p8~ )VP܀Ѐ .textЀ ) .data  *@.bss88VP.commentO* 8IppL IpZt@@(Pp@{@@ p@,\,\(,,@,@A0axppIL(Zpw O @{_pYp<+YCMYAA@A@@@@AOl)AQZ,ቀ(@w YAA@A@@@@AOl)A@{ Yp{Z@{L IpppIL(Zpw@{FpYp<+YC4YAA@A@@@@AOl)AQZ,ቀ(@wY@{ Yp{DŽ@{L IILYp(Zpw@{=Z@+Ppw@{0Z,@dpZ@?/PZ@?o~P{YpY@{L IpppI(%p @{{Z,| {L IpI ppppp p$p(p,p0p4p'@@AA@O @P%pL IpppI(tpt@+Ppwtp(xpx@+Ppwxp(p@+Ppwp(p@+Ppwp(p@+Ppwp(p@+Ppwp(|p|@+Ppw|pZ@&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AP"p@&AA@A@@@@AO\ A< O'@&AA@A@@@@AO\ A H"p@&AA@A@@@@AO\ A<OG@&AA@A@@@@AO\ A8"p(H"p8"@@<"p@D"p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ Ad"p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AD&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AT&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ A&p@&AA@A@@@@AO\ A< O'@&AA@A@@@@AO\ A &p@&AA@A@@@@AO\ A<$O'@&AA@A@@@@AO\ A$&p@&AA@A@@@@AO AAt,!@&AA@A@@@@AO AAx,!@&AA@A@@@@AO AA|,!@&AA@A@@@@AO AA,!@&AA@A@@@@AO AA,!@&AA@A@@@@AO AA,!@&AA@A@@@@AO AA,!L IpppILpYpY,A<ӒO',H@'p+'p ,\[{,\؄p,H@'p+'p ,\[{L IpppI,\P'pL IpppIO1O$,VބO$,V<0&O',H@'p+'p ,\[{Ԅ p{L IpI( pwO"1,qO^1,q,L IHLZD&p@&AA@A@@@@AO\ AD&pZ@<@C$@<@_$@@$1@(Zpw@@dpYp<YGY@@AA@OL@fPpYp{poYp<_YGY@@AA@OL@fPpYp{fJp<Z$(%p`fprpnpJpJp$@@AA@OL@$AAHHAOLAQpPp{o$@@AA@OL@$AAHHAOLAQpPpJpfp<%w"rpnprpnp$LpYp<YGY@@AA@OL@PpYp{poYp<_YGY@@AA@OL@PpYp{$@@AA@OL@$AAHHAOLAQpPp? #6#@@AA@OL@#AAHHAOLAQpPpfpfpJpTpTp`p`pvpvp<%<D& (%pw{"rpnprpnp<D&$LplpRpjphp~p|pppppplpfpRppppJp{L H IppHL  p  p ,@Yp ,@dpd@Y@p@AA(@CO1,$ꆀ{ pp,\,\=(@O,(&pO#( &pO&&p & &p,\O 2O 2O2O2O 2O 2,O2O2O2O2O2O2,O$2O$2O'2O-2O$2O$2,௢O$2O$2O'2O-2O$2O$2,tO62O62O92O?2O62O62,FOH2OS2O]2,$,\pOOg2,!O,,\`'p,\K(@CO2,$ꆀ,\$m@,ȉO8od,&(%p$!O?,%(<&pw ?@{@@'p?%p#, @#p('pUOO',@(@C9O2,pO,q'pOO2,%,\憀,\[@$p_Z#_Z#,h(@CO2,$ꆀD&,(Lpw(%pw$jhplpP'pL'p%p\&p'p%p_͐p_&p(%p&,\<0&O,H{pO,݉OO(,%'p@pOO'%,@(@CO2,$ꆀ%pLpKpKp,\69,\ƈ,\8,\,\,\O(O0 Ox ,t)+$p#,\O(Oj O ,t)$p&p<ZG$,\VG@'p''p( 'p%,D,\a(@C ,\8 'p+'p>(&p%@@,Zn,\O(O6O ,t)( 'pw($'pw+'pw{($pwP&,('pl((&p6(%pw-(H&p$,\0t@AA+AwP&,((&p&(%p,\a(@CP&,('pw ,\؄p,\O(O OP ,t)(@w{{ل@{L IpppI_,!@Tp(Tpw@{*(,!@Xp(Xpw@{@{L IpppIL(xpO(tp (Zpw{(ZpZ@Pp@{@pYpt@Y@+Pp"x@@<@YCZ@Y@tAYAQPpYp{քZ@Y@PpY@{L IppH<ZGZ@@AAHO3HX@{\zp(dp,௉@pApD9pH9p@{L H G IpG0Lp(Zpw$1<xG$1(|pC|pxYpY@YHp@AAAA@@Yp(YpG$1phpx@Y@<@hK$1h@Y@@AA@Z@PAApAp(pw O5p(tph@Y@@AA@t@Pp(|pO3@+Pp),<|@C O5p{G|GGpphdp(dpC$1d@@AA@Z@Pp(pw O5p(|pO?@+Pp5,<|@C O5p{d@@AA@Z@PG|GGp<$E1lp(p,p p$p,(@?D9 pH9$p,g(@D9(pH9,p{ p$p(, $,(@Clp{lp{,@lp(pw (lpC{](p (lpO{Pd@Y@@AA@Z@dAAHHAZAQPp(tp#d@Y@@AA@t@dAAHHAtAQPpYdpzd@Y@@AA@Z@Pp(tpd@Y@@AA@t@PphpzzL H G IpppI L(tpw O5tp(xpw O5xp(|pw O5|p(pw O5pt@+Ppw$x@+Ppw|@+Ppw@+Ppw$+3Z,@Yp(Ypw O5YpY,@dp<d @$3t@+PpYt,ቀ(@G @$3x@+PpYx,ቀ(@K @$3|@+PpY|,ቀ(@O @$3@+PpY,ቀ(@C @$3<G <G{BZ,@hp(hpC @$3<O<hK @$3<O <hG@{}(p OL9Z,a(@@{Ypdp($pJ< dCDd@@AA@$@(Ppw{/d@@AA@$@PZ,(@@{ dp{@{L IpppHLO>dplpp<tO <$tG{ @$5<xO <$xG{ @$5Z@?+PwZp{Z@?-PwlpZppZ@? PZ@?0P{Zp{pZ@+Ppw$-5Z@PYpY@AA+AY@@,@Yp?/Y_?9YWY@p@HoHHhp{,?o@Y_?oZYWY@p@HoHHhp{ @$5@t@p@HhHHp(pCO|9@$5pZpzL(pw O9@{kO3?dpd@Ppdp(p;d_2@x@@hpd@hAOW9AQPpdp@x@@p{(lp d@-Ppdpd@@{L H IppFLlp(tpCZ,@tpphp@{/Oe>@{&Oi>@{On>@{Ot>@{ Oy>@{L IpppI LZA_AAdpZ@_@@ZpZAO>dhY,8ቀ{ >pO>@{L IpIL(tpw O5tpt,@Ypp<tOtphpYp@0Pp{0ZHHHdpZZpYO>@< dG gA0A{gA7AAPpYp{YO>@{L H IHoTL@pHpPp(Zpw O5ZpZ@+Ppw @$<(tpG @$<B,:,,W&O=,W&,,\,.,W&,\,ʼn@?pdp,| (@,@dp{<,| (@,@dp{,| (@,@dp(dpO?d!,+?pwO?,D+?pwO??!,,\O,\@_,ÓpO,@Yp(YpG/pp{.Y@O@?/PY@O@/PpY@O@Pp@{L II<?O?,ʼn@{L IppHL_?pD@p<0@O.ZOE ,0(@0@,{ @$qG$p4@p8@pZhph@PA@@+@hp{h@+PpwzZ,d@0@pOEZ ,(0@pwt@Pp\@p{t@Pp\@pd@p?px?p?p?p@$qGd@pOB=,W&@p@p?pH,| (@,| (@w{HH?px?pt@P\@p`Bp(|pO[O =,W&@@p|,@lpOE,(@ `Bp{Z,@0@p,\3{|pZ,@0@p(0@pCW(|pO(&pw Z,^:,W&< |w @$qG{(`Bp@{@$qG0@,| (@waZOdB,ቀ(@MOOnBZ,50@,0@p$p,W&@$qG@<w@@@pOEZ ,t@(PpK$gDZO?,ቀ(@w\@p$gDZO?,ቀ(@w \@p{c+?pY0@,@Yp(Ypw OBYpY@+Pp)YO? ,0\@p(@ \@p{ \@p(\@pw"(?pw0@,0@p{T@p(\@pG$EZ,@AAp(AK$E0@,0@p$p,W&@<w@@@p<$EOtA,@p<O*OB,6OD@OB,8ቀ{`+tApV_,!@p(p?OBSOtA,8ቀ,ɀ(p,#p@$qG{ @$qG{ T@pt@(Pp t@\@Pp0@_TOh@, 0@_TO|@, 0@_TO@, 0@,ʼn@AA+Aw$F0@0@,ʼn@AAA,ʼn(@COB,6(\@p;_@p|p0@_TO|@, (@COB,6Z, /@,(\@pZ`@pO|@@<?w@@,,O@pOn@p0@_TO|@, @dp,\@?p,W&@<w@@@p@{L H IIZ<?@{@@,A.{L IppILdp(0@pC @$cI(?p @$cI?p(%p&,\̓_,ݰp,\(\@p,\(@OOC, 1(0@pO00@0@,ʼn@AAA,ʼn@dpdpBp(\@pw$OIO(=,W&@@p,@YpOE,(@dp|p(BpGBp,,\@dp<BGBp,,\@dp<BG-Bp|p,0@,@dp,\Y-(dpCO"COE,20@p$p@{L IILYp(0@pC @$J(\@pG @$JYp0@_TO@, (@C Y@$J0@,ʼn@AAlp(AC Y@$J@p@@@hp0@l@@@,ʼnO@p0@_T, (@C0@_TO@, (@C0@l,ʼn@{r_,,!OE,X+@,@p0@_TO@, (@C@{&lp0@l,ʼn(@C@{@{L IpIL(0@pC@{<(?p@{/0@_TOh@, @Yp(YpC?pY@{L IppI LZ,@Yp(?p5,\<@hp('pw5Z,@hp(hpC((lp+pwd@OO@Ppdpd@OO@YAOKAQPplp{Ypdpz(lp+pwd@OO@PpdpOOdO,h@p@{L IpppIL,\d憀@YpOEZY@+Pp OE@{ OB@@Y,{L IppIoDL(Tpw$w~(TpwOTO U,!(Zpw OUZp(tpw OUtp(xpw OUxp(Tpw,T ,(%@AATp(AC Tp{iTI@$@@,(@wOI@ @@Z ,It,I@ @@,TTI$,%<$@{{L II,\@,\*@,@{L IILOjYpdpjpZd_@@Y,QY@+PpY@? PW Y@o_PpYp{L II(y@$O䨓4UphUp@$tOU,4ZAAHHAO,UA@QpZ@@AA@O`U@Pp(]p t,kZ@@AA@O,U@(Ppwt,>}@{?{=Z@@AAHO,UHX@ZAAHHAO,UAQH G_GG p@{L H G IpppHLhpZ, (@ @$ɂ(Zp <Z{1O8UplUp𿓀pX迓p@$ɂIOU,%(|p|@<wIOU,%hp(]p t,btI,4ZAAHHAO,UA@QphUpZ@@AA@O,U@(Ppw$<Z <Z{%Z@@AA@O,U@P,݉$Z<Zwm((pwdZ@@AA@O,U@PA @@,ʼn@AAlpy<@w*H@@AO,UAQ@ A A+A@{@{{@{L H IpppILX迓p(𿓀pw @$Z{(𿓀pC𿓀p@$Z(%p1('pw(_@Aw@@$Vp$@($pC@{L H IpI,L(p(Zpw @$XZ,@$p($pG @$XZ p< $w O0V,ቀ(@w @$X @?o~Pw. ,8@ p( pw OU p @+PpwZ p I,,@$p($pC @$Xd@O@>_@@w(p((p (&pw{d@O@>_@@{O ,@$p($pC @{2{0UpOr _,U@p(@C@{L IpppILhp(Zpw @$GZ,@dp< dwZO0V,ቀ(@w @$GZlpl@?o~Pw(l,7@lp(lpw OUlpl@+PpwZlplZplp(&pwZ,<(@ @$Gd@@@,!@lp(lpwOO:V,>y@$GlZ,%dYp(YpO"Y@l@p@AA?/Qwhp{Yp{(hpz(YpOuY@l@p@AAQpl@+PpZl,!<(@wNl,@Yp(YpO.Y@l@p@AA?/QwY@l@p@AAQp{Yp{(Ypwl@Pp{{l@Y@.PpYpl@Y@Ppl@+PpwlORV,%l,@dp(dpC{l,#(dpC@{@{L IppIL(%pYp{Z, @YpY@{L IIZt_,L IpG_(Lhplppp(tpw$(Zpw OUZpZYpY@?o~Pw(Y,5@Yp(Ypw OUYpY@+PpYZppHZO0V,ቀ(@wHHp(pw/(|pw*ZI@@@,I@@@d_,ቀ{k(pw<|wI@@@Z_,ቀ{G(pw*Z,(@I@@@OTVZ,8ቀ{I@@@Z_,pIGGGpIG_GGp p$p@+Ppl<_$Gc p< O'@+Pp@?/P p{䀩 p{@?/Pw p@AQPppp$p{@PpI@@@I@_@@_,(xp (pw{tI@@@,$IGGGZptdpZ@+Ppy<UlCpZ@? P_hp(hpwZ@? PW{LZ@PA@@+@ p{Z@PA@@+@pd@ZAQPpdplpZp{d@Ppdpd@? PW,\xv@,h@p(p@ A+Qpw {lp{ @ lpl@@p@p@+Pp@p?/Pwp{,\p>lOyVt,􉀠,{<Uw @$[h,Z@@AA@O`U@PpdOU,ʼnZAAHHAO,UA@Qp<Zwr(piZ@@AA@O,U@PA @@,ʼn@AAp@w>Bw @$={ @$=jpZ_Oj,c((@ OjYpnpt_On,>((@ OndpYd,ቀ(@w @$=Y,1%(@ @$=d,%(@o`pd,@hpd@h@p@AA?/Q h@On@/Pph@On@PphpYI@_`@@,hOn@@`,%,x@GGpdp40p ,px@p(@ <@m{}@O@>_@@w _@p(dpZ@@,@Dp(xpC@{G(hpw@{>ZI@,@@, (@Yp{Yp{@<4$K@@Yp{YpY@{L H G IppI(%p@{*OvO<[Zt,8ቀOv,@{L IpppI(%p @$((p)('p OvOI[t',8ቀ{G('p OvOU[t',8ቀ{ OvOb[SZt,8ቀOv,e@{L IppG LYpZ,@H|[,HA@AAGGGplp<p[lC@l@@AA@t@(Pp)l@@AA@t@P,#l@@AA@t@Pplp{p[p,!@Yp(Ypw @$YO[|[Z,8ቀY,߀lpOdpp(4$p,\X@H{/쿓p(쿓pK俓@PH俓p{ ,\J̈́@HH@@p<@w$p? ? $d@PpOdpd,3<@w$dd,@p(|Vp (pwzR(Vp (pz@d,@p@@@,!@hp(hpw{BhO,%l@@AA@t@hPplpy@$[,@[p[,@[p[,r@[p[ptpxpYOd,:(YpY@pY,#Yp{@{L H G IpG_LIGGGppp4p8p_@Aw@{@@4p{!tOcV,04p(@w4p{:tOd,,<@@dAOA>_@Aw@{@@4p(Vpw[@?.Pw Vp(Vpw:[@?.Pw,[@@?/P[@@?.P Vp(Vpp(Vpwp(VpG$(4p$xpx@Ppt@?/Pw tpp{=xGGGppDp_@Aw@{@@4p{4p{:tOd,,<@@dAOA>_@Aw@{@@4p(VpO1(4p+[@?*Pw[@@+Ppw t4,tp(4pZ@{ [@@p(4p*(Vpw!([pO(8pw(_@Aw@{@@tp(|Vp (tpw{(Vp(tpw{$ƀpZ@?.PwZ@@?/PwZp{p(pCp$ƀZ,@HHHYp@Y@p@AtA[@[@<@A_ p{zZ,%(tp?Y@@p@AA?/Q'Y@@p@AA/Qp@Y@PpYp@PppYppL H II_LL<\O[@$pȀ,\xv@\pO\,@AADp(AoI@oD@@D_,I@oD@@,(@AAHp(A8H@<\w)O[I@oD@@o@,O[@$pȀ,\@AADp(ASIDo@,I,(@AAHp(A+H@<\wO[I@oD@@o@,\,h@AAHp(Aw[p\p@{#O[H@Po@,O[@{L IpppI LZ@?o~P Z@$ɀO\Z,ቀ(@wO ]@$ɀ$PɀZ,@hpdpOkVOG_OyVZ,􉀠OkV,>}_,􉀀@{L IpppIL|p(xp9<0@O00@,@0@,@0@,,\p>Zt,Է@Yp(YpCL IpppI$L('p @$̀,\􉀄@AAYp(A$0̀OkVp,\u(@ ,OsV,@dp(dpw>,\xv@,h@p(p@ A+Qpw {dp{ @ dpd@@hp@lpl@+Ppl@lp?/Pwlhp{,\p>(Zp Z@+Ppw{dhOJ_,{dhOyVZ,􉀠,$̀_@Aw@{@{L IpppILpZ,@lp(lpO <_lG{ @$0Ѐl@@@,!@AAdp(Aw @$0ЀdZ,%d@?o~Pwzd,@Yp(Ypw OUYpY@+PpXY,@AAA,!@AAp(Awd,#dp@$0Ѐd,#dpdY,%dYpY@?/PwYppY@+Ppw$ ЀY@?/P$Ѐ(%p@$0Ѐ$π('pw (%pw{o('p7(@@+@w{('pwG7(@@+@w{6('p+(@@+@w#{('pw+(@@+@w {@{gY@PhpY@Ppd,(@w1d_,É@lp(lpCd,#dp@{%{pY@hPpYpzd,#@{L IpppI(%p@{Z,ɉ{L IpppI쿓p4UZ,(@@{@{L IppG_LLIGGG,p0p4p8p<p@pZYp(Ypw @$ՀY@+Ppw @$Հ(xpw @$ՀxZt,@P_pxT_pX_ptdpY@?o~Pw2Y,W@Dp(Dpw OUDpD@+PpDYppY@+Pp2Y@?.Pw$Y@@?/PwYpY@?/PwYp{{{{ɄY@+Ppw @$ՀY@?/Pw+xYd,x,@<p@p$NҀ,\Ȅ@AAHp(AgxHd,@<px@<@/Pp<p<dpY,@AA@p@@$,(%p&"p&"p{((p""p{<D#w oN蓀p{"蓀p蓀p<lG蓀p"pO瓀@$ <""@0@{oB@@蓀p<lG蓀p"pO瓀@$ ("p7("p"蓀p{#@p@AA"pA蓀p{ 蓀p<lG2蓀p(#p#p#p4#pO瓀@$ (@#p <#H{HHG((#p $#GpGF(#p  #FpFE(#p #E(4#pE@0#@ @_@{ E@ @_@@蓀p< lGd"pO瓀@$ (#pg"@ @{!@@蓀p< lGoPL"pO瓀@$ <lOZAAQ@o@_@{ "@@YpY@(YpC "@@"p"",c@"p"p#p<lOGZ@@PApA@o@@G_GG"p<lOZ@@PGo@GG#p{ #p("p7p<"C)#@@,NAOA@Qpp{<lOZAAQ@_@{ @@#p+#p?#W{ #p<lOZAAQ@{#@@Yp< YO <>YO{"O{_{?o__?o~_{"p"p{ "p8#p #p#p,#p<D# D#p dp< lG$%Z@ @PApA@o@@G_GGYp@YA$#Ap(A((#p@@,#p@YA #Ap(A(#p@@#p@YA#Ap(A(#p@@ #p@YA0#Ap(A(4#p@@8#p<D#0@YA<#Ap(A(@#p("p@@D#pp dpZ@d@PA_AA@@+@ ((pw$>(Pp$>O <p(Tp(\p (Xpw{D<pO蜐O <T<Tw OA@{ OC@@X<Xw O @{ OG@@\<\w O @{ OG@@D,8ቀPpHpO蜐,@Lp{蜐pHpLp<LHC'H@O蜐@P$pHp$@{ {@{L IH_LYppp@(DpO@@(p@(@pO@@,p@(<pO@@0p(Zpw O ZpZ@+PpI@@@Z_,{I@@@OI,%TpXp\pI@@@_I@_ @@,Ѐ(@IHHI@@@,HA@AAYp((pIO蜐OMI@_ @@DD,8ቀHpO蜐,@Lp'pI@@@,̀(@wVI@@@,̀(@BIAAA pYpY@?/Pw Oc,D{ Oe,Dx$p(0p x$p(&p x$pI@@@x$,@PpUP,f/(PpG @$A|$p&pI@@@,<_@G OԛOhI@@@,8ቀ{OԛOu,%ܜppѓpO:Лp,\h@p@{L H IpH_ Lpp<LHC!HAO蜐AQ@Hp$>D(PpG$bCPpI,+YpwPp,\ϕ$>DI,@pI,IH@HHpR(蓀p<蓀O 蓀p@(蓀@p@F蓀FF(蓀p@@FFp@CFCCp@ 蓀@p@F蓀FF 蓀p(,蓀pG _M,蓀p 蓀@,蓀@p@F,蓀FpF@@FFFF@@,蓀p,蓀FF@F@@F(蓀FpF@_@p@CCC\p<t"G\@@@\p{@dѓ`",򟁀@hp(hp@{&d,ƚ@Yp(YpC@{d#p@{L H G IpIѓO,{L IpppGLѓhph@@AA@Oѓ@Pdph,rh,ƚ@AAYp(ACpoYhO,@lpp(lpCl@{Zp"O$p+tѓp{"lp"p"p"poYOtѓ,@Otѓ,@hp(hpC h@$s#ZO,"pl"p{'oYZO,@hp(hpC h@$sx"p('p,(?pw#(p%#O,@$s{ @$sYAA@A@@@@ADA@p<\"@O&P&p@$s,\ΠYAA@A@@@@ADA< wy(@'phZ,kx"p('p,(?pw#(p%#O,YAA@A@@@@ADA@$s{ @$s("pO,\$mZAAHHAO0铀A@QpYAA@A@@@@ADAYAA@A@@@@ADA ,b@hpx"p('p,(?pw#(p%#O,oSZYAA@A@@@@ADAYAA@A@@@@ADA ,YAA@A@@@@ADA@{L H IIL,'pຐp(&p(&pOZ,('p$(?pw(p Z,Z,ހoE#𺓀$,@Yp $ZoP,&dp&pp,\ā4',rǁd&p(d'p "@@\p@"pd'p<&$u('p ('pw$u('pw$u<`"G(d'pw$ulp('p((?pw(pOͤ,p(@COvp@{FoO#h$, @dp(dpCOp{@?o@l@@dpd@{L IpppHLYpdppp((pwO(p(@+PpwOp@$}(xpw$,|pphp<#G$y,!@p(pwOp@$}I@@@Oץ#,8ቀI@ @@,@YpcH HHipY@@@,!A@Qp@(PpwOܥp@$}@PI@@@,%@p(pw pp<#G$z,!@p(pwOp@$}I@@@O#,8ቀI@ @@,@YpcH HHipY@@@,!A@Qp@(PpwOp@$}@PI@@@,%@p(pw p{ @pp(,@Yp8"@@<@YOO8p@$},!@p(pwO5p@$}Y@@@,!A@Qp@(PpwOQp@$}@Pdpd@oFPpdp}ODOt,\d憀@,8ቀx@ODPp{R(Zpw't_OD,Ѐ(@x@ODPp{((Zp#ODOt,8ቀx@ODPpd@{L H IppIL_Z#Yp_@#dp<'dG(dp{<_dO_dpY@d@@d"p< d"O d"p<d"O d"p{(d"pG d"pdd"Y,M@P"pP"` pP"L"p$@Y@Pp$,@lpoA#l$,d{{@{L H IpppHL<w Op@{sZdpd@dp?oNP O@{X{Qd@PAAYp? A_@Yp_YpY@<@WY@@AAHOxHX@{ O@@dpd@{L H IpppG LZ@?oNPwEZ,Z@حp(&p#(&pOح,򆀄@$z<&$jZ@?1P$jZGGGhph@PApA@o@@G_GGYphpdpY@Yp(@O.dAA@A@@@@AoAh@PHpAGHGGdphp{(dpO d'p('pO',`Ѐ(@C@{N<w5('p,(?pw#(p$O,Oحp@{L H G IpppGoHL apOpdp(T&pw(瓀p+ӓp OӓdpO|(&p5<&,(&p#(&pO2O,(&pw$sʁ<&}(􉐀pwt(pwk('p((?pw(pO,(&p3(&pw*&ܢ$&O䱐,(('pw@$r6$߁('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{ ຐp$o6&p(&pw &pH'p(X$pw$(\$p$O,&s,\D('pw@$r6$('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$⁀('p3(@@+@$၀{('pw3(@@+@$၀{O,&s,\S('pw@$r6$၀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$⁀,g(@K$}⁀,\('pw@$r6${⁀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{ ຐp$o6(X$pw$぀(\$pw}O,&s, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$぀,g(@K$぀,\D('pw@$r6$぀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{ ຐp$o6(X$pw$t䁀(\$pw}O,&s, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$V偀,g@AAT͐p(AK$4偀,\('pw@$r6$2偀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{$(T͐pw ຐp{,\mຐp$o6(X$pw$偀(\$pw}O,&s, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$恀,g@AAT͐p(AK$恀,\h('pw@$r6$恀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{(T͐pw ຐp{ ,\m$o6$lphOR߀,|䀀,R߀,R߀$@+Ppw$>聀$@P'p(X$pw$灀(\$p$灀?oI'w$灀?oL'w$灀?oH'yO,&s, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{N@'p&p(d'pw'("pG"",c@"p&p ຐp$聀O:,&s,\,('pw@$r6$聀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$o6(X$pw$遀(\$pw}O,&s, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$t쁀('pK(@@+@$sꁀ{('pwK(@@+@$sꁀ{OV,&s,\('pw@$r6$mꁀ('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$t쁀('pw$3끀Ok,&s,\('pw@$r6$-끀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$t쁀$lphOR߀,|䀀,R߀@'p&p$O亐, G(@F&p(d'pw'("pG"",c@"pຐp$t쁀O,&s,\('pw@$r6$t쁀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$o6,\U@\͐p<\͐O\͐@$r6$o6O,&s,\('pw@$r6$P큀('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$o6<%Y<9YOû,&s,\ ('pw@$r6$ ('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$o6,\P@\͐p<\͐O\͐@$r6$o6('p+(@@+@$-{('pw+(@@+@$-{OỐ,&s,\('pw@$r6$'('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$t󁀀p$@@@,bE@T͐p('p(&O$@@@O亐,=(T͐p$,&s,\('pw@$r6$x%('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{(( 'pO亐,q,\mຐp$o6h,* ""p<" "@{@@"p<&$&(,#p(8#p$&{OO,&s,\d('pw@$r6$&('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$V(&p&p&,@T͐pp(T͐pw$q'(&pw<w p,\,\m,\:('p=&('p O庐@{ O亐@@OrOpO亐,=ຐp$V((&pw  $@{ Ow@@X͐pX͐@+PpwOX͐pX͐,&s,\('pw@$r6$V(('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp$o6,\F$o6,\F$o6,\F$o6$lphOR߀,|䀀,R߀ȿp$@+Ppw$Y)<&w$Y)< <{1('p((?pw(p$,(&p#(&pO$,򆀠O䢒$,!(,#pw$G*&@&@@,(@K$9*O,&s,\ޡ('pw@$r6$7*('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp{ ຐp$+h",~(@K$ +Oþ,&s,\ ('pw@$r6$ +('p'p@$r6{i, (@C @$r6,\@'p&pO亐 (p&pp&pĺ&p ຐp,\@AAT͐ph( 'pw ((pw {O߀@{ On@@,|䀀(@K$-=Oᾐ,&s,\('pw@$*?$=('p'p@$*?{i, (@C @$*?,\@'p&pO亐 (p&pp&pĺ&p ຐp@$*?${>(hpNh@+PpA((pO亐,{&( 'p,\r(@w{O亐,q('p((%p_,l'p,G,rǁ(pw(􉐀pw 𢒀p,\('pw@$*?$r>('p'p@$*?{i, (@C @$*?,\@'p&pO亐 (p&pp&pĺ&p ຐp@$*?$%?H,&s,\('pw @$*?{{('p'p@{q{e, (@C@{\,\@'p&pO亐 (p&pp&pĺ&p ຐp@{@{L IpHL('p(&Oǐ$@@@O亐,=$@@PYp?oQY$D('po(@@+@$|@{('pwo(@@+@$|@{Oǐ,&s,\('pw@$G$m@('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$DOppp$HHHhp$,@dp$@@PYp$@@?o\Pw$$HHHhph@?o\Pwhp$)B?oKY$Ah,@p(pOE@h@p@AA?)Qw0$HHHhp$@@o\Pp$@@ofPp{O$@@o\Pp$@@ovPp$@@(Pp$@d@)Pp$@d@p@AAQp{~$@@o\Pp$@@ovPp$@@(Pp$@d@)Pp$@d@p@AAQp?oSYw$@@$Pp{?oGYw$@@omPp_dpOlphI@ @@I@@@,((@K$&C(dpO OȐ@{ OȐ@@,&s,\('pw@$G$C('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$DO,ހ<@G$D$,n𢒀p,\#('pw@$G$C('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$DO,23(@ຐp@$G$DO$Ȑ,&s,\@('pw@$G$D('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$G?oSY$G('pk(@@+@$E{('pwk(@@+@$E{O5Ȑ,&s,\8('pw@$G$E('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$G$@@PApA@o@@H_HHpp$@@Pp$@@@$@@p@AAA,Vބ(@COLȐ,&s{,\m𢒀p,\ ('pw@$G$ G('p'p@$G{i, (@C @$G,\@'p&pO亐 (p&pp&pĺ&p ຐp@$G$GO:,&s,\R('pw @$G{{('p'p@{l{e, (@C@{W,\@'p&pO亐 (p&pp&pĺ&p ຐp@{L H IpH_L('p/(@@+@$H{('pw/(@@+@$H{OaȐ,&s,\]('pw@$K$H('p'p@$K{i, (@C @$K,\@'p&pO亐 (p&pp&pĺ&p ຐp@$K$K$@@PApA@o@@H_HHp@$@p@AAQ@p@AoAAH_HH pI@@@$@@@,ቀI@@@AAQpI@_@@@@@A$AA ,ቀI@_@@A AQp('p(&OvȐI@@@I@_@@,=('p+(@@+@$ K{('pw+(@@+@$ K{I@@@I,ΕI@_@@I@@@,ΕI@@@Y,ቀ(@w I@_@@d,ቀ(@w$ KOO,&s,\('pw@$K$K('p'p@$K{i, (@C @$K,\@'p&pO亐 (p&pp&pĺ&p ຐp@$K< ຐ$KI@@@I@_@@,(@OȐ,&s{𢒀p,\m,\#('pw @$K{{('p'p@{q{e, (@C@{\,\@'p&pO亐 (p&pp&pĺ&p ຐp@{@{L H IpppH_L('pO(@@+@$L{('pwO(@@+@$L{OȐ,&s,\xˁ('pw@$P$L('p'p@$P{i, (@C @$P,\@'p&pO亐 (p&pp&pĺ&p ຐp@$P$P$@@PApA@o@@H_HHp@$@p@AAQ@p@AoAAH_HH pI@@@$@@@,ቀI@@@AAQpI@_@@@@@A$AA ,ቀI@_@@A AQp@$@p@AAQ@p@AoAAH_HH pI@@@$@@@,ቀI@@@AAQpI@_@@@@@A$AA ,ቀI@_@@A AQp('p(&OȐI@@@I@_@@,=('p+(@@+@$O{('pw+(@@+@$O{I@@@I,ΕI@_@@I@@@,ΕI@@@Y,ቀ(@w I@_@@d,ቀ(@w$OOO,&s,\xˁ('pw@$P$O('p'p@$P{i, (@C @$P,\@'p&pO亐 (p&pp&pĺ&p ຐp@$P< ຐ$PI@@@I@_@@,r(@OȐ,&s{𢒀p,\m,\xˁ('pw @$P{{('p'p@{q{e, (@C@{\,\@'p&pO亐 (p&pp&pĺ&p ຐp@{@{L H IppH_LYpDppp$@@+Pp&$@@PApA@o@@H_HHp(X$pw$U(\$pw$Q(pOOȐ,&s$Q('p"&OȐO亐O亐,=(&p#(&pOȐL$,򆀠OȐ,n𢒀p_,l\$p(%p ,\Zᆀ$U(pG$Thp+p+pw,Zψp$4^+p!+p,Zψplp+pr+pwh,>(@wX?os'L𢒀p('pOʐ,J{(&p#(&pO%ʐO?ʐ,{("pw ,\`,\𢒀$pp+p"+p(lpw,Zψp(ɐpw$&_(Xpw$&_(Lpw{(%pwr(Ypw(+p_,p{Yp(dpw(+p_,p{dp(dp (Ypw{O`ʐ,܏+pd'pX'p(𢒀pw8&P&p(&p#(&pOxʐ $,򆀄"&p<O"pp&pĺ&p<"O""p"p&&p&&p$pL IH_L'hpip"p𢒀pغpԺpܺp('pw$`,\a(@K$`('p,G𢒀p$g?og'wX((pO(@?oLP"(@?oFP(@?oXP{ 𢒀p{Oʐ,J{$g('pI($pC@(%pw7('p((?pw(p Oʐ,$gYpOI%L&,@(@C7('p((?pw(p Oʐ,$g@ΐp{(&pOѐ,J{{}ΐ,@pΐt,,#(@Q(&pOѐ,J{{6tGGGpOѐ,J{,>퓀pΐp{jZ@+PpwOXӐ,J{{OaҐZ,J{OӐΐΐ,J{O,{OeӐY,J{@{,"-@YpzL H G IIZtx|O0ϐ,W{L IIZtx|O0ϐ,3{L IIZtx|O0ϐ,{L IGoHLlpp(xpw O0ϐxp(|pw O0ϐ|pxΐp(ZpwOӐ,J{@$,@dpΐppΐpGGGpΐp퓀@@p<@w)|,<(@COҐ,J{@${@<w@@,+@p,\mΐp@<@C$@<@_$@@$DՐ,\$m<Ծ@C@<w@@,|+@p{{4(%p"OhАԾ,J{,@$퓀p@$OА,J{@@퓀p$ΐp(ΐpw<|<w@{@@,;@AAp(ACOҐ,J{@$<w(ΐpw @$(pw$۪ΐ$pΐ(p_ސpΐI@$@@OސH,X(@C @$(@+Ppw|(pOΐΐ,(<w@{@@,;@AAp(ACOӐ,J{@$(pZΐ@?/PL@@+@/(&pOѐ,J{OԐΐ,J{퓀p@$(pI,p<,C>ΐ@,@?:Pΐ@,@?=P{ΐ@,@Pp{,p{ZΐtI@ @@,A@hph@<@#<@G <@$䬂<@a$䬂$<퓀p@@+@8(&pOѐ,J{OԐΐ,J{@$@$(dp2Yp@hpԐΐ,J{퓀p@$lAA@A@@@@AZA,9(@a@@+@wU@@+@8(&pw/(&pOѐ,J{O%Ԑΐ,J{퓀p@$lAA@A@@@@AZA,(@w$`lGGGOD/O|7,$%OH/O7,$%OL/O7,$%@$%O4/O7,$%OP/O8,$%OG8,J{OLOzO<踑,ȧ@AAZp(AC Z@$%,\΂@AAYp(AC Y@$%Z.p𢒀p@$%OOzO|踑,ȧ@AAZp(AC Z@$%,\΂@AAYp(AC Y@$%< Zw.p.p{ Z.p𢒀p@$%On8O I踑,l@ZpOYZ_?,Z$%O8O8 I踑,l@ZpOYZ_,Z$%O.O8,@AAYp(AC Y@$%(.pw$., 9(@woO8,J{.@?(PwO9,J{.@?/PwO"9,J{(.p.,#.p@$%Y@$%O, Z@AA𢒀pA@$%OOzO 踑,ȧ@AAZp(AC Z@$%,\΂@AAYp(AC Y@$%Zp𢒀p@$%O.O89,@Yp(YpG Y@$%(.pw$., 9(@wSOZ9,J{.@?+PwO9,J{(.p.,#.p@$%.O ,ቀ(@$ (.pwO.O ,!(.pwO.O9,!( p$,!@AAp(Aw$O9,% p,!@AAp(Aw$O9,% p,!@AAp(AQO9,% p,!@AAp(AO9,% p(.pwO.O ,!{n(.pw/,!@AA.p(A.O/,%(.pw/,!@AA.p(A.O9,%.O9,ቀ(@w tp𢒀p@$%O.O9,&$%O.O9,$%O.O9,$%O.O:,$%O.O+:,$%O.O@:,$%OU:OzI@@@,@AAlp(AC l@$%h@+Ppw$A퓀ph@?o\P$Ah@@Pp@AA+A@@,@p?ofrhO:,,#(@ZhO: ,,#(@BhO:,,#(@*_lphI@@@I@ @@,(퓀hpO.h,!@$%O.O:,v$%O.O:,^$%Ox, Z@AA𢒀pA@$%p<O$(pw<&Zw O:@{ O1;@@8p{<&Zw OY;@{ Ou;@@8p8OzI@@@踑, @AAYp(AC{x(hpjh,@,J{𢒀p@$~4,\ O0,J{(%pO%@@AAHO4HX@{@@Yp(Ypw$I4O6>/@(/pwYAQ@@,J{O<>,J{(H&pwOV>,J{{B<H&wO[>,J{{)<H&wO_>,J{{Oe>,J{On>,J{.@(.pw YA@@p(pwO>,J{$(@@+@O>,J{@@+@O>,J{@@+@O>,J{@@+@O>,J{@@+@O>,J{@ @+@O>,J{@o@@+@O>,J{@o@+@O>,J{@_@*@O>,J{O>,J{.@(.pG YA@@p(pOO>,J{{O>,J{O>(.p Oj @{ Of @@,J{O?(.p Oj @{ Of @@,J{O!?(\.p Oj @{ Of @@,J{O=?(\.p OT?@{ O\?@@,J{Of?,J{(.pwO?,J{{K<.wO?,J{{2<.wO?,J{{< .wO_>,J{O?(|.p O@{ O@@,J{O?`.,􄀠@,J{O?<d.<d.G O@{ O@{ O@@,J{O?(p.p Oj @{ Of @@,J{.@(.pw YA8@@dp@lpO @d,J{l@AoWA+AO)@l@@,J{O3@,J{Oq@(.p @{*@@,J{.@(.pw YA@@,pރO@(.p @{*@@,J{.@(.pw YA$@@,pރ('p@{@@hphp&@@<@hO,\(@w @$~4{hpO@(.p @{*@@,J{.@(.pw YA(@@,pރhp&@@<@hO,\(@w @$~4{hpO@(.p @{*@@,J{.@(.pw YA,@@,pރhp&@@<@hO,\(@w @$~4{hpO@(/p @{*@@,J{(/pw{/@(/pw YAT@@,pރhp&@@<@hO,\(@w @$~4{hpO@(/p @{*@@,J{/@(/pw YAX@@,pރhp&@@<@hO,\(@w @$~4{hpOA( /p @{*@@,J{ /@( /pw YAL@@,pރhp&@@<@hO,\(@w @$~4{hpO.A(/p @{*@@,J{/@(/pw YAP@@,pރhp&@@<@hO,\(@w @$~4{hpOIA(/p @{*@@,J{/@(/pw YA\@@,pރhp&@@<@hO,\(@w @$~4{hpOdA(/p @{*@@,J{/@(/pw YA`@@,pރhp&@@<@hO,\(@w @$~4{hpOA(@_$G@@$XZ,8͆@dp<_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ A@?@_$:TOO p((p$TSOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@@A @A@$5TOp(,pK2<1,G,,AA pA p  pA A$T<_,O><_,G6,FoFF$p$(p$(p((pA(A{I<_,w7,F_lFF,p,0p,0p00pA0A{ A_ AAA4p @4@P@{ OK@@踑,ȧ@AAdp(AC d@$,\΂@AAlp(AC l@$((pw$UO8p(,pK!<1,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_lFF@p@A@AAA8@A@{ 8@_ @gpODp(,pK!<1,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_lFFLpLALAAAD@A@{ D@_ @gp$&WOPp(,pK!<1,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_lFFXpXAXAAAP@A@{ P@_ @gpO\p(,pK!<1,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_lFFdpdAdAAA\@A@{ \@_ @gp$cO%4&((p OkK@{ OK@@((pw$XOhp(,pK!<1,G,@@A@AAAh@A@{s<_,O1<_,G),FoFFlplAlAAAh@A@{<<_,w*,F_lFFpppApAAAh@A@{ h@_ @P@$XOtp(,pK2<1,G,,AAxpAxpxxptAxA$X<_,O><_,G6,FoFF|p|p|pptAA{I<_,w7,F_lFFpppptAA{ tA_ A@?@_$ZOOp((pw$YOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @P@@A@A@$ZOp(,pK2<1,G,,AApAppAA$xZ<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ AAAp@@P@{ OK@@踑,ȧ@AAdp(AC d@$O%4&((pw OkK@{ OK@@((p$[Op(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@$g\Op(,pK2<1,G,,AApAppAA$c\<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ A@?@_$'^OOp((p$A]Op(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @@@A@A@$"^Op(,pK2<1,G,,AApAppAA$ ^<_,O><_,G6,FoFFppppAA{I<_,w7,F_lFFppppAA{ A_ AAAp@@P@{ OK@@踑,ȧ@AAhp(AC h@$,\΂@AAlp(AC l@$((pw$aOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFF p A AAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @gPpOp(,pK!<1,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_lFFpAAAA@A@{ @_ @gpO p(,pK!<1,G,@@A@AAA @A@{s<_,O1<_,G),FoFF$p$A$AAA @A@{<<_,w*,F_lFF(p(A(AAA @A@{ @_ @kpO,p(,pK!<1,G,@@A@AAA,@A@{s<_,O1<_,G),FoFF0p0A0AAA,@A@{<<_,w*,F_lFF4p4A4AAA,@A@{ ,@_ @kp$cO8p(,pK!<1,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_lFF@p@A@AAA8@A@{ 8@_ @gpODp(,pK!<1,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_lFFLpLALAAAD@A@{ D@_ @gpOPp(,pK!<1,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_lFFXpXAXAAAP@A@{ P@_ @kpO\p(,pK!<1,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_lFFdpdAdAAA\@A@{ \@_ @kp𢒀p@$O,(4)OKOz踑,ȧ@AAlp(AC l@$l@<@C$kl@<@_$kl@@$0ZO! "OKO踑,ȧ@AAdp(AC d@$,\΂@AAhp(AC h@$dYp𢒀p@$OX, Z@AA𢒀pA@$OY, Z@AA𢒀pA@$OKOzI@@@踑,@AAhp(AC h@$(XpX,#Xp(p@+Ppw{Xp𢒀p@${^,@AAA,!@AAXp(A&X,%𢒀p@${𢒀p@$O& 'OzO&踑,ȧ@AAdp(AC d@$<dwvO 't'OzO&踑,ȧ@AAdp(AC d@$,\΂@AAhp(AC h@$dXp𢒀p@$$g<dwrO 't'OzOj 踑,ȧ@AAdp(AC d@$,\΂@AAhp(AC h@$dXp𢒀p@${6,\΂@AAhp(AC h@$dXp𢒀p@$O OzOj 踑,ȧ@AAlp(AC l@$,\΂@AAhp(AC h@$lXp𢒀p@$O OzOj 踑,ȧ@AAlp(AC l@$,\΂@AAhp(AC h@$<ܾ<ܾw<ྑw{𢒀p@$lXp𢒀p@$O%4&OzOy%踑,ȧ@AAdp(AC d@$,\΂@AAhp(AC h@$gpgpgpgp𢒀p@$O%4&OLOL踑,ȧ@AAdp(AC d@$O%4&O LOL踑,ȧ@AAhp(AC h@$,\΂@AAlp(AC l@$kpgpkpgp𢒀p@$O%4&O[OL踑,ȧ@AAdp(AC d@$O%4&OLOL踑,ȧ@AAhp(AC h@$,\΂@AAlp(AC l@$g೓pk᳓pgⳓpk㳓p𢒀p@$O&OzO8&踑,ȧ@AAdp(AC d@$O OzOf 踑,ȧ@AAlp(AC l@$,\΂@AAhp(AC h@$d@<@K<@<@W4@@$ZlXp{ lXp{lXp{ lXp{𢒀p@$O OzOj 踑,ȧ@AAlp(AC l@$,\΂@AAhp(AC h@$(%p((pOL,J{𢒀p@$lXpup𢒀p@$O.LOzI@@@踑,@AAhp(AC h@$<@w$2o<@G(@w$n$p<@w$o<@w$o$p< @w$p< @G<@w$Fp< @w$o$p< @w$p<_l@$p,\΂@AAhp(AC h@$%@@,Zn𢒀p@$OLOL I@@@踑,l@AAhp(AC h@$<d$<dOL,J{𢒀p@$,\΂@AAhp(AC h@$<dw o͐p{<dw _͐p𢒀p@$OLOV5 I@@@踑,l@AAhp(AC h@$,\΂@AAhp(AC h@$d,*˂@AA𢒀pA@$O丑, Z@AA𢒀pA@$O좒, Z@AA𢒀pA@$I@@@, Z@AAdp(AC d@$h,h p(hp O(@{@@踑p𢒀p@$OMO#M I@@@踑,l@hpO &dh_,Z$O&MOBM I@@@踑,l@hpO&dh_,Z$O`&, Z$O쾑, Z$@$Z@<@w$yr<@G <@1$r<4@$r,N@AA𢒀pA@$O ,OzOz踑,ȧ@AAhp(AC h@${W<hw7O&, Z@dp(dpC d@${𢒀p@${,\΂@AAdp(AC d@$(%p((%pOL,J{𢒀p@$h@<@,<@G(@ {W<@9{P|&p𢒀p@$OEM,J{𢒀p@$|&p𢒀p@$@${^OlMOM I@@@踑,l@hp(dpCdpO%dh_,Z@AA𢒀pA@${Z@<@Z<@G<@[<@w$s$FuO(dp O @{ O/@@Oz,ꆀ@'p'@${*(dpO p{ p𢒀p@$O", Z@AA𢒀pA@$@$Z@<<@$<<@G <(@9$~<@G (@$-<@A$-O", Z@AA𢒀pA@$OjU,J{@$O9NOz I@ @@踑,l@AAdp(AC d@$,\΂@AAdp(AC d@$< lO <>lO{OOX\,ቀ(@OZ\O,J{{O\,J{{c(H&pwhp{0,\0t@AAYp(AKYHHHhp{,\a@hphhp(,&pwhp(hpO\O,J{(hpw(ZpwC<Вw:('pw{/(Zp O\@{ O]@@,@dp,J{dpO],J{Yp<_YG7Y@@AA@O0@AA+AdpO]Y,J{Yp{(dpwO>,J{O],J{L IppI_ L_pIpOpqI@_@@I@_@@,(,\⟄,|ΐOyqZ,8ቀΐO~q,DOmOmI@_@@I@_@@I踑,@(@C@{,\r|@{L IpIp@{L IpppH$L(qp$)qpYpdp(ܸpw+_,!@AAܸp(AwOq,$ꆀܸOq_,<tw %p{(tp$)<YG$d@@PA?-Qw$d@@POq,ቀ(@w$d@@POq,ቀ(@pd@@P,@p(pwd@@P,@p{ d@@Pp(pwP&,_O$,ЀYpdppYp(YpG$)dpd@PHHHlpd@PA?=Qw$)d@POq,ቀ(@wgdpϒpd@(Ppw$) pd@P,S@p(p_O$,Ѐ$){P&,d@POq,ቀ(@w$)$&d@PA?-Q$&d@PAAQhp+hpw$&hApA@<+@C$+@(@$(%pw}(&pwdOs,J{Os,J{Os,J{Ot,J{O>t,J{Oit,J{Ot,J{h&p@$(lpH+p>((p+pw,Zψ{((pw+p ,Zψ,\z@Yp+pw$+pw$(%pwx(&pwo,\a(@KdOs,J{Os,J{Os,J{Ot,J{O>t,J{Oit,J{Ot,J{h&p((&p,\a(@CP&,%@@,Zn,\(YpG$e<ܾ <ܾ$e(ྑpw$eOt,ڄ<@wIOt4듀AA@A@@@@AA@@@,Ot,f焀(ܾpw$eH<ܾwH($pwH@@+@w{{ܾp$e&hp(&pw('p @$Z,(@GOtZ,J{@${*Z,z(@wOtZ,J{@$ pOI@ @@%L&,@(@CO uO,J{@$( p $@{@@4p(|pE<% %@{@@p4,T(@CO!u,J{@${34%%,Q(@CO!u,J{@$@('p(%p <K{('pw(Lpw{@@p(pO,W&@Ypplp$p<$G$(dp$hp(pO7u,J{$(4$p,\X@H{1쿓p(쿓pK俓@PH俓p{ ,\臀@HH$p<$CO>u,J{${!<$O0p&$p{ <$wdp(|pw$<$w$ '@@,N@AA,d(@COLu,J{$<_$w(p_,d(HђpHђ,l(4ђpw$(%p+'@͐@@AA,p(@C$$~,\a@@p(@pCOgu,J{$pOu,J{,G$Ou,J{,G$Ou,J{$< O_/@@+@S(%po p $p'ptpt@O@PptO,`p(@C{z{ ,\^(dplp{ zplp(lpOE+vp;Ov8p8@+Pp(8@PAA8p,N@AA,d{ҠY,W&,҂,\Jl@{L H G IpILЪpOЪ,\@_,@Yp(YpG/ЪpѪp{5<_YG.Y@OϪ@?/PY@OЪ@/PpY@OѪ@PpOЪ@{L II_Lhplp(%pOv,J{@$@Z@<@C$@<@_$@@$wO'vO?vI@@@踑,‡@Yp$OJvOcvI@@@踑,‡@Yp$OovOvI@@@踑,‡@Yp$I@@@,\@_,@pOv,@p@@<_@GI@@@Ov,D{I@@@Ov_,OvI@@@I@@@踑,‡@Yp{OvZ,J{@$@(YpC Y@$@<YwOvh,J{@$@h@?o|PHh_퓀,Ѐ@AAp(A(@(p@,(@O @hp퓀h_,퓀hpOSqlp<Zw <& {<Z{ OLqlpOXqOvl踑,ȧ@AAYp(AC Y@$@Ydp,\΂@AAYp(AC Y@$@Z@<@K}@<@Wv@@$(whd,u@AA&pA@{Whd,@AA&pA@{=hd,@AA&pA@{#hd,Q@AA&pA@{@{L IpppIL(Zpw OmZpZ@+Ppw @$,҂Z@?o|PwBZAAAdpd@+Ppd@? P{ {dp{d,@&p$_(tp`HwpLwpPwpTwp\wp`wpdwphwplwpZOHw,@&p{Z,@&p(&pwOpwZ,\d憀@,J{(&pOOZ_,{ p&@{L IpppIL(Zpw OmZpZ@+Ppw @$,҂<&wM(tpwZ,<@O Z,P]pOZ_,Z]p@$Z@?o|Pw|@@,J{OF|OG(YpK<1YGY@@A@AAAG@A@{_<_YO'<_YG YCoCClplAlAAAG@A@{3<_Yw$YC_lCCpAAAAG@A@{ G@_ @?_$ЃOF(YpK<1YGY@@A@AAAF@A@{b<_YO*<_YG#YCoCCpAAAAF@A@{3<_Yw$YC_lCCpAAAAF@A@{ F@_ @@@AACOOCCpCS@{ O>|@@OE(YpK<1YGY@@A@AAAE@A@{b<_YO*<_YG#YCoCC p A AAAE@A@{3<_Yw$YC_lCC$p$A$AAAE@A@{ E@_ @?_$уOD(YpK<1YGY@@A@AAAD@A@{b<_YO*<_YG#YCoCC(p(A(AAAD@A@{3<_Yw$YC_lCC,p,A,AAAD@A@{ D@_ @@@AACOOCC0p0CS@{ O>|@@,J{OQ|Op(YpK<1YGY@@A@AAA@A@{h<_YO,<_YG%YCoCC4p4A4AAA@A@{7<_Yw&YC_lCC8p8A8AAA@A@{ @_ @?P_$BӃO|@@OLp(YpK<1YGY@@A@AAAL@A@{e<_YO+<_YG$YCoCCPpPAPAAAL@A@{5<_Yw%YC_lCCTpTATAAAL@A@{ L@_ @?_$ԃOXp(YpK<1YGY@@A@AAAX@A@{e<_YO+<_YG$YCoCC\p\A\AAAX@A@{5<_Yw%YC_lCC`p`A`AAAX@A@{ X@_ @@@AACOOCCdpdCS@{ O>|@@,J{Zp&@@<@ZO,\(@w @$؃{Zp(Lpw$QփO\|OmOmOmOhp(YpK<1YGY@@A@AAAh@A@{e<_YO+<_YG$YCoCClplAlAAAh@A@{5<_Yw%YC_lCCpppApAAAh@A@{ h@_ @+p Ov|@{ O{|@@Otp(YpK<1YGY@@A@AAAt@A@{e<_YO+<_YG$YCoCCxpxAxAAAt@A@{5<_Yw%YC_lCC|p|A|AAAt@A@{ t@_ @+p Ov|@{ O{|@@,J{$׃O\|OmOp(YpK<1YGY@@A@AAA@A@{n<_YO/<_YG(YCoCCpAAAA@A@{:<_Yw)YC_lCCpAAAA@A@{ @_ @+p Ov|@{ O{|@@Op(YpK<1YGY@@A@AAA@A@{n<_YO/<_YG(YCoCCpAAAA@A@{:<_Yw)YC_lCCpAAAA@A@{ @_ @+p Ov|@{ O{|@@OmOm,J{Zp&@@<@ZO,\(@w @{{ZpYpzZ@{YL H G F E D C IpppILOH}(Yp O`@{ O~z@@,J{X@<@Kl@<@Wd@@$`OxO}},J{{DOxO},J{{.OxO},J{{OxO},J{{Zp&@@<@ZO,\(@w @$&ރ{ZpO},J{ApA@<@KT@<@WL@@$pO},J{{2O},J{{"O},J{{O},J{{ApA@<@KT@<@WL@@$O},J{{2O},J{{"O ~,J{{O~,J{{+p.O)~+p O0~@{ O8~@@,J{{O@~,J{+p.OH~+p O0~@{ O8~@@,J{{OQ~,J{O0x,J{Zp&@@<@ZO,\(@w @$&ރ{ZpO[~,J{X@<@Kl@<@Wd@@$OxO}},J{{DOxO},J{{.OxO},J{{OxO},J{{Zp&@@<@ZO,\(@w @$&ރ{ZpOr~,J{ApA@<@KT@<@WL@@$O},J{{2O},J{{"O},J{{O},J{{ApA@<@KT@<@WL@@$O~,J{{2O~,J{{"O ~,J{{O~,J{{O~+p O~@{ O~@@+p O~@{ O~@@,J{Zp&@@<@ZO,\(@w @$&ރ{ZpO~X,􄀠@,J{Zp&@@<@ZO,\(@w @$&ރ{ZpO~X,􄀠@,J{Zp&@@<@ZO,\(@w @$&ރ{ZpO~X,􄀠@,J{Zp&@@<@ZO,\(@w @$&ރ{ZpOX,􄀠@,J{Zp&@@<@ZO,\(@w @$&ރ{ZpO0,J{(XpOxX,J{{9OA,@Yp(YpOFY,J{{O#{,J{Zp&@@<@ZO,\(@w @{ {ZpZ@{L IpIO,J{@{L IpppI(%pC ('pw{,\L IppIL(Zp Z@+Ppw{O,J{{uZAQ@@YpZp+@U?o\YwO,J{{;?Y_ ?o~YWOY@@,J{{OY@@,J{{O0x,J{L IpppI LdpO .,J{dp<.G+O퓀@(퓀pw O4@@,J{{RO;,J{hp<.hC0OPh@@@h@@AA@O퓀@P,J{hp{˜.dpOY,J{(.pOi,J{{K(.pwOq,J{{2<.wOy,J{{<.wO,J{O(xp O-{@{ O){@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO(T.p Oр@{ O){@@(X.p O-{@{ O){@@,J{dp&@@<@dO,\(@w @$ꃀ{dp(pOOՀ,J{{O,J{dp&@@<@dO,\(@w @$ꃀ{dpO7,J{(h.pOOGh.,J{{OO,J{OXh@(hpw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpOs(p Oр@{ O){@@(p<w O-{@{ O@{ O){@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO(t.p Oр@{ O){@@,J{Oˁx.,J{dp&@@<@dO,\(@w @$ꃀ{dpOၑ.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO'.@(.pw O4@@,J{OL(p<w O-{@{ O0{@{ O){@@,J{(p+O^(p Ob@{ Oh@@,J{Op.@(.pw O4@@,J{dpdp&@@<@dO,\(@w @$ꃀ{dpO,J{<|wO,J{{[<|wO,J{{B<|wOĂ,J{{)<|wO#{,J{{O˂,J{dp&@@<@dO,\(@w @$ꃀ{dpO΂,J{(pwO4,J{{5pYp<YC(OY@@AA@O4@P,J{Yp{ӠO򂑀.@(.pw O4@@,J{dpdp&@@<@dO,\(@w @$ꃀ{dpO.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO9.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO\.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpOt,􄀠@,J{dp&@@<@dO,\(@w @$ꃀ{dpO.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpOŃ.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpO胑,J{( pwO4,J{{5pYp< YC(OY@@AA@O@P,J{Yp{ӠO0x,J{dp&@@<@dO,\(@w @$ꃀ{dpO,J{(pwO4,J{{5pYp<YC(OY@@AA@Oh@P,J{Yp{ӠO0x,J{dp&@@<@dO,\(@w @$ꃀ{dpO(,J{(dpwO4,J{{5pYp<dYC(OY@@AA@O@P,J{Yp{ӠO0x,J{dp&@@<@dO,\(@w @$ꃀ{dpOH.@(.pw.@(.pw O4@@,J{dp&@@<@dO,\(@w @$ꃀ{dpOk,J{(0pwO4,J{{5pYp<0YC(OY@@AA@O@P,J{Yp{ӠO0x,J{dp&@@<@dO,\(@w @$ꃀ{dpO.@(.pw O4@@,J{dp&@@<@dO,\(@w@{{dpO.@(.pw O4@@,J{dp&@@<@dO,\(@w@{2{dpOфT/@(T/pw O4@@,J{@{L IpIZ@<@K8@<@W0@@$O){@{&Oj@{O􄑀@{O0{@{ O(x@{L IH LdphpO0x,J{O(&pw O'y@{ O1y@@,J{hpO2+,@,J{<&w(+pOO,J{{(+pOw,J{O0x,J{hp(&pwO,\ؠ@,J{{O,\ؠ@,J{hp(&pw OkYp{<&w OͅYp{ OׅYpOᅑY,J{hpO&,}@,J{hpO&,^@,J{hpO;($p OY@{ O]@@,J{hpO`($p O~@{ O@@,J{hpO,J{dp<dwdC+dAA@A@@@@AOwA<T&w{dp{РOx<dwddAA@A@@@@AOwAQ@{ O(x@@,J{hp&@@<@hO,\(@w ${hpO(&p/<&<&w OĆ@{ Ob@{ Ŏ@{ Oӆ@@,J{hp&@@<@hO,\(@w ${hp(8'pK%<8'G8'@@AAHOT"HX@{ O؆@@YpO݆Y,J{hp&@@<@hO,\(@w ${hpOOxO7,J{{(OxO:,J{{O{d,J{hp&@@<@hO,\(@w ${hpO?r@(rpw O4@@,J{hp&@@<@hO,\(@w ${hpO]t'@(t'pw O4@@,J{hp&@@<@hO,\(@w ${hpO{x'@(x'pw O4@@,J{hp&@@<@hO,\(@w ${hpO|'@(|'pw O4@@,J{hp&@@<@hO,\(@w ${hpO'@('pw O4@@,J{hp&@@<@hO,\(@w ${hpOՇ(ϒpw ܸ@{ O4@@,J{hp&@@<@hO,\(@w ${hp(𾑀p>O󇑀𾑀,J{hp&@@<@hO,\(@w ${hpO(((p OC@{ OL@@((p OW@{ O`@@,J{hp&@@<@hO,\(@w ${hpOlU,J{hp&@@<@hO,\(@w ${hpO U,J{hp&@@<@hO,\(@w ${hpO࢒@(࢒pw O4@@,J{hp&@@<@hO,\(@w ${hpOƈܢ@(ܢpw O4@@,J{hp&@@<@hO,\(@w{t{hpO䈑,J{hphp&@@<@hO,\(@w{?{hpO񈑀,J{O ,J{O,J{O,,J{L H IILO/@&AA@A@@@@AO\ AQ,J{(@&p$O=,J{("p$Oe""",J{{"O""",J{O",􄀠@,J{("pO"#,J{O‰"",J{<"wOډ,J{{O",J{O#@@#@@,J{O.%,J{OH$$,J{O_(#,􄀠@,J{O|$@@$@@,J{O\",J{O#@@#@@,J{("pOĊ",J{{Oኑ",J{O <",J{O#P",J{("pO,",J{{OD",J{OkX"T",J{Od"",J{OTX,J{O,J{<D#wOx,J{{cOx(@#p Ox@{ Ox@@,J{(@#p1Ox(D#p Oy@{ Oy@@O y,J{O,,J{@&AA@A@@@@AO\ A(@@Yp(@w OmYpO܋Y@+PpY@{ O4@@,J{@&AA@A@@@@AO\ A,@@Yp(@w OmYpOY@+PpY@{ O4@@,J{@&AA@A@@@@AO\ A0@@Yp(@w OmYpO"Y@+PpY@{ O4@@,J{퓀@Pp("p$퓀OE"",8ቀ{퓀Oe,8ቀ퓀@+PpO}퓀,J{O@(&pw@@,􄀠@,J{O(&pw O@{ O@@,J{OÌ&,􄀠@,􄀠@,J{O挑(#p Oр@{ O){@@,J{O,$@(,$pw O4@@,J{O0$@(0$pw O4@@,J{O0,J{O<,J{O ,J{O,J{(@&pw$OR,J{@&AA@A@@@@AO\ A4Yp(Ypw OmYpOtY@+PpY@{ O4@@,J{@&AA@A@@@@AO\ A8Yp(Ypw OmYpOY@+PpY@{ O4@@,J{@&AA@A@@@@AO\ A(Ғp+pw ,ZψYpГpdp<dGd@@AA@I@@AAQpdp{@@AA@`@(Ppwedpdpd@@AA@t@PAAhp(AEh@+Pp9h@PA@@+@h@PAA,hA@Qphp{{,\mԓplpp|p@(Zp@@p<ܾ<ܾwz(ྑpw{oOt,ڄ<@wPOt4듀AA@A@@@@AA@@@,Ot,f焀ܾp(Zpw(`pGГp$ ('pw$,i@dpd@@<_@GOOZ,8ቀ{OO/,8ቀ{$opxFFFdp(dpK>d@@AA@t@(Ppwxp{ d@@AA@t@PA+Qpwxp{{dp{<$w|@(|pw Om@@Pp$o<$$t@PAAPp(AP@+Ppw5{(pOPp( pOOF,8ቀ$oP,@PpP@?o\PwPpP@PAAhp?%A$PpP@PhpOmPp+hpw3(pOPp( pOOg,8ቀ$o?/h_g?9hW_(ӒpCh@@AA@O@PPp{:ӒAA@A@@@@AOAh@@HH@A@@A_@AQPp{q?*hw6(ӒpK-Ӓ@@AA@Ol@PPp(Ppw OmPp{5h@AA+A _hph@@AA@O@PPp(Ppw OmPp$o$?&h$PI@ol@@I@op@@,9(@C3(pOPp( pOO,8ቀ$olp,=(@OYolpl@@AA@Oѓ@0,@hp(hpChpOOȗh,8ቀOPp{ O8Pp<xG$y&pI@_@@4,IF_FF|p|@?o\Pw|p(pOPp( pOO˗Z,8ቀ|@?&P$o|@@+Pp(|@@?o[Pw|@@?o]Pw{$o|@@??P_)|@@?oZPW|@@|AAQF FFPp|@@PAAh,4@AAp(AC$o(p@@AA@O@PxpOOȗh,8ቀ(ppgp@@AA@p@(Pp<@@AA@p@P,#@@AA@p@Ppp{p,#I@_@@O,h@@@AA,!@pp(ppw$(pT@@@@@AA@`@P,$(@w p{(pC p{p{ap<C=T@@@@@AA@`@P,$(@w p{<w p{p{64@@AA@`@P,v@p(p(p,#OOȗ,8ቀOPp$o(xpG$o<xGP0_,$N.0,@lp4,@p<xO8,{@@pl@@p@FFFdp(dpO(lp (pw({P0_,P@_@Pp$N.0Tpdp0@d@p@FFFTpYp(p( pOOBZ,8ቀ{ pOPp$o(hpOTYp<YCD0Tpdp@@AA@I@@A_AQ,AAHHAIAAH_H@Xp@@AA@I@@A_Ap{P"p{H'p{@'p{8<xw Lp{*OT ,ቀ @O@Pp$o @T@p@AA?Qw6OT@@@ @@@,ቀ @O@Pp$oOT ,ቀ @O@Pp$o0, 9(@w,(p( pOOnZ,8ቀ$oO<>$w O瘑@{ O똑@@0,@,8ቀ<>$wPw{$oh@t@Ppp@@AA@d@@h@@@,!(`p:p@@AA@`@@|AA@A@@@@AA,!|,.儀(@C$oppzOOȗx,8ቀOPp(p$o<_$w>]p(xpO"OPpO0_,{ OmPp$o<_$<_$$GjxpO8Pp(xpG$o0<_$w@{@@ ,3@Pp(Ppw'( pOOZ,8ቀ$o(pOP_,OPp$o<_$$lO8Pp(xpG$o0TpT,<@,(p( pOOZ,8ቀ$oOPppp<pO$lxp<xO$lx@@AA@I@@A_AT@PQpTpx@@AA@I@@A_AQ@O@PAA+A>x@@AA@I@@A_AQ,xAAHHAIAAH_H@Xpx@@AA@I@@A_A<@Pp<pT,dxAAHHAIAAH_H@Xp<Tp{,(p( pOOZ,8ቀ$oxpznT,d@pPOA,8ቀ$o<_$$n(pOPp<xG'( pOOSZ,8ቀ$o4, 9(@8, 9(@w){( pOOnZ,8ቀ$o04,d@8,d@,3@Pp(Ppw#( pOOZ,8ቀ{K(pOP_,OPp{'(p( pOORZ,8ቀpphpQ!OOrZ,8ቀOPp{!OOZ,8ቀOPp( p |p( pOP,J{{ Om@{P@{L H G F IpppHLI,Vm(Yp Y@+Ppw{Om@$Kqpdp<dGd@O@YAdAQPpdp{Y@@? P YAAQ@{0@@֮pY@ @P׮pdp< dG2Y@@@d@@AA@OT^@P,0(@w{dp{< dw?ծp?Ԯp{.dp< dG0@{1@@Ԯpd@ @@H0HHծpخpOЮ@{L H IppIL,\t*@YpO|OhzY,8ቀO|@{L IppF8L(Zpw OmZpZ,@Yp( p@C$8>@,DO` ,D{O`O8,%O`@$$Yp<O Zp@pzC@@Pp@@AA@I@@A_LA@GGGQppZp@pz (dpw>(DpD,#Dp(^p^,#^p@$I@oL@@I@_L@@^,𯉀@,p(,pp0A,HX@@Qp,p0p+@Kp(pC>(DpD,#Dp(^p^,#^p@${0pp(DpD,#Dp(^p^,#^p$ϞhpZGGG8p8@?(P.0@ZAQPpZp0pp(pC @$$Ϟhp8pIGoLGG(@C$ӄ퓀Oʑ,8ቀ{퓀Oʑ,8ቀ퓀lp_dp퓀I@ @@I@@@,( ,!@ p( pwOʑ,J{@$ӄ@@AA@O@(Ppw@@AA@O@ Pp{$@ p $p @pY@@AA@I@@AAQ,@AAA,! A@Qp(@w$ӄ @PY@@AA@I@@AAQ,%퓀@+PpG퓀,@AAA,! A@p(@w{b @퓀,%{ @ptpY@@AA@I@@AAQ,(tpYpz^𢒀p@{!Oʑ,J{, @{L IpppHLp@('p(%p <K{('pw(Lpw{@@p('pr,\a(@C9O ˑ(%p O@ˑ@{ OCˑ@@O,J{@$؄$%,T(@COFˑ,J{@$؄,\(@wUZ,@Yp('pZY,b@H{YZ,`p@HHdp@@dp(dpC$ׄ<O(@@,N@AA,@dp(dpC{xO񑀠,(@C{`zs<_twOdˑZptpz]<lwo\,N@AA,@dp(pOO񑀠,(@C{@{(pOfˑ,J{@{L H IpILYp(ʒpw$؄%@@,Znʒ,(@Oy(pjdp<dGbd@@AA@O@P,<@O=Oˑ,J{d@@AA@O@P좒,{dp{$لYp(ฑpYp{'(\&pOYp{(\&pC(?pOYp(Yp$لOˑ ?,J{Oˑ,J{Oˑ,J{(&p$ل(?p$ل(pjdp<dGbd@@AA@O@P,<@O=Oˑ,J{d@@AA@O@P좒,{dp{Oˑ,J{L IILZ@p(@ <@{8(tp Oˑ@{ Ȏ@@Yp{%(tp O ̑@{ Ȏ@@Yp{ O\YpY@{L IppHL(Zpw O\ZpZ@+Ppw@{MZpZAQ@@YpZp+@4?Xw@{{@{L H IpppILt,$@AAlp(A (xpO{ @$ۄpdpx@@<@dK$ۄdAA@A@@@@AZAQt,ቀ(@gdAA@A@@@@AZAQtl,0@A@(Aw@@hp(@6dAA@A@@@@AZApA@ @Ptl,0(@w{d@{N(hp@{DdpzTxAA@A@@@@AZApA@@Ptl,0(@w x@@{ {@{L IppILt,$@AAdp(A (xpO{@{cpYpӒ@@AA@@@AO`AAӒ@@AA@Od@P,!Ӓ@@Ӓ@@AA@O@PpӒ@@AA@Oq@Pѓp{pplѓp{ Ӓp(pG,\%@@,Zn(xpw$(pG$򄀄AA@A@@@@AA<QwHȎAA@A@@@@AA@@AA@Od@P,J{{rAA@A@@@@AA<QwQAA@A@@@@AAHH@H@@@@AOAQhpO ͑h,J{@p(@C@{L H G IppIp,\(@{p,\L<@O{@,|@{L IppILZ@<@C$􄀔@<@_$@@$͑(&pGO͑,J{@$􄀃p&p,҂$(&pGO3͑,J{@$􄀃p&p,҂$(&pG!(pOM͑,J{@$(&p#(&pOk͑O\,򆀃p&p,҂$(&pG(pO͑,J{@{`p&p ,҂{F<Zw @{ @@YpY,d(@G@{"Y,҂{O͑Z,J{@{L IpppI(Zp OCˑ@{ O͑@{L IIZ@<@<@G(@ {$<@{O͑@{OCˑ@{O͑@{ O͑@{L IpHLOΑZ,J{@Z@Phph@O@(@ChH_HHlp< lO <@G <@$<@$@$b(Oӑ,J{@$b(퓀,@Yp͑pZp<ZCvZAA@A@@@@AAQ퓀Y,0(@wCZAA@A@@@@AAQZAA@A@@@@AA,"(@C{Zp{@$b(ZAA@A@@@@AAQZAA@A@@@@AA,v"@$b({sOӑ,J{͑pYp<YCHYAA@A@@@@AAQYAA@A@@@@AA,"(@C{Yp{@$b(<Z"<Z,\΂@AAYp(AC Y@$b(Z@<@C$B(@Ց4(@@AA@O@P,J{OVՑ8(@@AA@O@P,J{OnՑL(@@AA@O@P,J{OՑT(@@AA@O@P,J{OՑX(@@AA@O@P,J{OՑ\(@@AA@O@P,J{OՑOEE@(%pw`(AADD@P,J{OՑd(@@AA@O@P,J{OՑ@(@@AA@O@P,J{O֑$(@@AA@O@P,J{O.֑|(@@AA@O@P,J{ hp&@@<@hO,\(@w @$b({hpOF֑",J{hp&@@<@hO,\(@w @$b({hpO_֑",J{hp&@@<@hO,\(@w @$b({hpOx֑",O@,J{hp&@@<@hO,\(@w @$b({hpO֑,@,J{(p(pO֑,J{hp&@@<@hO,\(@w @$b({hpO֑",@,J{hp&@@<@hO,\(@w @$b({hpO֑,J{(L$pwOQё,J{{HO֑L$P$@(P$pw O\@@T$@(T$pw O\@@,J{hp&@@<@hO,\(@w @$b({hpO֑,J{(D$pwO֑,J{$Oˑ,J{hpZp<D$ZCdZ@@AA@Op@(Pp%O בZZ@@AA@Op@P,J{hp&@@<@hO,\(@w{ {hpZp{$U(OΑ(𢒀p Oב@{ Oב@@,J{@$b(,\$U((%pO{ӑ,J{𢒀p@$b(,\$U(,\2$U(O"בO\I@@@踑,@AAYp(AC Y@$b(퓀,%퓀@+Pp퓀O;ב,D,\=(@O,(&pO#( &pO&&p & &p<ZwTO=ב,J{OmHqO\OgבOjב,mOˑ,J{$U($hpYp<jYK$YAA@A@@@@AO@cA @@+@$ 퓀@+Pp8퓀YAA@A@@@@AO@cAQ,$(@w$ YAA@A@@@@AO@cAQ,q@pOmבYAA@A@@@@AO@cAQ,J{YAA@A@@@@AO@cA<+w>@+Pp OΑ@PAAp,J{{ڠOˑ,J{$YAA@A@@@@AO@cA<jYAA@A@@@@AO@cA<4LYAA@A@@@@AO@cAs@@+@w ZZp{pw@@+@w ttp{@e{r(YpC^AA@A@@@@AOAZ@@HH@A@PpAA@A@@@@AOFAZ@@HH@A@oPp{mAA@A@@@@AOAZ@@HH@A@ZAAHHAOAQPpAA@A@@@@AOFAZ@@HH@A@YPpZ@@AA@O@PpZ@@AA@Oѓ@Pp@{L H IppILZYpZ@?o\PwZpZ@?%P%Z@?&POg鑀Y,J{@$s@Z,<@GO鑀Y,J{@$s@Z@?%Pw%Z@@+PpO鑀,J{@$s@Z@?&Pw)Z@@?o[PO鑀Y,J{@$s@Z@?%Pw>Z@@Phph@O@PAA+Aohpt@hPpx@Pp@$s@Z@?&P$n@ZI@@@I@ @@,@hp(hpC-}{O̾d,!@$POꑀ侑I@@@H(pwO⑀,@HH踑,@AAYp(AC Y@$P퓀d,%퓀dp,\΂@AAYp(AC Y@$P,\@hpd,䘀(@wpd,>}{ pYp(pyO̾h,!(p`lp<lGXl@@AA@O@P,<@O3Ypl@@AA@O@P좒,{lp{(Ypw6(p-(&pw$,\r(@wO\‘,\@,J{@{L H II,\J,\+ђpOђ,bzђp𢒀pL IpIL(tpw O\tpZ@Pdpt@+Pp$Q(둀pO:Oˑ,J{dp&@@<@dO,\(@w @$eR{dpOˑ,J{dp&@@<@dO,\(@w @$eR{dp둀pZ@dPp@$eRt,@AAAYpY둀p<( &O &@@{oO@<@둀OPOˑ,J{dp&@@<@dO,\(@w@{={dpObёt,J{Y둀p{Obёt,J{Z@dPp@{L IIL(둀pO$ apYp<_YGY@@AA@O@PpYp{둀@@AA@O@@둀pO 둀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O+둀_,8ቀ둀@@AA@O@@둀p퓀,!둀@@AA@O@@둀pO7둀,!둀@@AA@O@@둀pO>둀,!둀@@AA@O@@둀pOG둀,!둀@@AA@O@@둀pOP둀,!둀@@AA@O@@둀pOX둀,!둀@@AA@O@@둀pO_둀,!둀@@AA@O@@둀pOi둀,!둀@@AA@O@@둀pOr둀,!둀@@AA@O@@둀pO{둀,!둀@@AA@O@@둀pO둀,!퓀O둀,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀o@,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀.,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀o@,8ቀ둀@@AA@O@@둀p퓀,!퓀O둀 ,8ቀ둀@@AA@O@@둀p퓀,!퓀O쑀 ,8ቀ둀@@AA@O@@둀p퓀,!퓀O쑀o@,8ቀ둀@@AA@O@@둀p퓀,!퓀O쑀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O&쑀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O0쑀_,8ቀ둀@@AA@O@@둀p퓀,!퓀O<쑀 ,8ቀ둀@@AA@O@@둀p퓀,!퓀OG쑀_,8ቀ둀@@AA@O@@둀p퓀,!둀@@AA@O@@둀pOS쑀,!둀@@AA@O@@둀pOX쑀,!둀@@AA@O@@둀pOb쑀,!둀@@AA@O@@둀pOk쑀,!둀@@AA@O@@둀pOq쑀,!둀@@AA@O@@둀pO}쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO쑀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO 푀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO'푀,!둀@@AA@O@@둀pO2푀,!둀@@AA@O@@둀pO;푀,!둀@@AA@O@@둀pOF푀,!둀@@AA@O@@둀pON푀,!둀@@AA@O@@둀pOV푀,!둀@@AA@O@@둀pO`푀,!둀@@AA@O@@둀pOj푀,!둀@@AA@O@@둀pOt푀,!둀@@AA@O@@둀pO}푀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO푀,!둀@@AA@O@@둀pO푀,!퓀O푀O푀,8ቀ둀@@AA@O@@둀p퓀,!O񑀠둀,f/L IILdphp,\NO\‘ ,J{Oˑ,J{hp&@@<@hO,\(@w @$_j{hpO푀,J{hp&@@<@hO,\(@w @$_j{hpO푀,J{hp&@@<@hO,\(@w @$_j{hpO,J{hp&@@<@hO,\(@w @$_j{hpO,J{hp&@@<@hO,\(@w @$_j{hpO<,J{hp&@@<@hO,\(@w @$_j{hpO\,J{hp&@@<@hO,\(@w @$_j{hpOh,J{hp&@@<@hO,\(@w @$_j{hpOˑ,J{hp&@@<@hO,\(@w @$_j{hpOw,J{hp&@@<@hO,\(@w @$_j{hpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpO,J{hp&@@<@hO,\(@w @$_j{hpO%,J{hp&@@<@hO,\(@w @$_j{hpON,J{hp&@@<@hO,\(@w @$_j{hpO{,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpdpO,J{hp&@@<@hO,\(@w @$_j{hpdpO%,J{hp&@@<@hO,\(@w @$_j{hp(dpw;OA,J{hp&@@<@hO,\(@w @$_j{hpOHlp(lpw O\lpl@+Ppw O͑lpOˑ,J{hp&@@<@hO,\(@w @$_j{hpOQ𑀠l,J{hp&@@<@hO,\(@w @$_j{hpO]𑀠On,J{hp&@@<@hO,\(@w @$_j{hpOt𑀠O𑀠O,J{hp&@@<@hO,\(@w @$_j{hppYp<둀YC4I@@@Y@@AA@O@P,(@w @$_jYp{DŽI@@@O\,(@w @$_j퓀O(1p O@{ O@@,8ቀI@@@퓀,_(@w @$_jI@@@O\,?(@w @$_j퓀O𑀠,8ቀI@@@퓀, (@w @$_j퓀O𑀠,8ቀI@@@퓀,(@w @$_j퓀O𑀠,8ቀI@@@퓀,(@w @$_j퓀O𑀠,8ቀI@@@퓀,g(@w @$_j퓀O𑀠,8ቀI@@@퓀,1(@w@{~퓀O𑀠,8ቀI@@@퓀,(@w@{L퓀O񑀠,8ቀI@@@퓀,(@w@{I@@@O\,@{L IppH_Lp@AA=p(AC=@$q@AA=p(AC=@$ x}$dO5,4@AAtp(Awlpd,>}$ZO7,4@AA(p(AwZ,>}$O9dZ,J{(OgZ,>y(OOOOOO,>yY@PpY_t,T‰(@w$~Y@+Ppw(O,>y{ƠY,@,p,@,p(@O Y@,@? PWY@,@Pp{{{נYI@@@,G,p<,G=,@@AA@I@@AA(Qpw,@@AA@I@@AAO Qp,p{(Ol,>yzO,J{0p(tp t,,((p (,,(Yp Y,#0@{L IppIodL,p0p4p(Zp (.pO{ @$ϓZ,@AAdp(AG @$ϓ_,!@AA\p(Aw @$ϓ,pXpppYpp p(Xp$<.YK$yY@@AA@O퓀@PO5,4@AAXp(Aw7Y@@AA@O퓀@P,>}(\p\,#\pYp{lp(X.p)(,pw#OY@@AA@O퓀@P,J{Yp(0pwp p$p(p\@Pp\_X,(@C(XpX,,Xp0pz\@+Ppwz\,@AAA,!@AATp(Aw$T\,%TI@8@@,G(,@A &ApAGGGp(&pO( &pO $pO,J{(tp9(&pO0( &pO'&@@<@$O,\(@w{.{$p,#(@|@< @w{ (pz,#p4&p좒pp@{L H G IpppIL(PpYYp<TYC8Y@@AA@P@(PpY@@AA@P@P,#Yp{àP,#PpTpL IpILYpOϒOP,Q(8pOBOϒ<8<8w OZ@{ Og@{ Ol@@,QYp{OϒOg,QYp<O.Oϒ(p Os@{ O|@@,QYp<O.Oϒ(p O@{ O@@,QYp<O.Oϒ(p O@{ O@@,QYp<<O.Oϒ(<p O@{ O@@,QYp<@O.Oϒ(@p O@{ O@@,QYp<DO.Oϒ(Dp O@{ O@@,QYp<0O.Oϒ(0p O@{ O@@,QYp<4O.Oϒ(4p O@{ O@@,QYp($pwYpOϒO,Q{e($pO\Yp(,pwO=p{.<,wO%=p{<,wO0=pOϒ=,Q<(O.Oϒ((p O;@{ OD@@,QYp< OR( pwOϒOO,Q{0퓀OZH,8ቀOϒ퓀,QYp(YpwOϒOh,QOϒO ,QL IpppIOO O=踑, @AA=p(AC=@$#0p퓀=,@_,{O,J{@$#z1,\΂@AA=p(AC=@$# G @@AAHOP^HX@{ O"@@HpL@@PApAHoHH@H@@@LAAQHHAoA@GAGG pL@PALHHX@AHAHHHHA@AA@A@@@@A_0AL@@PHHAA@A@@@LAAQHHAoA@GAGG pL@ @PApAHoHH@H@@@LA AQHHAoA@GAGG pL@ @PApAHoHH@H@@@LA AQHHAoA@GAGG pL@@PApAHoHH@H@@@LAAQHHAoA@GAGG pI@_8 @@O" @@H @@ @@ @@ @@,8ቀIG_8 GGLp$DžL@P8 pL@@P9 pL@@P: pL@@P; p-< pL@@P= pL@@P> p-? pL@@P@ pL@@PA pI@_B @@L@@@,%IG_8 GGLpI@_8 @@,@ppI,@p(p`(TpCY(p,I@_@@O"O"LI,8ቀ{&I@_@@O"O"LI,8ቀ{S(p*I@_@@O"TLI,8ቀ{$I@_@@O#TLI,8ቀ(pw$ɅO p p@<@$<@G(@ {'<@{ GGGp{p{ p{;@<@$<@G(@ {&<@{GGGp{ p{pPT,f/p<TK$ͅO@@AA@P@P,J{(ppw$ͅT@@<@K(|pw$ͅ( &pOy@@AA@P@P,@ p@ A &Ap(A@@ p@@AA@P@P,@A &ApA@ @@tp{tp&@@<@tO,\(@wp$΅{tppz(|pw$΅OT#X<Xw O|#@{ O~#@@\<\w O @{ O:@@`<`w O @{ O:@@,J{`,<@AO.A,@ pA p O@@,t(@O.O# O@@,@A,J{{8 Oz?O{G,P(@KO# ,J{O#,J{p<ВOВ$pВp<O좒pp,\(pO 𢒀p@{L H G IpIL('pw <Z{ ,\$eЅ<_Zw O8$@{ OI$@@dpdO O=踑,@AA=p(AC=@$eЅ퓀=_,퓀=p,\΂@AA=p(AC =@{y퓀pOm$,@AAYp(Aw SYpOt$Y=,8ቀ퓀,ˀ@=p@(=pO@@𢒀p{L IppIt@<@C$`Ӆ@<@_$`Ӆ@@$$Z@@D(p@@(p@<(p@0(p@,(p@((pZ@@p(p@\(p@X(p@T(p@P(p@L(p(%pwZ@@x(p@t(p@`(pZ@@8(p@4(pZ$(pZd(p('pw(%pw ZH(pZ@@l(p@h(p$eӅZd(p$eӅZ,(p$eӅZ((p(%p(Zpw&p&p$eӅZ0(p$eӅZ<(p$eӅZ@(p$eӅZD(p$eӅ('pw ZH(p$eӅZL(p$eӅZP(p$eӅZT(p$eӅZX(p$eӅZ\(p$eӅZ`(p$eӅZh(p$eӅZl(p$eӅZ0(p$eӅ(%p(ZpOz$,J{@$jӅZt(p$eӅ(%p(ZpOz$,J{@$jӅZx(p{|Z4(p{rZ8(p{hZ$(p{^s@@+@(@@+@w{s@@+@((@@+@w{O$,J{@{{ Z|(p{@{@{L IpppILYpOϒO ,QOϒO@%,Q<<%O.Oϒ(<%p OG%@{ OL%@@,QYp<0%O.Oϒ(0%p O@{ O@@,QYp<,%O.Oϒ(,%p OS%@{ OY%@@,QYp<4%O.Oϒ(4%p O@{ O@@,QYp(YpwOϒOh,QOϒO ,QL IILYpdphplpppOlOyO 踑,@AA=p(AC <=w $ օ{=@$xօ,\z@p@?: ?={@@p(@+,\z@AA+AwO,J{@$xօ(pw+,\z@AA+AO,J{@$xօ=@<@KH@<@W@@@$%hp{Chp{>lp{8Yp{2Yp{-Yp{(Yp{"p{p{Oa%,J{@{tz,\΂@AA=p(AC =@{R@AA=p(AC=@$셀퓀pO(,%퓀,@pp=@?o\Pw =ppA=HX@@Qp=pp+@{؜p@ PppO(O I@@@踑,l@AA=p(AC#<=w @$셀{=@$셀ΐ=p=,(@G$셀퓀O(d,8ቀ퓀=pA=HX@@Qp=pp+@{؜p@ PppO(O I@@@踑,l@AA=p(AC#<=w @$셀{=@$셀ΐ=p=,(@G$셀퓀O(h,8ቀ퓀=pA=HX@@Qp=pp+@{؜p@ PppX呀pPpp@ Ppp(pOiO(O O=, @AA=p(AC=@$셀ΐOr,ቀ(@O/(,J{@$셀O(O O=,@AA=p(AC=@$셀=,@AA=p(AG @$셀=@?o{PE=@=@p@AA?o}Q(퓀Of(=,8ቀ퓀=pO=O@퓀@@_AA,E(@COm(,J{@$셀O(,ڄ@=p(=pCXO(O`,T݄O(,ڄ@AA=p(ACO(,J{𢒀p@{[=AA@A@@@@AA@@@,A@AA𢒀pA@{O),J{@{L H IpILO dp(𾑀p 𾑀dpO(),J{YpOq),J{YpO)dd,J{O)dd,J{YpO*,J{O9*,J{Og*,J{O*,J{O*,J{YpYp&@@<@YO,\(@w @${YpO2+,J{O+,J{YpYp&@@<@YO,\(@w @${YpO+,J{YpYp&@@<@YO,\(@w @${YpO+,J{O+,J{YpYp&@@<@YO,\(@w @${YpO,,J{YpYp&@@<@YO,\(@w @${YpO;,,J{YpYp&@@<@YO,\(@w @${YpOa,,J{Yp&@@<@YO,\(@w @${YpO,,J{YpYp&@@<@YO,\(@w@{N{YpO,,J{Yp&@@<@YO,\(@w@{{YpO-,J{@{L IppGLdphplp(Zpw O ZpZ@+Ppw @$񅀄Z@PA@@+@Z@PApAGoGGdpZp{ @$񅀄Z@PA@@+@.dAZHX@AHAHHHHG@GG@@GoGGdpZpZ@?:PwZp{Z@+Ppw ${ @$񅀄Z@PA@@+@Z@PApAGoGGhpZp{ @$񅀄Z@PA@@+@.hAZHX@AHAHHHHG@GG@@GoGGhpZp<@<>@G <@{(@G<>@G <@$Zwk(pJ,\0t@xp(xpC𢒀p@$}x@@<@w𢒀p@$}{(=pw𢒀p@$}$퓀,@|p<twq<|w𢒀p@$}퓀,@=p(=pwO =p=I@_@@,ቀ(@𢒀p@$}{:<tw<|w𢒀p@$}{<tw<|𢒀p@{o(=pG{(l-,߉l-=p(=pOzX<>Zw@(pw@@𢒀p{@(=pw@@𢒀p𢒀@{L H G F IG_LhplpXp\p`pdpI@@@O.O O 踑OI@4@@,ЂI@4@@O O O 踑,Ђ(lp$I@@@,`Ђ@dp(dpC d@$=tא@<@w$<@$|א@<@K<@G<@;<@G(@8{W<@+{P<_@;<_@G <_@4{9<_@<_@{)hp{#hp{Xp{\p{`p{ dp{{xא=plp{ @$=z#(|אpOO.,J{@$=퓀=_,퓀,@A퓀ApAGGG=pO//O2O=踑,‡@AAdp(AC)0,J{{BOi0,J{{2O~0=,J{{O0퓀=,J{%@@,Zn@$={8%@@,Zn(hpO0,J{𢒀p@$=$=pptppp|p퓀O5,4@AAp(Aw퓀,>}@$==(\p O0@{ O7@@,4@AAp(Aw%,,=,>}@$=(dpw$MphpI@_@@6,|@AApp(AG tp$Gh@@p(@O0h,J{tp$G(Xpw$s@@+@O0,J{tp$Gpxpyz$(`pw$=(\p O0@{ O7@@,4@AAp(Aw%,,=,>}@$=pp(ppw$I@_@@oP,|@ppI@_@@pI@_@@oP,*7@AAlp(ACO0,J{tp$(Xpw$s@@+@O0,J{tp$pxp}tp{z$(Xpw$pI@_@@,|@pp(ppG tp{d{#<pwppO1,J{O41@@@@,>y<@w=,>}tp{zu{i(\pcI@_@@,|@pp(ppG tp{7I@_@@,h(@G=,>}tp{{(p,,(p,,I@_L@@O`5O O 踑I@_p@@,ЂI@_p@@O O O ,ЂI@_(@@,`Ђ@=p(=pC$<*<tא$w,\z@lp@<:l <=l{@@p(@0,\z@AA+AwO,J{=p$<*(pw0,\z@AA+AO,J{=p$<*|אp@<@C$R@<@_$R@@$9('p Op5,J{=p$<*{'(0$pO5,J{=p$<*( p O5,pp@@AA@I@@A(Ap$t,p@@AA@I@@A(Ap$t@@AA@I@@A(Ap$t,pppp@@AA@I@@A(Ap$t(pw$tO1!O O=踑, @AA=p(AC'<=wO9!,J{=p$<*@@AA@I@@A(A(Qp @@AA@I@@A(AQ,#=,@=p<_=OO5,J{=p$<*=@@@,!AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ=,%@@AA@I@@A(Ap$t(pw$t<w O6@{ O76@@O O=<w 踑@{@@, @AA=p(AC?<=w0O<w O^6@{ Ot6@@,J{=p$<*@@AA@I@@A(A(Qp7@@AA@I@@A(AQ,#@@AA@I@@A(AQp=,@=p=,@=p(=pG$=@@@,!AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ=,%@@AA@I@@A(Ap$t(pw$t($pO6,J{=p$<*O6O O=, @AA=p(AC$<*=,@=p=,@AA=p(AG$@@AA@I@@A(A(Qp @@AA@I@@A(AQ,#=@@@,!AAHHAIAAH(H@Xp@@AA@I@@A(A(Qp?@@AA@I@@A(AQ=,%@@AA@I@@A(Ap$t(pw$tO6O O=, @AA=p(AC<=wO =p{$<*=,@=p=,@=p=p<==CA=@=@?o\P{ =@=@p@AA?ovQw{ =p{<==wO6,J{=p$<*@@AA@I@@A(Ap@@AA@I@@A(A(Qp7@@AA@I@@A(AQ,#@@AA@I@@A(AQp=,@AA=p(AOV=@@@,!AAHHAIAAH(H@Xp(@&@@AA@I@@A(AQ=,%$t(pw!@@AA@I@@A(Ap$tO(tptO O"7踑,ȧ@AA=p(AC$<*@@AA@I@@A(A=p$t(pw$tOx,xO O%7踑,ȧ@AA=p(AC$<*@@AA@I@@A(A=p$t(pw$tOG|GO/7O 踑,ȧ@AA=p(AC<=w =p{$<*@@AA@I@@A(A=p(hp'(=pOF7,J{=p$<*{$O|7|א,J{=p$<*z5퓀(p퓀 (pdp퓀@Pp퓀@Pptא@<@/<@G <@ {x<@l{q퓀xא_,{y( p2퓀xא_,퓀,(@Odp{퓀xא_,p{$O7tא,J{=p$<*(,@(p(p$i(pOiO7O O=,@=p(=pC<=$<*<=퓀=_,dp$i( pwO7O O=,‡@=p(=pC<=$<*<=:퓀=_,,\΂@AA=p(AC$<*dp(dpw+(p퓀_,{ 퓀@Pp (,@ (p(@+Ppw9< Z(@wOm8,J{=p$<*(pC<@&$<@&{<OA< <{1( p+ (@+PpwO8,J{=p$<*(tpO&pp@&ВpP"ВpH" Вp8"$ВpD"(Вp<",Вpd"0ВpD&4ВpT&ϒp&8Вp&<Вp&@Вp<G$$@&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AP"p@&AA@A@@@@AO\ A< O'@&AA@A@@@@AO\ A H"p@&AA@A@@@@AO\ A<OG@&AA@A@@@@AO\ A8"p(H"p8"@@<"p@D"p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ Ad"p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AD&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ AT&p@&AA@A@@@@AO\ A<O'@&AA@A@@@@AO\ A&p@&AA@A@@@@AO\ A< O'@&AA@A@@@@AO\ A &p@&AA@A@@@@AO\ A<$O'@&AA@A@@@@AO\ A$&p&Вp&Вp(,pO&p&p#p{?(pO&p&p#p{ (pO&p&p#p(pO\0$XВp(pw 0$p{@,@AAA,!@0$p(0$p0$,%(pG$&p(%pO8,J{=p$<*,@p,̀(@$&p@@@,!@p(pw$&,%@@p@AA?/Q"@@/Ppp@@Pp@@oXPpp@@Pp, ΀@=p,#(=pC"O9,J{=p$<*O|',!(pG$F'p(%pO/9,J{=p$<*(pw O p@+PpwO[9,J{=p$<*,@pO',!(pO 'pHВp(lpO p<O&8Вp&p<O&PВp&p(Yp?oo'p#p(4pO #p(pO #p(tpO #p{?( p ov'p{.(4pO oh'p{(pO oj'p{ or'pp('p(lp &p,\^=p($p$<* (,@=p(=pG$$*=@ (@p@AA?/Q (,̀(@w$$*(Вp$$*,\@=p(=p$O쓀=_,Вp{/O{9,J{O  (pВpp$<* (,@p<$)p (,@p@@@,!@AAp(AaO (O9,8ቀ, ΀@p,#(pCO9 (,J{p{T (,䘀(@wO9 (,J{p{&O  (pOד(_,pp<G?@@AA@I@@A(A(Qp @@AA@I@@A(AQ,#p{=@{L H IGL,\΂@AA=p(AC=@$0,IG_GGZpZ@?:P :pZpZ@@?.PZ@@? PZ@@+Ppw#{OF:Z,J{𢒀p@$8(pw"O`:,J{𢒀p@$8Z,@lp(pG$8AA@A@@@@AA<Q$6pIGodGGpI@ @@I@_@@I@_@@,(I@ @@I@od@@?,p(p<@G><@w$@<@G(@w$@$N<@w$><@w$>$N<@w$A<@O$C$><@w$I<@GJ<@w$?<@G<@w$?<@w$ZG$N<@w$@<@w$H$N<@w$><@G<@w$2I<@w$>$N<@w$J<@w$J$N<)@w$=<)@O$<<#@w$L<#@GJ< @w$L< @G<@w$J<@w$J$N<(@w$v=$Np(p (pOzp$@PpOm,p2@,d@hph@{L H G IpH,LZ,-@hp(hpC h@$V<-Zw[,\ꂀ@p(pw O pp@+Pp$@? P@? P{p{{{ք@?o{PwoJZpZ@}0&p𢒀p@$Z$Y0&@@AA@O@Ppph_@𢒀p@{1O,҄@AA𢒀pA@{O,J{@{L H IIO,J{O,J{𢒀p@{L IILYpOx@yOrOr踑,ȧ@AArp(ACr@$(%pB,\΂@AArp(ACr@$O<,J{𢒀p@$r@<@C$@<4@_$@@$@OXO O踑,l@AArp(ACr@$<(<O,J{𢒀p@$,\΂@AArp(ACr@$<w o&p{<w_&p%p𢒀p@$O%,$O%,$,\ $O! "OyO踑,ȧ@AAp(AC@$,\΂@AArp(ACr@$%p𢒀p@$OLOrO踑,ȧ@AAp(AC@$,\΂@AArp(ACr@$&p@$OLyOrODy踑,ȧ@AAp(AC@$,\΂@AArp(ACr@$Ģp𢒀p@$OpyOOr踑,ȧ@AArp(ACr@$,\΂@AAp(AC@$<ܾ<ܾw<ྑw{𢒀p@$rྑp𢒀p@$O(,c΄@p(pO 𢒀p@$|&pO|&,%΄@rpr@$OƋO狒 O踑,l@AArp(ACr@$,\΂@AArp(ACr@$ &p𢒀p@$OꋒO틒 O踑,l@AArp(ACr@$,\΂@AArp(ACr@$&p𢒀p@$O&,̈́@AAp(AC @{g𢒀p@{ZO OrO踑,@AArp(AC r@{"O',@{@{L IppI LOyyOOs踑,ȧ@AAdp(AC d@$(%p6,\΂@AAdp(AC d@$O<,J{𢒀p@{pd@p(@ <@${\,\΂@AAhp(ACh@{J&p{rO{h!?o|hOҖ,J{@$%dp?>hwd@?>Pw dp(ppd@? Pd@? P{dp{d@+Ppw2O▒?>hw O@{ O@@,J{@$%?>hw%d,b(@COd,J{@{Y(p@?o|hw@@(p((p('pO,J{@{O (d,!@{L IppHL(p(p(p( (p (,# (pZ@Pp(pw Orp@+Pp$7('p$.<dU<dL<dC<d:<d1<d(<d<d<d <d{8Oΐ,J{(4&pOG,J{@$⭆{ @$⭆hplp,@dpdHHHYp(YpK<@Y@Pp?o}w{%{?>wYhp{?o|wYlpYp{(hpK$m(lpK$m('p$L<dU<dL<dC<d:<d1<d(<d<d<d <d{6Oΐ,J{(4&pOG,J{@$⭆,@pZ@Pp@$⭆(pYpwY@@p@AA?>Qw (p@Y@(AA@HAHHp@? P@? P{p{@+Ppw3O▒?>w O@{ O@@,J{@$⭆?>w',b(@CO,J{@{sO (,!@Y@p@HHHp<_!@? P@? P{ p{܄@@Pp,@pZ@Pp@{L H IpppILYpdphplppp('p(%p&,\a(@K{Os,J{@$OOrO踑, @AAp(AC<@$,@rp(rpG$:r@@@,!@AAYp(AwO,J{p${Y,%OOrO踑, @AAp(AC<$,@rp(rpG$:r@@@,!@AAdp(AwO,J{p${d,%OOrO踑, @AAp(AC<$,@rp(rpOLr@@@,!@AAhp(AwO,J{p${h,%O,@AAp(AC$(Yp$hΐpΐpOђ_,zlpO,bz%@@,Zn,|踑,zpp(pC/,\r|OrOrO,@p{̠,@rp(rpGO,J{$r@@@,!@AAYp(AwO,J{${Y,%O˗,bz%@@,Zn,|踑,zp(pC8</,\r|OrOrO,@p{à,@AAA,!@AAdp(AwO,J{{T{d,%O֗,J{,\΂@AAp(AC{oIYdh,ꆀ@'pp(lpOђ,bz<O ΐp(hph,#hp(dpd,#dp(YpY,#Yp<O('p<O ,\^@{L IppH_PL(p(p(p(ZpC Z@$Zdp<ZwlO|8}OrOr踑,ȧ@AAdp(AC)Oqp(&p,\r(@w{O?,J{$~ӆO\qp(|pw$TӆOq,\d憀@,!qqp(&p,\r(@w~{퓀,@HHHp_@}{O,J{{,(&p,\r(@w{O,J{(𢒀pwv?'pO?,%,\[@$p%p,&p(%pC(<DrODr%p{ %pDrp@$ՆO,J{$ꆀO,J{$ꆀO,J{$ꆀO5c@@+@ OV@{ OY@@,J{O]c@@+@ OV@{ OY@@,J{O~c@@+@ OV@{ OY@@,J{Oc@@+@ OV@{ OY@@,J{Oc@@+@ OV@{ OY@@,J{Oᤒc@ @+@ OV@{ OY@@,J{L IIL IpppIL IpppI(Zpw OZp(ppw ,\>Z,q(&p(&pOZ,sP&@@@,+L IILZ,@Yp,@Yp(YpZYt,t@Z@p@AAQpL II L(좒pw @$ (?p @$ %@@,Zndp(dpK$OC,J{O,(%p@Ծ,L炀@hpyp$,90p p(p4pp(4pw$&X,*X,k+8pO O8,C{Oӥ ,CX,kO&,\@,C(%p*X,kOǒ,J{(\pOFǒ\,J{< &wORǒ,{ORǒ,$K('pw@('pw5,Z(@'< &wOǒ,M{Oǒ,]{n(tp9 AA@A@@@@AOȒA @ @+@w?+4 @$[R(pZAQ@@@{@@8p AA@A@@@@AOȒA @@+@(pw @$[R{8 AA@A@@@@AOȒA @@+@w(p @$[R@<@C$RR@<@_$RR@@$ʒOɒ8ʒI@_ @@,0킀@p(pC @$[RTp$WR8_I,Ѐ(@I8pOT8,!$WROɒ8ʒI@_ @@,0킀@p(pC @$[RTp$WROɒ8ʒI@_ @@,0킀@p(pC @$[RTp$WRp8@+PpR8@?/P_8@?7PW{ @$[R@@AA@o@8AQHp@GHGGp8p{Tp$WR8_I,Ѐ(@I8pOh$8,!$WR8_I,Ѐ(@I8pOd$8,!$WR8_I,Ѐ(@I8pOl$8,!$WR8O,O8,!$WROɒ8ʒI@_ @@,0킀@p(pC @$[Rp$WROɒ8ʒI@_ @@,0킀@p(pC @$[R]p$WR8_I,Ѐ(@I8pO]8,!]p$WR8_I,Ѐ(@I8pOʒ8,!$WR8, 9(@w @$[R8,d@`$p$WR`&pd&p$WR8_I,Ѐ@AA<p(A(O\<@,!O`I,!$p{GOɒ8ʒI@_ @@,0킀@p(pC@{$p{@{@{L H G IppG$Lssp(%p ,\@PGGGp+spw$dsApA@<+@C$jd+@$d@@+Pp+< &wO͒,{O͒,$dpp(pO@PA?-Q{+< &wO͒,9{O͒,I$d@P,d@lp< lO/<T"lG&l@@P"p@L"pz,\΂@AAx p(AC x @{ ,@ p @+PpwOO,J{p$T(,pO+(pG (pG{O{,J{p$T(pG$p(%pO,J{p$T,@p,̀(@$܀p@@@,!@p(pw$܀,%@@p@AA?/Q"@@/Ppp@@Pp@@oXPpp@@Pp, ΀@p,#(pCO,J{p$TOt',!(pG$၇p(%pO,J{p$T(pw OВp@+PpwO,J{p$T,@p(lp`퓀p_pI@_@@I@@@,(퓀,ቀ(@wO6,J{p$TOx',!(pO-<&$(+pwO{,J{p$T(|pO](lpO,J{p$T{O,J{p$T(@&pO,J{p$T(pO-(@&p$<@&O#,J{p$T(@&pwD(DpG(\pG (pG{/(\#p ((#pw{Od,J{p$T(lp/<@& <@&{O,J{p$T(p$&(pw$|$p|$@@AA@OX@퓀Pp|$p퓀,@A퓀ApAGGGpOOВO I@@@踑,@AAp(AC-<$T,\΂@AAp(AC$T$|$@@AA@OX@Pp|$ppA HX@@Qp pp+@<퓀@_@<@_%O,J{퓀@Ppp$T{<|$w דp_퓀,Ѐ퓀pOד,@H,HA@AA@@<آ@C*Oד,DOדO,D{z$&|$p(DpO (@p O@{ O.@@p{/(\pOOHp{(lpOcp{ OpOВI@_@@,@AAp(AC$T(pw OВp@+Ppu,@p,@AAp(AOJ(p,#@@@,!@p(p,%p(pOp(pi (@+Ppw\퓀,@p퓀@@p@AAA_@@,퓀@@p@GGG (p(DpO!(\pOO,J{p$Thp(DpOhp{ (\pOhp(hpw$(@&p2O<hw O/@{ O5@@,J{p$T8쓀ph@@AA@I@@A AQ p( pwOВ p<hw* @+PpwO<,J{p$T{F ,(p$>p ,̀(@w ,@p(pC!O ,J{p$T<퓀 퓀 _,{퓀(p(آOד,Ѐ(p$錇(pO $p($p$(#pO,J{p$T(lpq (@+Ppd퓀p_p (I@_@@I@@@,(퓀 (,ቀ(@wO,J{p$T (,@ (p(`p`,#`p (,@AAp(AOR@@@,!@`p(`p$` (,%` (p{OВ (p<|O-(lpOH,J{p$T{ |'p{ 'ppH'p(dpOHВpp(pG$(pw p$T<wp<w@@AA@Oѓ@Pp(pKA@@AA@Oѓ@(@wO,J{O,J{(H'p+(%p"(%pO ,J{@$os'pВp(pO &p{*(|pO &p{(p &p{ &p('p(dp &pppdp<dG(@wO,J{@$` oLOВOВOВ,ꆀ@'p('p ,\^@$` ,\΂@AAYp(AC Y@$` (&pO,J{@$` <Z$رO𒀠,񒀠OOX𒀠踑,ȧ@AAx p(ACx @$` ,\΂@AA| p(AC| @$` { @@+@ ,\^{@@| pz @_@*@,\@| p{ @@+@C Ӓp<Ғ ӒCt@ Ӓ@Pp Ӓp{ۄtp| p{ @o@+@ܾp| pz @_@*@,4| px @_@@A_A(ApYp@AA| p(AC| @$` OOВO 踑,@AAx p(ACx @$`  ,2@dp(dpw OВdp(ђpd@+PpOd,J{Od ,(ђpw*I@@@d,Vބ@AA𢒀pA@$` {@dA+Qp@@𢒀p$` <Z<7ZZ (@wO,J{@$` oFOВOВOВ,ꆀ@'p('p ,\^@$` OOВO 踑,@AAx p(ACx @$` ('p𢒀p@$` <ܾw<ྑ𢒀p@$` ,\o<ZwA ,ˀ@x p%@@,Znx @@𢒀p$` {B(dp,dI@_p@@Y,ʀ%@@,Zn𢒀p@$` < ZwZO󒀠OВOG󒀠踑,ȧ@x p(x pCx @$` x ,&$` @𢒀p𢒀@$` <&Z<_Z$pp|ptppphpYp<_Zw p{l@(lpC 좒@@p(%pM('p_(@@+@w5{('pw_(@@+@w{O,J{@$` I@_@@OOВOВh踑OI@_,@@,ЂI@_,@@OВOВOВ踑,Ђ(p$I@_@@,`Ђ@x p(x pCx @$` $<tא$t,\z@p@?:穈 ?=穈{@@p(p+,\z@AA+AwO,J{@$` |א@<@C$r@<@_$r@@$p$rp$rpp$r | p(p@OO  O| 踑,l@AAx p(ACx @$` | @<|אw@@@|p$r<pO p@{  &@@| p(pJO| ,Z@ O| 踑,l@AAx p(ACx @$` | tp$r(pw+,\z@AA+AO,J{@$` OOВO 踑, @AAx p(ACx @$` 퓀 _,퓀Yp$r(pw+,\z@AA+AO,J{@$` OOВO 踑, @AAx p(ACx @$`  ,,(@O.퓀O@ ,8ቀ퓀,ɀ𢒀p@$` y{.O. ,\΂@AAx p(ACx @$` <&p𢒀p@$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw ,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw,$` <_Zw@,\΂@AAx p(ACx @$` ,𢒀p@$` <_Z$_O\Oy Ox 踑,l@AA| p(AC| @$` ,\΂@AA Ӓp(AC Ӓ@$` x ,K@AA𢒀pA@$` <_Zw,\]$` <_Z$(%pX('p3(@@+@w{('pw3(@@+@w{ (%pw{O*,J{@$` <ܾ<ܾw<ྑw{𢒀p@$` ,\j$` <_Z$,\΂@AAx p(ACx @$` O{,ڄ@x px AA@A@@@@AA,A@AA𢒀pA@$` <_Z$B,\΂@AAx p(ACx @$` O,ڄ@x px AA@A@@@@AA,A@AA𢒀pA@$` <_Z$,\΂@AAx p(ACx @$` O֒,ڄ@x px AA@A@@@@AA,A@AA𢒀pA@$` <_Z$? O쒀풀OOВ踑,ȧ@AAx p(ACx @$` x @<@w$<@G(@w$$? <@$? OOВ O Ӓ踑,l@AA| p(AC| @$`  ӒYpOOy O Ӓ踑,l@| p(| pC| @$`  Ӓp,\΂@AA| p(AC| @$` (YpK (pK{O,J{@$` (&pO<&YO &Yp( &pO< &O  &pY,:@| p| @@@@AA𢒀pA@$` ,\΂@AA| p(AC| @$` ,\@| p| @@@@AA𢒀pA@$` ,\΂@AA| p(AC| @$` ,\ @| p| @@@@AA𢒀pA@$` <_Z$! O t OOВ踑,ȧ@AAx p(ACx @$` x @<@Kl@<@Wd@@$ ,\$` ,\]$` ,\$` ,\ $` x ,$` ,\$` ,\$` Oΐ,J{@$` <_Z$ YpI@_,@@OOВOВ踑OђI@_@@,ЂI@_@@O)OOВ踑O,ЂI@_,@@,`Ђ@AAx p(ACx @$` I@_,@<@pאwN|אYpOOВO踑,ȧ@AAx p(ACx @$` {|אx p,\΂@AA| p(AC| @$` x @<@ <@G(@ {1<_@{(Ytp{'Yxp{YtpYxp{ @$` O6(Yp O@@{ OC@@,J{𢒀p@{y<_Zwm퓀ΐ_,OGOВO ,@AAx p(AC x @{&OW퓀,J{𢒀p@{@{L H G F IpppIssp!!p?s ?s{!p$!@<@C$@<@_$@@$(!?sw !p$?o[sw !p{v?oPs?o\s_??o_s_{5!p?o_sw#( !pw(ྑpܾp p{)?/s_?o~sW !p{?s !p$?/s_?o~sW !p{?sw !p$??s_?o~sW !p{?sw !p$?sw !p{R(ܾp*<  C4듀@ @sPp p{!ܾp p4듀@Pp!p$?o\sw*!p(ܾp4듀@ @Pp@{^{X!p(ܾpG @@< @C44듀@ @Pp p4듀@ @sPp p@{L IILZA_AAYp!I,%{L IppI,W&OL-,ቀL IpppIOL-,(@w+O,W& ,\*,\{L IHL,W&!I,<%YH_HHdpd@<@C$@<@_$@@$!!I@ @@,<%O'l@@AA@O'@P,!!O!,<%(!pO2!O$-,<%!$-!,<%< dw -p{ -p( pOx--,ቀ$6p<dw ,G( !pQ ! ,\*@p,%(pC%O@! !,\d憀@|,J{ !p,\o(&pw,Om!+8p O8@{ O~!@@,J{&pO!,J{O(,ቀ!O%,<%$!O,<%$!O,<%$'pྑp('pw!I@@@,<%(hpO!Oh@@@,<%!O ,<%!4듀 @@@,<%!O!,<%(!pO2!O$-,<%!$-!,<% p (-p @Pp-pOx--,ቀOV,W& !,\*L H IpppILYp( pO  ,`p@Yp (-p pY@{L IppIL(-@sPp(-p p(!p<_ {4  ,`p@Yp (-p pY@{{@{L IpIL(!pO$G!p $-p,i@Yp(YpC Y@$g{$-@cPp$-p!p,\a@AAdp(AOA!_@<@dO !_dpd$-,a@AAdp(AO d!p{ (dpCd@{. $-p$-@PYp$-p!pY@{L IppIL YpdpY@Yp(@Ox,\q@AA-p(AG -p{<_-O _-p!-,<%@AA-p(AG<|w{{@{>{dp{{(dpw@{*!-p-p-AQ@-p{L IppIo@L p p,\u(@O!,J{,,W&,W&,W& p p!I@@@,<%@AA$p(AG($pC,,\@{ɠ!,!p&p,@hp(hpC@,\(&pwO!,J{O,,\jI,,\<_h$(%pw$<K$$p(p,\Ak@@%O,$@AAp(Awo@<@$',!O,%,\6{3@<@(%,!O,%,\z$<w:(&pwO!,J{O,,r,\$<w:(&pwO!,J{O,,4,\$<w:(&pwO",J{O,,,\F$<w?(%pw6%p,!O%,%,\z$<w>(%p5%p,!O%,%,\z$<w(%po@{_@@hp{a<w+p(%pw  p{?<w6(&pwO7",J{O,,,\A{z{(%pohp+ެp(Xp h,d(|&p7h,톀@,p,@+Pp,@PAA,p,{$n&hp((pw+pw$k@@,"}@0p(0pw( pk@@,~@0p(0pw$4p(0pC4p00p'p{ 'p0p(0p<0$(0pw0O,@}$R++p @$+ p(pw$"O#O,J{<$OO#$,J{(&pvO#%@o@@@A_AA%}$R++p @$+$%,T(@C,\oOr%,J{$R+(%p$k$(H&pw$k$,\0t@$p<$G$k$'@@+@$k$,\oO%,J{(4&pw @$+O%,J{O%,J{O&,J{OA&,J{O\&,J{Ow&,J{$R+@(!pw (ྑpw{@@!pܾp p!p,\t*@ p<!O!,!p<!O!,!p pO!,PƉ(@O&,>} p{/,\􉀄@AA !p} p( p[,\o(p,O&+8p O8@{ O~!@@,J{O",J{&p p$M+( !pw$G+,\^ $-p!pOV,W&! ,%!,!p&p pOx-,(@$* p-p( pw$)( p+ @PApA@@hp p(@w  p{{3-p(-pK-@PH-p{ ,\@HHhp<Kw5+pw X@{ X@<@<@{ (p{(p{<(O7 ,N@AA,d(%p ,p(hphp{5k@@,N?@w (%p<Kw_,dk@@,N@AA,d<@Ol(%pa(|&p,톀@,p{@@,p(&p)lp(pw < w lp@@,{O&,>} pdpzzN,W&-p,W&( !pU(p ! ,\*@(p,%((pC%O' !,\d憀@|,J{ !p<-w  p<-wܾp p,\o( pO$< O,\"v(@G ,\jI p( pP&,(p,O9'+8p O8@{ O~!@@,J{(ܾpwO",J{&p p{ {,\pp,W&!,!p!,!p(p'<ܾwO",J{O$,J{O,@{L H IppHLO),pO),p+8p O8@{ O)@@,pO),pOX),pO*,p-p(-pK-@PHoH-p{,\@HoHHYp(.pwO.O7,!(.pwO.O7,!{<(.pwO.O7,!(.pwO.O7,!O.O7,@,d"O.O7,@,d"O.O7,@,d"O7,@Yp(Ypw$>Y@+Ppw$>pI@@@Y,!(pw$> I@@@,Gdp<dGRI@@dAAHH@(Ppw{;d@@AA@O@@I@@dAAHH@P,!0pdp{I@@@,!L H IppILZ/p,\O7(Cpw O7@{ O7@@,J{(X.p2,\J񆀄@ Cp C@+PpO7 C,J{/@<@C$GA@<@_$GA@@$8</wO7,J{{D</w-O8(Cpw O+8@{ O88@@,J{{OG8,J{O, C@AA+A ,d.p$AOQ8,J{O, C@AA+A ,d .p$A+$CpdO_8,J{O$CYpY@+Pp5Y@PA@oW@+@Ob8Y@PAA,J{Yp{ƠOe8,J{{%(Cpw Og8@{ O|8@@,J{O8,J{(.pC oc.p{\O8,J{.p{DO8,J{O, C@AA+A ,d .p(`6p`6,#`6p(d6pd6,#d6p(.pC ob.p@{L IppG_Llppp.@(.pw  CA,@@dpd,@H0D,HA@A<_AOYO8,J{,\(`6p`6,#`6p(d6pd6,#d6p@$j]O80D,!,\[(.p$\DC@@+@w$\D<.w (,/pw{"<.$\D(0/p$\D{dhp0D@?oTPw$\D0D@?oPPw$\D0D@?otPw$\D0D@?opPw$\DhO9,,#(@$\Dh@@?oTPw$\Dh@@?oPPw$\Dh@@?otPw$\Dh@@?opPw$\D<.woT@{oP@@ph@PA@@+@@@,@p0D,<_@G;I@@@O 9@@0D,8ቀO8I@@@,!(/pw 8p(/p(8p$WE{,\~0(@K$PE(T.pw$PE< .w$PE,GOO'/,@(@CuO9,J{O<9O,J{.p(`6p`6,#`6p(d6pd6,#d6p,\@$j]8p< .T/p/p(X.p;,\J񆀄@ Cp(8pw# C@+PpOV9 C,J{C@@+@w$GJ< .w$GJ<x.Ox.8p{ C@8p(.p.4Dp{ C@4Dp(4DpwOl94DppX6p<X6O$tG(X6pO ,d8,lO08,?X6@<@C@@,#@8p(8pO$tG(X.pB(X6pO9On9<X6O O9@{ O 0@@,J{O,,\^X6@p(@ <@{od,l{;,\k{2(%p ,\k{ <X6w ,\jI{,\.8pO,X6pz(/p8(8p/ ,d_,l,,\^$Sp<.< .wi<%{^( /p /@+Ppp /lp{3C@ @+@$ C@@A+Qpp C@@lp$I<.< .wf<%{[($/p$/@+Ppp$/lp{4C@o@@+@$ C@DA+Qpp C@Dlp{_(.pwV((/p(/@+Ppp(/lp{1 C@(Hp$ C@HA+Qpp C@Hlp(pw$IX6p(X6pOrl8,,!@8p(8pO{G(X.p4<X6O+O9<X6G O9@{ O 0@@,J{X6p{,\^_,lX6p(X6pOv4D8,, @8p(8pO{G(X.p4<X6O+O9<X6G O9@{ O 0@@,J{X6p{(8pG,@$j]$J< .w$J.@(.pw  CA@@4Dp(4Dp(4D,(@O4D8,{ C@( p> C@ ,(@O( , C@ ,C,{< .,_,l< .w$Mp(.pn( /p( /@+Ppp /8,i{=C@@+@. C@LA+Qpp C@L8,,{l(/p(/@+Ppp/8,{=C@@+@. C@PA+Qpp C@P8,(pO(CpFCH,X@p(pC,O9,J{O9,J{O?:,J{(pOp(.pw$L(pK (.pw{Og:,J{{l(/p(/@+Ppp/8,{=C@@+@. C@TA+Qpp C@T8,{l(/p(/@+Ppp/8,{=C@@+@. C@XA+Qpp C@X8,](p3(Cp*CH,X@p(pCO:,J{C@@+@w$RN< .w$RN(}.p(`6p`6,#`6p(d6pd6,#d6p@$f$%,Q(@K$a,GOO'/,@(@K$`I4pO,<@G4O=O,8ቀ{4O >,8ቀI,>}.p(`6p`6,#`6p(d6pd6,#d6p@$f$%,Q(@K$aOO%>,ቀ(@pO/>,J{OZ>O,J{.p(`6p`6,#`6p(d6pd6,#d6p@$f(.pK0D,8ቀd60Dp_,l<|w$l.(Dp((DpC (Dp$c(h.pO$c0D,@(Dp C@ (Dp0D,J{{-O>(tpO O>@{ O6@@0D,J{(tp$Df(xp$Df< .w$Df(%p!O>O,\@,J{{LO>O,\@,J{<$OO>$,J{{O>,J{.@(.pG CA@@@p(%pwx(@pOr<@$Oh(4&p_O?,J{O?$,J{Oa?@,J{O?,J{O?,J{O8,J{O?(|pw O?@{ O?@@,J{((DpOO@(D,J{{O @,J{O@,J{O4,W&@ DpOCO3OAOx],,* D,W&< . (.pw {@{{@{L H IIO8D,ቀ@{L IpG LC@@+@$O0,4΄dDp@$0j$,jdDphp<_hG`6@h@ Pphp{`6@_@Pp(dDp$,jhD,̄@hp(hpCdDp@$0jkGoGGYp+Ypw{(X.pY@@,ppdp<_dG%`6@d@dA`6ApAHHXPpdp{؄`6@_@YPpY@< @6< @G< @w$h$ jB,l(@8p$tO$COGB,I(@8p.p$tO$COSB,(@wFO$COXB,(@w0O$CO^B,(@wO$COdB,(@w{((Cpw@{@@8p.p$tO$COjB,(@8p.p$tO$COpB,q(@8p$tO$COxB,N(@8p$tO$CO}B,*(@8p!.p{xO$COB,(@{`O$COB,(@{HO$COB,(@{0O$COB,(@{O$COB,(@L IpppILYp(T.pw$u< .w$u,\@Yp(YpO' .p(X.pOB,J{$u(%p+.p(X.pOB,J{@$v{p,\jI@Yp(YpO# .p(X.pOB,J{{?(Ypw(X.pOB,J{{!.p(X.pOB,>}{(X.pOB,J{Y@{L IHLdpp(|.p ('pw {@$x(.pC @$x,\a@dp(dpC @$xdp(%p(%pG @$x(/pw(%pO%/p(/pG @$x(/pO/@@AA@O4@Pp(pw @$x.@(.pw A@@Cp@Cp/@(/pw A<@@lp(lpw O 0lpl@+Ppw @$x$%,Q(@C @$x%hp%p(.pK}@$톈@(&pw(?pw(Вp@@dGp(dGpe<O\AA@A@@@@AA<QwВdGpAA@A@@@@AA<QwӒdGp(dGpOFO$,J{@('p(%p <K{('pw(Lpw{@@DphGphIdpd@+Pp(OhGd@PAA,톀@,Ddp{(&p#(&pOFOhG,򆀠$%,T(@COF,J{@$톈,W&@Yp,\hI@+Ppw$JhI@+Pp%hI@PA@@+@ hIp{ҀlIp,\A(lIpwShI@hIp?-P$,\b,\(@$hI@hIp?-P$,\{phI@+Pp%hI@PA@@hIp+@w{phI@+Pp%hI@PA@@+@ hIp{,\hI@+Pp ,\H(@{WzY,W&(dGpOG,J{(&p#(&pO-GO2F,򆀄@{SY,W&(dGpO@G,J{(&p#(&pOVGO2F,򆀀@{L IIL(&pw(dGpw$,\a@AAYp(AC$<_YO_Yp,\Y@Yp(@Of,i@dp(dGpF@OI@gPpFp(&p+(pw < dw{F@OJ@gPpFp{,\{ ,\^L IpI@{L IppI@{L IppI@{L IppI@{L IppI@{L IppI@{L IppIssp@{L IppI@{L IppColLYpdp(Xpw$ydp<_dO$o(dpK <1dO!{<_dO <_dO{<_d$iOH(dpK<1dGd@@A@AAAH@A@{\<_dO'<_dG dCoCChphAhAAAH@A@{0<_dw!dC_lCClplAlAAAH@A@{ H@_ @+pw$뉈(Zpw$܉OY(dpK <1dO{<_dO <_dO {<_d{qONG(dpK<1dGd@@AG@A@{L<_dO<_dGdAoAApG@@{(<_dwdA_lAApG@@{ G@_@P@{ OBY@@,J{Yp(Zpw$oOF(dpK<1dGd@@A@AAAF@A@{b<_dO*<_dG#dCoCCpAAAAF@A@{3<_dw$dC_lCCpAAAAF@A@{ F@_ @+ pw$D(Zpw$5OJY(dpK <1dO{<_dO <_dO {<_d{qONE(dpK<1dGd@@AE@A@{L<_dO<_dGdAoAA pE@ @{(<_dwdA_lAA$pE@$@{ E@_@P@{ OBY@@,J{Yp(Zpw$oOD(dpK<1dGd@@A@AAAD@A@{b<_dO*<_dG#dCoCC(p(A(AAAD@A@{3<_dw$dC_lCC,p,A,AAAD@A@{ D@_ @+ pw$(Zpw$OrY(dpK <1dO{<_dO <_dO {<_d{wONhp(dpK<1dGd@@Ah@A@{O<_dO <_dGdAoAA0ph@0@{*<_dwdA_lAA4ph@4@{ h@_@P@{ OBY@@,J{Yp(Zpw$oO8p(dpK<1dGd@@A@AAA8@A@{e<_dO+<_dG$dCoCC(Lpw (&pwp<_ZO$A(hpw%(lpw(dp$A{,\a(@C$A,i@YppⳓpYp<_YO$1(YpK <1YO!{<_YO <_YO{<_Y$+O<p(YpK0<1YG+Y@@@p@@p@@p<@@@$y<_YO<<_YG5YAoAADpDHpDHpHHp<@H@{G<_Yw6YA_lAALpLPpLPpPPp<@P@{ <@_ @(Lpw${OXp(YpK=<1YG8Y`p`dp`dpddpXAdAA\p$j<_YOB<_YG;YAoAAhphlphlpllpXAlAA\p{S<_YwpO_$p{/pO_$p{ pO_$p{pO_$p{{$(܈Z@Otp(dpK<1dGd@@A@AAAt@A@{n<_dO/<_dG(dCoCCxpxAxAAAt@A@{:<_dw)dC_lCC|p|A|AAAt@A@{ t@_ @+ p$s􈀄Op(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @+ pw_d,(@C @$N%Op(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @+ pw$Op(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @ pOp(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @+ pw$Op(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @ pOp(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @+pw$6Op(dpK<1dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_lCCpAAAA@A@{ @_ @pd@<@w$?<@G<@w$$8_` C$/(CC$/x甀@@<@CK$/(DC$/x甀@@<@DK$/v@(Tw$v/C@<@xwx_LC"F,甀ALAA@@B{_B(xwA@4O甀_v@@,%vp@L H G F I_,@É@甀p(甀w$ >甀@(p甀@,p@@甀p@ @@,`@ @@,S(tO甀@vp{甀@vAp甀p,މ甀@vA⡈AAAAvp,\,\X甀@v$p_vpO@@@AA@@p_vp@@@AA@@p_vpO@@@AA@@p,\蔉(xO甀@z p{甀@vA p 甀p(|w"v@>w|p{v@|p甀@~ p甀甀,A甀A@px甀p(x甀w$=@@甀pvpx甀@pv@+w2v@*C&v@+wv@+v@+x甀@ p甀甀,A甀A@p(w$=甀@@pv@+wv@*C$6=甀,@É@Fw$=甀@F4p甀@@@{@甀AAA@@GG@甀@@,@É@Vp(Vw$=甀H{ GVpFH@H(@G甀@@,@É甀A@p(w$=甀@甀A甀BB p(甀 ,\甀(甀 ,\甀甀甀,A甀A@p(!v@(Nv@(A@{>甀,d甀plx甀pY甀p甀pvpz@@甀p甀@<@w$>v@(v@(@{@@甀p甀@<@bv@v@,ቀ(@w@@甀pv@v@,ቀ(@w@@甀p甀@<@wv@(wv@(@{@@甀pv@(|wv@(l@@甀p甀@p甀@p甀@Xp甀@|甀p甀@ 甀p甀@L H G F I@{pHHv@+HH@L H I+vw$v@v@vAvBTpTtptAvBApAvBAv@(twv@(X3v@(T'v@(`wv@(0v@(w&v@+wv@*Kv@pD{RD@w4p4@@@C@(P4@C@PS,ቀ(@wv@4AvpD<D[v@OpD$|OD@0@pDAwAAAAQPp(PH(DOD@0@P0,ቀ(@)<Dw<v@D@0@P,ቀ(@wv@DAvAApD<DZwv@vA\xpv@vAh|pv@vAxp@YL H G F E D C IpIZBpB@pB@pB@BAppB@BApp_,$L IIv@⠈@8@)v@l@@_T_v@@, @L IpIv@l@@_T_pv@@, @L IILtY@@,Pw{pHLZBR@AAAA@<@_ncw$R<@_bs[<@_nsw$IR<@_ptx%pBOhwO{,\@pvp<$mR@L H Iv@`Y@@, @H ?Xw+}@L H Iv@@Y@@,@H ? Xw+K@L H Iv@0Y@@,@H$? Xw+w@L H Iv@(,w@L H I@L H I@P@L H IppH LZAHAOwOx|H,\@BvhpXw*H(Bv@+7(Fw3H@L H G F E IW@@G,G@L H G F E IBx,(H@L H G F E IHZH9H䋓p{+?$Xw?<wHtx,@H{X@@H,+XwՀ@L H IpIv@(C @L I(ZCZpv@v@@@@@dp*Dd@@F*bfd@@EDbb@@D@@G,YL H G F E D C I>Dbb@@D@@G,W_Pv@dAA@P,S@F,^Cd@v@@E dp< dKv@*Nv@`F,^zpErHxG甀@Fo|甀E*HwNv@,S@G,^v@(w$gpUpL H G F E Iv@(8v@H@@,S@G,^L H G F E IH@@@F@>Fv@H@@@F@@@,S@G,^H@@@F@pH@@@F@>UPCv@H@@@F@P@@,S@G,^H@@@F@PUpL H G F E IH_LZHtAY@@Ax,@B􋓀XK$p(Cwt,\vA@p@?@wU|甀@E:p苓x甀px甀@싓p甀@(,甀@YL H G F E D C I(DC2El,@D|甀@(@<@El,甀@p􋓀XC E,_>XpWpEHGPw@{@@(px甀@ZAA @P px甀@ZAA@P$p+(w%|甀@ZAA @>Pw􋓀@<@$C#v@*G)|甀@ZAAD@PH{YL H G F E D C IZ, @Hx甀@ZAAD@PG+(wv@*KD􋓀C{M|甀@ZAA@PD|甀@ZAA @>Pw 􋓀C{|甀@ZAA @P@p@C+(wjD@H@@FD@G@@E{F@EAFEPwlp{CC@@lpl@H@@F{ < Vw lpF􋓀PC(甀@ZAA@PpYL H G F E D C I甀@ZAA@PpYL H G F E D C IppCLtEZD甀@<@w$̈́OT@< @w$̈́DExx@@@Y@@,@COAv@(甀@X@{甀@>@Y@甀A:AA@@dp{_>dpVS>􋓀TK >􋓀UK{?|甀@GAAD@PB􋓀@@@B@@H{ < Rw B􋓀RK>X_>XpFBH􋓀RKGB@<@GK(F$v@+^v@(Q甀@*~OEv@OtC,^甀@|p甀@~px甀@O,pv@<@@OtC,^苓p싓px甀,*$Lv@(Dw'v@(w$hv@+ $h苓@@싓@@F,-F苓p싓pv@+^v@(Q甀@*~OEv@OtC,^甀@|p甀@~px甀@O,pv@(Dv@D@{"v@@F@@,S@@F@@OtC,^Fx甀px甀,`g|甀F@@,ГL H G F IpIv@(Q甀@*~OEv@OtC,^甀@|p甀@~px甀@O,pL IpCLZB@p$_>X5X@Y@@lpW@Y@@pV@GFZ@_ p{R GRpFXpBHC@C(@G<DwZ@+ Z,ܒ<Dw&Z@+Z,lkYL H G F E D C I@YL H G F E D C IppIZt, L IpILv@?w$_vYpO@@@AA@@p_vYpO@@@AA@@pv@pv@pv@pv@p,\,P@L IppILv@+v@? Fv@(C @L Iv@+FwKv@Y@@,<%(@O_v@vAFBFpBAAAA@YPp@L IppFtFZHv@+w-v@⠈@@@BO<B[!@L H G F I@L H G F IB@AA@@@Hv@(v@G{GAH{G,VH@H(@G{pHZHpH@($H@$,ЗH@(H@,pH@(H@,pH@(H@,pH@(0&H@(0H@0,pH@0,#H@(4&H@(4H@4,#H@4,#H@(H@,#H@(H@,#H@(H@,#H,#L H IpHZHw@L H IH,(K,_>Ww$d+Dw>W W@<4@C4B{WB+Dw>W V@<8@O 8@p{V@pW>UwUp{2U@BAWpVpB@S@@dpB@@AA@@hp@dB@@@@@@,$ pplpYpGFEDC<(JzppCLZB_>VSV@Y@@pCpU@Y@@p$XK>&XG &@p@E{E(tC*X@E@@dp<@w{~EEDFOEZF,@ȉ@Yp EY@@@FFXpFp(XC@{X@ AAA(A<@AC H,FG(YB; o@&H,><@w@YL H G F E D C IG@YL H G F E D C IFZpzVp@_A0aA@ppGZG,\,\:@HGX,ቀ(@w,\࿉H@L H G IpppGZH,\,\:@G@<@G_"|p@YL H G F E D C I;w<Ewb;_W;0@{;7@{oW@@F\p>>>w3Gl@@ ,0(@wE,F@L H G F E IFEY@@$,<%<$@E,@L H G F E IppHZAtBxHl,wF$@O@<_ @w2(G"@bA; wC@YL H G F E D C I@YL H G F E D C IWp@YL H G F E D C IppDpIYCICAAA8_Cw$,IzD{pppD{ppp D{pppo@D{ppDp{ppp8DwDJpCpD{JpCp{8Dw_D0CYA;!0ACACACCACIYA;w8D CpzBDCpz7LEEFJCCOLppCC<CGt{/p80DQ8DOPpp{CB{GABG<@w"tG@@t@@x@YL H G F E D C IEEDFOx@YL H G F E D C IFCz_pHO䨓H{ H,H<$H[L H IGZHG(HwG@L H G I; _5; G{ H,Z@G @@,(@C G|p; ,#p pXppG@L H G IpppHZH; wXp@L H IH,o; w; ( <W; @L H I@L H IppHLtHoR @ ~ € N׀]ꀐ/ TwL Tրf T TπV׀e;~À G T΀^ T̀c Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. /etc/iksd.conf| KermitXMODEMXMODEM-CRCYMODEMYMODEM-gZMODEMOther $ZZ + 2 = D M TZZZZZZ#@#@ &Y~   ##~U1#,,nonexon/xoffrts/ctsdtr/cdetx/ackstringxxx1xxx2dtr/ctskeepauto$$$$ƀ$̀$Հ$܀$တ$怐$$ remotedirect-serialmodemtcp/ipx.25decnetlatnetbiosnamed-pipesshpipe%(%/%=%C%J%O%V%Z%b%m%q P, 0anonymousA1Apple IIA3MacintoshD7VMSDARSTS/EDBRT11F3AOS/VSI1VM/CMSI2MVS/TSOI4MUSICI7CICSI9MVS/ROSCOEK2Atari STL3AmigaMVStratus VOSN3Apollo AegisUNIXU8MS-DOSUDOS-9UNWindows-32UOOS/2((((((:((]((](€((ʀ(:(Ԁ((ހ((逐((((()) \))/)) >),)//#Ѐ)</)A)D\)K)N/)S)V\)a)d\*.txt*.c*.h*.r*.w*.cpp*.ksc*.bwr*.upd*.html*.htm*.mss*.tex*.nr[Mm]akefile*.hex*.hqx*.for*.f77*.f*.F*.s*.pas*.java*.el*.lisp*.sh*.perl*.awk*.sno*.spt*.sed*.TXT*read.me*READ.ME.**/.*- -&-*-.-2-6-<-B-H-N-U-[-a-g-l-x-~-------------ǀ-̀-Ӏ-ـ-߀-耐--*.gz*.Z*.tgz*.gif*.tar*.zip*.o*.so*.a*.out*.exe*.jpg*.jpeg*.tif*.tiff*.pdf*.so.**.class*.rpm*.bmp*.bz2*.BMP*.dll*.doc*.vxd*.xl**.lzh*.lhz[wk]ermit./// ////!/&/*/0/6/?456789:;<=  !"#$%&'()*+,-./01238Ԁ88888888888888888888888Ԁ88888888888က88evenoddmarkspacenoneinvalid%02ld:%02ld:%02ldUNIX Communications support, 7.0.231, 31 Dec 1999?4 AT&T 3B2 System V?l/dev/tty?none?LINESCOLUMNSFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! /dev/null%s is not a terminal device Locked by process %d %d%s %sCan't unset O_NDELAYioctl(TCSETA)setuphangupresetcloseBԀBڀBတBWarning, problem releasing lock ?WARNING - close failed: %s Removing stale lock %s (pid %d terminated) /usr/spool/locksCpLCK..%s%s/%s%s/LTMP.%05dUUCP not installed or Kermit misconfigured %10d Warning - Lockfile %s seized by pid %d Warning - Can't remove lockfile: %s Warning - Can't remove secondary lockfile: %s SzSSSSSSSSSSSSSSVVĀVĀVĀVĀVĀVĀVĀV€VĀVVĀVĀVĀV€\V\[\a\h\o\w\\\\\\\\\\^%c... Canceled... Can't send BREAKHZ%s%s %s :UNIX File support, 7.0.156, 30 Dec 1999S AT&T 3B2 System VS@rm -f SXcp Sdmv Slpwd Stls -l SScat SMailSlpSdf SSwho S /usr/adm/wtmp/var/log/iksd.logTerminal input not allowedrwa*%.24s %d %s %ld %s %c %s %c %c %s %s %d %s _ikskermit %c/dev/nullzchko: Malloc error 46 ..%sNONAME.././HOME/bin/shSHELL-c.~*~.~%d~/----------%oU1%04d%02d%02d %02d:%02d:%02d;Zx0N{eee򀀵eeeePmail %s < %scat %s | %scat %s >> %s%s %s < %secho[t%s %s'**fgen can't malloc string space LOGNAME?Privilege cancellation failure sh-i/.////../?Local resource failure: malloc ftpanonymous/usr/bin/bash/etc/ftpusersxxiks_%04x(unknown host)anonymous:Anonymous login. User %s logged in. USER=%sLOGNAME=%sHOME=%sC-Kermit functions, 7.0.187, 20 Dec 1999DisabledLocal onlyRemote onlyEnabled܀倐 -b4)Lz hM]pU6Z Q~"#In'+Af/T=23uV7J;,}?PCtiGx KXaOdRS$Y^W(j[쑖_!cgl*kNo1rs yw9{& ȡDH٪>@£F꫼mqʻ\v0B`%:< Ӥ|ߴe8E.5Error receiving file0renamereplacebackupappenddiscardaskupdateX_gnu} %cTransaction beginsGlobal file mode:binarytextCollision action:fnlist: no memory for cmargbufstdinCalibrationToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not found !++CALIBRATENONAMEAccess deniedException list refused: exception listWrite access deniedReceiving!%s?Sorry, receive filter + filename too long, %d max. Name too long/dev/nullCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup: refused: nameCan't overwrite existing directory error - can't overwrite directoryoverwritingFile has same name as existing directory error - directory exists: error - directory creation failure:Directory creation failure. path created: ۀ g s moving received file to renaming received file toFILE%02ld?Sorry, send filter + filename too long, %d max. Recovery attempted in TEXT mode: %sSending as mode: binary mode: textSending from:D4Remote system type: D7CALIBRATIONTransaction cancelled?Internal error expanding ADD list .not sentSkipped A܀܀Client Command Status Description REMOTE LOGIN required GET %-14s%s Transfer file(s) from server to client. SEND %-14s%s Transfer file(s) from client to server. MAIL %-14s%s Send file(s) as e-mail. REMOTE ASSIGN %-14s%s Assign value to server variable or macro. REMOTE CD %-14s%s Change server's directory. REMOTE COPY %-14s%s Copy a file on the server. REMOTE DELETE %-14s%s Delete a file on the server. REMOTE DIRECTORY %-14s%s List files on the server. REMOTE EXIT %-14s%s Exit from Kermit server program. REMOTE HOST %-14s%s Execute a shell command on the server. REMOTE PRINT %-14s%s Send a file to the server for printing. REMOTE QUERY %-14s%s Get value of server variable or macro. REMOTE MKDIR %-14s%s Create a directory on the server. REMOTE RMDIR %-14s%s Remove a directory on the server. REMOTE RENAME %-14s%s Rename a file on the server. REMOTE SET %-14s%s Set a parameter on the server REMOTE SPACE %-14s%s Inquire about disk space on the server. REMOTE TYPE %-14s%s Display a server file on your screen. REMOTE WHO %-14s%s List who is logged in to the server. FINISH %-14s%s Return the server to its command prompt. BYE %-14s%s Log the server out and disconnect.444Ȁ4545b555쀁66H66Ā67 7N7|77؀88@8REMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) type*.~[0-9]*~0000-00-00 00:00:00%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s -> %10ld %s %s%s%s %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiess./*Listing files: %s%s%s*/*DIRECTORY %sDIRECTORY %10s: %s%sskippingdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETEDirectory requested: Changed directory toFailed to change directory toH]HyHHǀMMMHMIIRetransmission(resend)Protocol Error:Draining incoming packets, wait...Drain complete.String too longGET Packet Internal Error 1GET Packet Too Long for ServerGET Packet Internal Error 8@ GET Packet Internal Error 9Send Packet FailureGET with no filenameGET Packet Internal Error 2Ox%dGET Packet Internal Error 3GET Packet Internal Error 4Mx%dGET Packet Internal Error 5GET Packet Internal Error 6GET Packet Internal Error 7B00treceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermit@老Ҁ*Bad packet headerBad packet lengthBad sequence numberChecksum errorCRC error(crunched)s&%c-xx-%02d-%c-%02d-%02d- Transaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate complete, size%s: no name givenmkdirrmdirDirectory %s not implemented in this version of C-Kermitcreationremoval%s %s: %s%s: removedW#Z#Zini_pkts: no memory for s_pkt%ld%dsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionoriginformatsys-dependent23456789:;<=>name@܀တ怐뀐󀐭 #//:AH܀VXZ\^`bdfhjlnpu unknown refused:gtattr: no memory for dsbuf refused: type refused: date refused: encoding refused: bad disposition refused: mail disabled refused: print disabledgattr: no memory for spbuf refused: length bytes refused: length KN+N?݀݀݀݀݀ Can't create backup file local name: mode: binary mode: textCan't open output fileFailure to openError:access deniedAccess deniedCommand or pipe failureCan't open fileauthorization failureInterruptedRefused: %sIncompleteFailure to closeCan't close file incomplete: discardedDiscarded incomplete: keptWart Version 2.14, 10 Nov 1999DC-Kermit Protocol Module 7.0.134, 31 Dec 1999hSERVERUser cancelledError sending stringLogin requiredDeleting files is disabledBadly formed server commandREMOTE HOST disabledHOST commands not availableCan't do system commandDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledREMOTE CDCan't change directoryREMOTE TYPE disabledREMOTE DIRECTORY disabledREMOTE DIRAccess deniedNo files matchCan't list directoryREMOTE DELETE disabledREMOTE DELETEIt's a directoryFile not foundDELETE failedSERVER FINISHFINISH disabledREMOTE EXITEXIT disabledSERVER BYEBYE disabledREMOTE HELPCan't send helpREMOTE SETREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPECan't type fileREMOTE MKDIRREMOTE MKDIR disabledDirectory access restrictedDirectory creation failureREMOTE RMDIRREMOTE RMDIR disabledDirectory removal failureREMOTE SPACE disabledREMOTE SPACECan't check spaceREMOTE WHOREMOTE WHO disabledCan't do who commandQUIT disabledUnimplemented REMOTE commandCan't open windowRECEIVEXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedSENDCan't execute commandCan't open file remote name:Can't send attributes deleting moving source to renaming source toUnknown errorProtocol errorERRORUnexpected packet type老! ـ쀁Ձլׂ؆ ,[۱<瀁⋀ခ\πz쥀VIIIIII=IIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIAIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIBIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIDIIIIIII IIII IIIIICIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIEIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIFIIIIIII IIII IIIIIHIII IIIIIII    11111111111111111111111111111111 1!"#1&1(%11111')*-/.$11111111 1,11 11+110111 1111111IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIG4IIIIIIIIIIII IIII53IIIIIII IIII IIIII2III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIIII IIII IIIIIHIII IIIIIII%s -s %c%s%c %s%s %sREMOTE QUERYREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedREMOTE COPY disabledREMOTE COPYCan't copy fileREMOTE RENAME disabledREMOTE RENAMECan't rename fileAlready logged in.REMOTE LOGOUTLogged outUsername too longLogged inLogged in as guest - restrictions applyLogin failedAccess denied.Logout ignoredLogin ignored.Logout ignored. IKSD IDLE TIMEOUT: %d sec SERVER IDLE TIMEOUT: %d sec SERVER DISCONNECTSEND disabledproto set binary modeA Kermit server is not available IKS client/server failureA Kermit Server is not availableproto reset binary mode failed:?No connection Sorry, you must 'set speed' firstCan't open lineCan't condition lineCarrier required but not detectedsrgcjhk Sorry, only Kermit protocol is supported in this version of Kermit KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server doneGET disabledUnknown GET ParameterGET without filenamej|jjjjjjujjjjjjj+jiCommand package 7.0.121, 24 Dec 1999`aprilaugustdecemberfebruaryjanuaryjulyjunemarchmaynovemberoctoberseptember͖͐͝ ͦͯͷͼ Command? Ψ /%s%s:%s %s%s%s ?Memory allocation failure ?Name too long - %s %sfatal error: unable to allocate command bufferscmpush: no memory for cmpcmnum: illegal radix - %d Output file?Name too long ?Wildcards not allowed - %s /dev/tty?Write permission denied - %s ?Default name too long IKSD IDLE TIMEOUT: %d sec ?Timed out Command or field too long Expanded name too long ?cmifi: malloc error ...?Wildcard matches more than one directory /?No %s match - %s directoriesfiles?Too many %s match - %s ?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s %s Default name too long %c %s?Partial name too long ?Directory name too long ?Completed name too long Directory name Input file specification %s?Expanded name too long : %s , one of the following: 。Date and/or time?Evaluated date too long Invalid date or time - "%s" Oops, command recall error ?Not confirmed - %s Press the Return or Enter key to confirm the command  ^χ?cmfdb - unexpected function code: %d Does not match filename or switchDoes not match filename or keywordNot a number or valid keywordNot a number or valid switchNot valid in this position?%s: "%s" 耂-aѯ#҃ӢӸӸӌӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӸӭӸӸӗ?Saved word too long ?Field too long error 1 ?Field too long error 2 ?Too long #3 ?Too long #4 %s %s%s?Command too long, maximum length: %d.  AAAAAAAAAAeeeeeeeeee=eeeeeeeeeeLeeeeeeee[eeeeeeeeeee=eeeeeeeeeeLeeeeeeee[Trustees of Columbia University in the City of New York. Press ? for a list of commands; see documentation for detailed descriptions. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support.More info at the Kermit Project website, http://www.columbia.edu/kermit/.؀_a߬D܀&Syntax: ARRAY verb operands...Declares arrays and performs various operations on them. Arrays havethe following syntax: \&a[n]where "a" is a letter and n is a number or a variable with a numeric valueor an arithmetic expression. The value of an array element can be anythingat all -- a number, a character, a string, a filename, etc.The following ARRAY verbs are available:[ ARRAY ] DECLARE arrayname[n] [ = initializers... ] Declares an array of the given size, n. The resulting array has n+1 elements, 0 through n. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ... by including = followed by one or more values separated by spaces. If you omit the size, the array is sized according to the number of initializers; if none are given the array is destroyed and undeclared if it already existed. The ARRAY keyword is optional. Synonym: [ ARRAY ] DCL.ARRAY SHOW [ arrayname ] Displays the contents of the given array. A range specifier can be included to display a segment of the array, e.g. "array show \&a[1:24]." If the arrayname is omitted, all declared arrays are listed, but their contents is not shown. Synonym: SHOW ARRAY.ARRAY CLEAR arrayname Clears all elements of the array, i.e. sets them to empty values. You may include a range specifier to clear a segment of the array rather than the whole array, e.g. "array clear \%a[22:38]"ARRAY SET arrayname value Sets all elements of the array to the given value. You may specify a range to set a segment of the array, e.g. "array set \%a[2:9] 0"ARRAY DESTROY arrayname Destroys and undeclares the given array.ARRAY RESIZE arrayname number Changes the size of the given array, which must already exist, to the number given. If the number is smaller than the current size, the extra elements are discarded; if it is larger, new empty elements are added.ARRAY COPY array1 array2 Copys array1 to array2. If array2 has not been declared, it is created automatically. Range specifiers may be given on one or both arrays.[ ARRAY ] SORT [ switches ] array-name [ array2 ] Sorts the given array lexically according to the switches. Element 0 of the array is excluded from sorting by default. The ARRAY keyword is optional. If a second array name is given, that array is sorted according to the first one. Switches: /CASE:{ON,OFF} If ON, alphabetic case matters; if OFF it is ignored. If this switch is omitted, the current SET CASE setting applies. /KEY:number Position (1-based column number) at which comparisons begin, 1 by default. /NUMERIC Specifies a numeric rather than lexical sort. /RANGE:low[:high] The range of elements, low through high, to be sorted. If this switch is not given, elements 1 through the dimensioned size are sorted. If :high is omitted, the dimensioned size is used. To include element 0 in a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort elements 0 through n). You can use a range specifier in the array name instead of the /RANGE switch. /REVERSE Sort in reverse order. If this switch is not given, the array is sorted in ascending order.Various functions are available for array operations; see HELP FUNCTION fordetails. These include \fdimension(), \farraylook(), \ffiles(), \fsplit(),and many more.P_oᵀ_ˀ_Ԁk_⧀_ЀL㕀ـ#p一_[妀_4xÀ_[_瞀綀_တG蒀_ۀ>_酀鷀Iꖀ_굀ƀ_FT_룀뮀_?쉀ր l_펀홀怐_J&Syntax: COPY [ switches ] file1 file2 Copies the source file (file1) to the destination file (file2). If file2 is a directory, this command copies file1 under its own name to the given directory. Only one file at a time may be copied; wildcards are not supported. Switches: /LIST Print the filenames and status while copying. Synonyms: /LOG, /VERBOSE /NOLIST Copy silently (default). Synonyms: /NOLOG, /QUIET /SWAP-BYTES Swap bytes while copying. /FROMB64 Convert from Base64 encoding while copying. /TOB64 Convert to Base64 encoding while copying.쀐^𪀐_ _]g_񝀐񫀐_ɀԀ_ &Syntax: RENAME [ switches ] file1 file2 Renames the source file (file1) to the destination file (file2). If file2 is a directory, this command moves file1 under its own name to the given directory. Only one file at a time may be renamed; wildcards are not Print the filenames and status while renaming. Synonyms: /LOG, /VERBOSE Rename silently (default). Synonyms: /NOLOG, /QUIET򐀐򸀐P_ 󘀐_]倐&Command-line options are given after the program name in the systemcommand that you use to start C-Kermit. Example: kermit -i -s oofa.exetells C-Kermit to send (-s) the file oofa.exe in binary (-i) mode.Command-line options are case-sensitive; "-s" is different from "-S".If any "action options" are included on the command line, C-Kermit exitsafter executing its command-line options. If -S is included, or no actionoptions were given, C-Kermit enters its interactive command parser andissues its prompt.Command-line options are single characters preceded by dash (-). Somerequire an "argument," others do not. If an argument contains spaces, itmust be enclosed in doublequotes: kermit -s "filename with spaces"An option that does not require an argument can be bundled with other options: kermit -Qis oofa.exeExceptions to the rules: . If the first command-line option is a filename, Kermit executes commands from the file. Additional command-line options can follow the filename. . The special option "=" (equal sign) or "--" (double hyphen) means to treat the rest of the command line as data, rather than commands; this data is placed in the argument vector array, \&@[], along with the other items on the command line, and also in the top-level \%1..\%9 variables. . A similar option "+" (plus sign) means: the name of a Kermit script file follows. This file is to be executed, and its name assigned to \%0 and \&_[0]. All subsequent command-line arguments are to be ignored by Kermit but made available to the script as \%1, \%2, ..., as well as in the argument-vector arrays. The initialization file is not executed automatically in this case. . The -s option can accept multiple filenames, separated by spaces. . the -j and -J options allow an optional second argument, the TCP port name or number.Type "help options all" to list all the command-line options.Type "help option x" to see the help message for option x.C-Kermit also offers a selection of "extended command-line" options.These begin with two dashes, followed by a keyword, and then, if the optionhas arguments, a colon (:) or equal sign (=) followed by the argument.Unlike single-letter options, extended option keywords aren't case sensitiveand they can be abbreviated to any length that still distinguishes them fromother extended-option keywords. Example: kermit --banner:oofa.txtwhich designates the file oofa.txt to be printed upon startup, rather thanthe built-in banner (greeting) text. To obtain a list of availableextended options, type "help extended-options ?". To get help about allextended options, type "help extended-options". To get help about aparticular extended option, type "help extended-option xxx", where "xxx"is the option keyword.At present, most of the extended options apply only to the Internet KermitService Daemon (IKSD). Type "help iksd" for details.P_ƀ_݀_ _fA_T倐__)_x___?р_iGڀ__>_؀_X뀐8__ʀY瀐0_G_& %s, Copyright (C) 1985, 2000, %s %s passwordpromptuserid   allcautiousminimalnone   prefixedunprefixed 0 9newold \ `diagnosticserror | pacingspecial-escapes 1234blank-free-2     countsprefix 4 ;automaticoffon \ f j \ f jquietverbose  sessiontimestamps f j  fullhalf8=/direct-serial/modem/remote\krzkeepxon/xoff \  zbellcodecresclfxoffxon   asciibinarydebugtextcinternationallocallong-distance ask  f jcapabilitiescarrier-watchcommandcompressiondata-compressiondial-commanderror-correctionescape-characterflow-controlhangup-methodkermit-spoofmaximum-speednamespeakerspeed-matchingtypevolume4AOWct  01highlowmediumat-commandsdcechardware-flowhwfcitukssbsoftware-flowspeed-bufferingswfctbtelebitv25bis-commandsW ( -147@EU@Z]earea-codeconfirmationconnectconvert-directorycountry-codedirectorydisplayforce-long-distancehangupignore-dialtoneintervalininit-stringintl-prefixintl-suffixlc-area-codeslc-prefixlc-suffixld-prefixld-suffixlocal-area-codelocal-prefixlocal-suffixmmacromemethodmnp-enablemodem-hanguppbx-exchangepbx-inside-prefixpbx-outside-prefixpulse-countriesrestrictretriessortstringsuffixtesttimeouttf-area-codetf-prefixtoll-free-area-codetoll-free-prefixtone-countriesHWR_)gyt  /2., - )9,F-SU4[^ep  3}!"# ; 5*%$7&'&',66modem-commandrs232-signalv24-signalautoanswerdial-mode-promptdial-mode-stringhangup-commandno-flow-controlpredial-initpulsetone W 0 AP`m 7sautorts/cts< Adefault< |mskermitshell/match-dot-files/no-match-dot-filesbriefftp & evenhardwaremarkoddspace Te YH bm go ks Te goz f jmessagepath!!file!, f jon-disconnectstatuswarning!\!j!qalways! f jremote f j!discard"<""Vn΀퀃T怃$<ӀӀ뀃Sorry, command disabled %s Modem carrier-watch: off on auto unknown Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s Modem compression: %s Modem speed-matching: %s (interface speed %s) changesis locked Modem flow-control: none xon/xoff rts/cts Modem hangup-method: %s Modem speaker: %s Modem volume: %s Modem kermit-spoof: %s Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Speaker on: %c Speaker off: %c Volume low: %c Volume medium: %c Volume high: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: %c Ignore-dialtone: %c Predial-init: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. %ld - illegal value, must be 0 or positive Internal time conversion error, sorry. %05ldnumeric key code, or the word CLEAR,clear Press key to be defined: ?Error reading key ?key code must be between 0 and %d Sorry, %d is the CONNECT-mode escape character Enter new definition: key definition, or Ctrl-C to cancel this command, or Enter to restore default definition?Key definition too long  7E17E27M17M27O17O27S17S28E18E28N18N28O18O2ETEXE\E`EdEhElEpEt Ex E|E E E zETEXE\E`EdEhElEpE|EtExEEEdeletepurgeF|F&zgotherxxmodemxmodem-crcyymodemymodem-gzmodemFFFFFFFFF {%s}?Sorry - maximum length is %d ?Sorry, REDIRECT capability required for external protocols. Optional command to send to host prior to uploading in binary modeOptional command to send to host prior to uploading in text modeOptional command to send to host to start Kermit serverExternal command to SEND in BINARY mode with this protocolExternal command to SEND in TEXT mode with this protocolExternal command to RECEIVE in BINARY mode with this protocolExternal command to RECEIVE in TEXT mode with this protocol|lprPrinter or file name?Directory names not allowed Sorry, printing disabled ?Memory allocation failure ?Access denied - %s ...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. 310Send buffer size?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small Receive buffer size%d400/client, /server or?This switch does not take arguments ?Unexpected value - %d desired server stateUNKNOWNdesired client stateparameter for TELNET negotiationsinitial TELNET echoing stateterminal type for TELNET connectionsDOacceptWILLu?Sorry, command disabled. Prompt string%% fields are not used in this command. Positive number?A positive number, please bytesize for command characters, 7 or 87 ?The choices are 7 and 8 maximum number of commands in recall bufferCommand screen width, characters80Command screen height, rows24?Sorry, debug log feature not enabled Number of seconds before starting to send5EXIT status codeFlow control type, one of the following: keep none xon/xoff or connection type?No keywords or switches match: "%s" Flow control typeASCII value?Character must be in ASCII control range Program's command promptMaximum retries per packet403Number of seconds, or 0 for no idle timeoutInterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs 404Name of file420type of fileTransmission rate for %s in bits per second?Sorry, you must SET LINE first ?Speed cannot be set for network connections ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, 134.5 bps %s, %ld bps character-setASCII code for cancellation characterCancel character must be in ASCII control range How many required to cause cancellationNumber must be 2 or greater ?Sorry, only Kermit protocol is available 410Sorry, access to pipes is disabled who expands wildcardswhether to match filenames that start with "."Shell expansion is disabled Window size for Kermit protocol, 1 to 32Window size for ZMODEM protocol, 0 to 65535Window size for current protocol?SET WINDOW does not apply to %s protocol 406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. TELNET IAC = 255, CR = 13, not affected. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. Sorry, not on a TELNET connection. repeat-count compression parameter(not implemented yet, nothing happens) ?Illegal value for prefix character Seconds from now, or time of day as hh:mm:ss?Number, expression, or time of day required ?Alarm time is in the past. Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. value for login scriptSorry, too long Name of temporary directoryPATHEDITORName of preferred editorFull path of preferred editor?A single file please editor command-line optionsfield separator,?A single character, please. ?A non-alphanumeric character, please. ?Sorry, command disabled. CD PATH stringStop bits for serial deviceSerial device character size, parity, and stop bitsfor commandTime limit for ASK command, secondsNot implemented - %s B݀C考C考C考C考C考CC考CۀB݀C考C考B݀B݀B݀C考C考C考C考C考C考C考C考C考B݀C考C考C考C考CGG怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃D G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃D4G怃G怃G怃GۀG怃G怃G怃ED?G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃G怃DIhIsJI~JIIIIIJIIIȀJIπISI]IրI考I߀IJJJJIJIddɀehjlklklklkhdlklkiGjဃlklklklklklklklkgkgklkdjjjjƀy~߀z~߀~߀~߀z~߀~߀~߀~߀~߀~߀~߀~߀{C||{}}$}1~ـ񀃁y "|w.逃 2h怃Zooo߀ooooꀃooooooo瀃c̀ooqooom쀃Ҁkŀoooـ퀃Oo_* A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. OK to close? OK to exit? control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d 255: %d SET SEND DOUBLE characters: %d SET RECEIVE IGNORE characters: 0123456789ABCDEFSunMonTueWedThuFriSat]쀑]]]]^^JanFebMarAprMayJunJulAugSepOctNovDec^$^(^,^0^4^8^<^@^D^H^L^P_lineapcactiveargcargsauthnameauthstateauthtypeblockcheckbyteordercmdbufsizecmdfilecmdlevelcmdsourcecolsconnectioncountcpscpucrc16cttycx_timed$acd$ccd$ipd$lcd$lcpd$lpd$pxd$pxxdatedaydialcountdialnumberdialresultdialstatusdialsuffixdialtypedirectorydm_lpdm_spdm_pddm_tddm_wadm_wddm_rcdownloadeditoreditfileeditoptserrnoerrstringescapeevaluateexitstatusfilenamefilenumberfilespecfsizeftypeheraldhomehosthwparityinputincharincountinidirinmatchinstatusintimeinwaitipaddresskbcharlinelocallockdirlockpidmaclevelmacrominputmodelmodemm_aa_offm_aa_onm_dc_offm_dc_onm_dialm_ec_offm_ec_onm_fc_hwm_fc_nom_fc_swm_hupm_initm_namem_pulsem_sig_cdm_sig_ctsm_sig_dsrm_sig_dtrm_sig_rim_sig_rtsm_tonenamendatendaynewlinentimeosnameosreleaseosversionpacketlenparitypasswordpexitstatpidplatformprinterprogrampromptprotocolp_8bitp_ctlp_rptqueryreturnrowssendlistserialsetlinemsgspeedstartupstatussysidsystemterminaltesttextdirtfsizetftimetimetmpdirtriggerttyfdty_lnty_lcty_lmuseridversionwindowxferstatusxfermsgxfer_badpacketxfer_timeoutxfer_retransmitxprogramxversion^W^]^^ ^^^^^^^^^^,_0_ _&____!_&_.:_39_8;_=h_Bh_H<_M_R_X_]_a_k\_v[_$___________A_n_p_o_U_V`}` 8` `!b`*c`5`>`D)`Js`Q`V`[`d`j!`q"`yS``R`~``^`` ``````/``7`G`H`EaDaCaGaFa'Ka/Ma7La?JaEBaLaSNa[adanaxaaaOaaaa+aaaaaYa#a>adaaa b|bb?b@b&fb-eb3gb94b? bF-bKxbTb[bfbl5btb{1b b.btbbbbbQbybbbbb=bbZbubwcccc-mc6Xaaconvertabsolutearraylookb64decodeb64encodebasenamebreakcacapcapitalizecapscharacterchecksumcodecommandcontentscvtdatedayofyeardefinitiondialconvertdimensiondirectoriesdirnamedoydoy2dateexecutefileshex2iphex2nhexifyindexip2hexjdateleftlengthliteralloplowerlpadltrimmaximumminimimmjdmjd2datemodulusn2hexn2octaln2timenextfileoct2npathnamepatternpermissionsradixrandomrawcommandrdirectoriesrfilesreprepeatreplacereverserightrindexrpadrsearchsearchsizespansplitstripbstripnstripxsubstringtablelooktod2secstrimunhexifyupperverifywordjjaj]j`j_j5j+j/j/j/j/jk3k k6k_4k M_X_]Sk(Nk2k=OkILkSAk_CkgNkkP_K` kt k|kkk)kk`kNkkkk9kkk.kkkQkRkk>k?lWaTl aVll2l$l,Xl8l>DlE7lPBl]@ld lh lolw llll[lZll,lFll:l8ll^bUlVl-l*l llEmZappendnewqLqS\v(home){%s} prescan: no memory for kermrc.kermrc=+--Extended argument errorinvalid argument bundlingmissing usernameusername too longmissing name in -y퀃ˀ?Sorry, IKSD cannot CONNECT. Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. _apc_commandsnone?Can't start command: %s ?Can't open file %s Can't open device %s Can't condition line ^C... ?Input error ?Can't transmit character ?Connection lost ?Output error Connection closed. Session Limit exceeded - closing connection. ?Communications error Can't TRANSMIT buffer ?Timeout ?Anonymous log creation not allowed Name of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.logCX.LOGName of connection log file ?Unknown log designator - %d ?Sorry, %s is a directory name DispositionlĀр뀃;;;;?%s - %s Transaction Log:%02dtextbinaryunknown Transfer Bell: %s Transfer Interruption: %s Transfer Cancellation: %s Transfer CRC-calculation: %s Transfer Display: %s fullscreencrtbrief Transfer Locking-shift: forced%senableddisabled,%s%s not used Transfer Mode: %s automaticmanual Transfer Pipes: %s Transfer Protocol: %s Transfer Slow-start: %s ؀0 Connection type: %s Current flow-control: %s Defaults by connection type: %-14s: %s %-14s: (%d) Communications Parameters: Host: %s%s (reliable) %s: %s%s, speed: Line (closed)75/1200134.5%ld Mode: , mode: remote, modem: %s Parity: %s%shardware , stop-bits: (default), stop-bits: %d (8%c%d) (7%c%d) (8N%d) D, duplex: %s, halffullflow: %s, handshake: %d none offonauto Carrier-watch: %s, timeout: %d sec, timeout: none, close-on-disconnect: %s Lockfile: %s Secondary lockfile: %s Terminal bytesize: %d, escape character: %d (^%c) %20s %12s %12s %12s %12s Telnet OptionMe (client)U (client)Me (server)U (server)%20s UNKNOWN%12s %12s %12s %12s %20s %12s %12s %12s %12s WILLWONTΪΪάΪάάάάάάάάάάάάάάάάάάάΪΪάάάάάάΪάάάΪάΪΪΪάάάάάάΪΪάΪSET TELNET parameters: echo: %s NVT newline-mode: off (cr-nul)on (cr-lf)raw (cr)(lf) kermit: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %sstartedstopped u, n/a me, %s; me, n/a; BINARY newline-mode: binary-mode: me, accepted; me, refused; u, %s; me, %s BINARYNVT binary-transfer-mode: %s bug binary-me-means-u-too: %s bug binary-u-means-me-too: %s bug sb-implies-will-do: %s terminal-type: TERMnone (%s will be used) ؒf|ب*:Jٍ}ٝ٭րڪ쀃n^~ێрဃ No networks are supported in this version of C-Kermit (none) \\%c\{%d} Dial status: %d Dial directory: %s (none) Dial directories: %2d. %s Dial method: auto defaultpulse tone Dial sort: %s Dial hangup: %s Dial display: %s on Dial retries: %-6d Dial interval: %d Dial retries: (auto) Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s Dial confirmation: %s Dial convert-directory: %s ask Dial ignore-dialtone: %s Dial pacing: %d Dial prefix: %s Dial suffix: %s Dial country-code: %-12sDial connect: %s %squietverbose Dial area-code: %-12sDial restrict: international long-distance local ? Dial lc-area-codes: %s Dial lc-prefix: %s Dial lc-suffix: %s Dial ld-prefix: %s Dial ld-suffix: %s Dial force-long-distance %s Dial intl-prefix: %s Dial intl-suffix: %s Dial toll-free-area-code: Dial pulse-countries: Dial tone-countries: Dial toll-free-prefix: %s Dial pbx-exchange: Dial pbx-inside-prefix: %s Dial pbx-outside-prefix: %s Dial macro: %s relative 0' Transfer mode: %s File patterns: %s (but disabled by TRANSFER-MODE MANUAL) (SHOW PATTERNS for list) Default file type: %s File type: %s converted(unknown) File names: %s Send pathnames: %s Receive pathnames: %s Match dot files: %s yesno Wildcard-expansion: %s shellkermit File collision: File destination: %s nowherescreendiskkeep File incomplete: %s File bytesize: %d File end-of-line: crlfcrlf File download-directory: %s Send move-to: %s Send rename-to: %s Receive move-to: %s Receive rename-to: %s Initialization file: %s Kermit doc files: %s Disk output buffer: %d (writes are %s, %s) bufferedunbufferedblockingnonblocking Longest filename: %d Longest pathname: %d Last file sent: %s Last file received: %s Also see: SHOW PROTOCOL, SHOW XFER, SHOW PATTERNS, SHOW STREAMING Protocol: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Cancellation: %s %d %d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Pause: %11d%9d Attributes: %s Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' 8th-Bit Prefix: ('%c' but not used) Packet Length:%11d %8d Repeat Prefix: '%c' Repeat Prefix: ('%c' but not used) Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: Auto-upload command (binary): %s Auto-upload command (text): %s Auto-server command: %s Packet timeouts: dynamic %d:%d Packet timeouts: fixed%-31sSend backup: %s Transfer mode: %sautomatic manual Transfer slow-start: %s, crc: %s Transfer pipes: %s Send filter: %s Receive filter: %s Also see: SHOW FILE, SHOW XFER Executed by external commands: SEND command (binary): %s SEND command (text): %s RECEIVE command (binary): %s RECEIVE command (text): %s Autoreceive command (binary): %s Autoreceive command (text): %s Show what? (Type "show ?" for a list of possiblities.) No file transfers yet. status : SUCCESS FAILURE (interrupted) FAILURE (i/o error) FAILURE crc-16 of file(s) : %ld crc-16 of file(s) : (disabled) reason : %s remote system type : %s files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) control characters : %ld prefixed, %ld unprefixed 8th bit prefixing : yes [%c] no locking shifts : %s window slots used : (streaming) window slots used : %d of %d reliable: : %s%s not negotiated clearchannel: : %s%s packet length : %d (send), %d (receive) compression : yes [%c] (%ld) block check type used : blank-free-2 block check type used : %d elapsed time : %d sec, %s transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps (%d%%) effective data rate : %ld cps peak data rate : %ld cps Use STATISTICS /VERBOSE for greater detail. ?Connection %s %s is not open. to?INPUT initialization error Internet Kermit Service in SERVER mode. Please use REMOTE commands. Fatal error - disconnected. cYn?malloc error 6 ;Zx0N<[y1O0-1%04d%03d %s%04d%03d%04d%02d%02d %s%04d%02d%02d ?\fexec() too deeply nested %d%s*1 %lu%u%lx%lo0%lx\&%c[%d]%02d:%02d:%02d-2INTERNAL_ERRORARG_TOO_LONGARG_OUT_OF_RANGE%s<*>%d.%d.%d.%d00000000%02x%02x%02x%02x?%s !!!!!M!M!M!M!!M!M!M!!M!M!M!!M!!M!!!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!M!!M!!M!M!!!!M!M!M!M!M!M!!!M!M!M!!M!M!M!M!M!M!M!!!M!M!!!M!!M!M!M!M!!!M!M!M!M!!!M!M!!!!!!!!!!!!!M!M!!!!!!M!M!M!M!M!M!M!M!M!M!M!M!M!!Ԁ(((("=(((!((P$~(((((((((((((((((((((((((((((((((((((((((((($~$~$~(Ҁ/n1Ԁ/0303031Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ.]1Ԁ/!-1Ԁ1Ԁ(Ҁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ1Ԁ(Ҁ(Ҁ9C49؀;ŀC4C4C4C4C4C4C4C4C4C4C4C4<_= ?yA[C[C[F HHF݀GGeGGÀGÀIIJ,NԀNԀNԀL逄L逄NԀNԀNԀMN,NԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀNԀKXtWZ퀄XYZ)[D[DXtXt\]ti]i]i]i]^B^Bbbc䀄i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]i]d[????./UNIXC-Kermitu3bfileevenmarkoddspaceimagelabeledmacbinary2480TMPDIRTEMPTMP/tmp/EDITOR.%s%s|(default)rejectedNULL 8%c%d 7%c%d 8N%drs sBtuuuuuur〄t uutsuutuÀvwJwހxxrxrxrxrxrxrw=wxrvȀxev'xrxrxrxrxrxrxrxrxrxrxrwWwkxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrwx{{{{{{{{xǀxyyAyhyyz1z{R{{ր|c~h|~h~h|~h}d}}}~A|Հ|뀄}}|뀄}-~~((~("/<Yvꀄ(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((̀O\i؀2_怄@mǀ􀄄8tM8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888!`ငրMZw耄9:a nBB^BЀBB퀄k퀄䀄񀄎XXXX*Q^XԀLsn݀)V}. <?definition is circular or too deep \&a%s(\v(dir)) C-Kermit>(\v(dir)) IKSD>(set parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 18set win 4, set rec pack 2200, set prefix cautiousxset win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all, set reliable off, set clearchannel off_assign _for\v(cmdlevel) { _getargs,define \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)Hm怑\_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)xˀ\_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:default,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)@d\_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)耑\successtimeoutinterruptedinternal errori/o error\/usr/local/doc//usr/share/lib//usr/share/doc//usr/local/lib//usr/local/share//usr/local/share/doc//usr/local/share/lib//usr/doc//opt//doc/􀑿$4F\r|\K_INFO_DIRECTORYK_INFO_DIR/%s%sckermit2.txt%s%sckermit2.txt%skermit/%s%skermit/%s/%ld75/1200.5cmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for xquietcmdini: no memory for kermrccmdini: no memory for apcbufcmdini: no memory for linecmdini: no memory for tmpbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_xif_while_switx\&@[%d]\&_[%d]=--+\%0r?%s - %s %s ?Memory allocation failure [getnct] %3d. %sWARNING: Last line of %s lacks terminator command filedirectory file?Line too long, maximum length: %d. %2d. File : %s (line %d) FORXIFWHILESWITCH %2d. Macro : %s 00. ERROR : Command source unknown %2d. Prompt: (top level) COMMAND PROMPT ************************* SEND-class command failed. Packets sent: %d Retransmissions: %d Timeouts: %d Transfer canceled by receiver. Receiver's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: s do does . Did you start a Kermit receiver on the far end? . Try changing the remote Kermit's FLOW-CONTROL setting. . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET PREFIXING ALL. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET CLEAR-CHANNEL OFF. . Try it again with SET PARITY SPACE. . %sive a ROBUST command and try again. As a last resort, gGAlso: . Be sure the source file has read permission. . Be sure the target directory has write permission. (Use SET HINTS OFF to suppress hints.) ************************* RECEIVE- or GET-class command failed. Packets received: %d Damaged packets: %d Packet length: %d Transfer canceled by sender. Sender's message: "%s" . Did you start a Kermit sender on the far end? . Choose a different FLOW-CONTROL setting and try again. . Try smaller packets (SET RECEIVE PACKET-LENGH). . Try a smaller window size (SET WINDOW). . As a last resort, give a ROBUST command and try again. . Give a ROBUST command and try again. . Try telling sender to SET PREFIXING ALL. . Try giving a ROBUST command to the sender. on_closeCommand file terminated by error. Command error: macro terminated. ?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersCommand ?Invalid - "%s" Command stack: ?Invalid: %s Kermit command error in background execution%s̨--̔-y#̔̉Variable name(s)\fcontents(%s)\fdefinition(%s)?Failure to allocate storage for local variables?Connection %s %s is not open. toon?OUTPUT initialization error ?OUTPUT execution error %s, for%s Copyright (C) 1985, 2000, Trustees of Columbia University in the City of New York. Type ? or HELP for help. TEXTtextBINARYbinary>>> %s: "%s" >>> %s: (undef) ?addmmac malloc error: %s !addmmac internal error! ?addmac malloc error 2 addmac macro error 7: %s ?Macro table overflow ?addmac malloc error 3: %s ?addmac malloc error 5: %s _for_swi_whi[%d] -F: "%s" [%d] -M: "%s" ?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open Transaction Log Closed?Connection log wasn't open ?Unexpected log designator - %d x󵀄ЀЀboffautomatic(unknown) Key code \%d => String: \{27}[\{%d} String: \{27}[%c String: \{27}\{%d} String: \{27}%c String: Character: \%u%c \%u (self, no translation) \{%d}%c Versions: %s Numeric: %ld Built for: %s Patches: %s (none) %s for%s %s %s %s Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminalTERM %19s: %-13s %13s: %-15s TypePrintEcholocalremoteLocking-shiftNewline-modeCr-displaycrlfnormaluncheckedAPCAutodownload %19s: %-13d %13s: %-15d HeightWidthDebugSession log CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL %19s: %-13s Suspend Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: Set file type: %s Set file patterns: %s Maximum patterns allowed: %d File binary-patterns: File text-patterns: (none) {%s} %s Output pacing: %d (milliseconds) Output special-escapes: %s Input autodownload: %s Input cancellation: %s Input case: %s observeignore Input buffer-length: %d Input echo: %s Input silence: %d (seconds) Input timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Array name?Bad array: %s Array not declared: %s Dimension = %d %3d. %s Declared arrays: \&%c[%d] No arrays declared Sorry, command disabled. Press key: ?Error reading key Macro namePattern%s - not found Macros: No network support in this version of C-Kermit. %d Function: Status: GET %s SEND %s MAIL %s PRINT %s REMOTE ASSIGN %s REMOTE CD/CWD %s REMOTE COPY %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE QUERY %s REMOTE MKDIR %s REMOTE RMDIR %s REMOTE RENAME %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s EXIT %s ENABLE %s Server timeout: %d Server idle-timeout: %d Server keepalive %s Server cd-message %s Server display: %s Server login: "%s", "%s", "%s" Server get-path: (none) %d. %s SUCCESSFAILUREVariable name or pattern* The following functions are available: \F() \v(%s) = Global variables: \%%%c No variables defined Macro arguments at level %d (\v(argc) = %d): (NULL) \%%%d = %s \&_[%d] = %s Top-level arguments (\v(argc) = %d): Type SHOW DIAL to see DIAL-related items. Type SHOW MODEM to see modem-related items. Command quoting: %s Take echo: %s Take error: %s Macro echo: %s Macro error: %s Quiet: %s Function diagnostics: %s Function error: %s Script echo: %s Command buffer length: %d Atom buffer length: %d File type: %s Terminal bytesize: %d Terminal echo: %s Transmit EOF: ^%c Transmit Fill: %d Transmit Fill: (none) Transmit Linefeed: %s Transmit Prompt: %d (%s) Transmit Prompt: (none) Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d (millisecond%s) s Transmit Timeout: %d (second%s) Escape character: Ctrl-%c (ASCII %d, %s): %s , speed: unknownauto, carrier: %s, timeout: %d sec, timeout: noneType SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Character set translation is not supported in this version of C-Kermit Exit warning %s always Exit on-disconnect: %s Current exit status: %d Printer: %s%s | (default) Command autodownload: %s Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s Command interruption: %s Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Hints: %s Quiet: %s Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Suspend: %s Alarm at %s %s (no alarm set) send-list is empty %s, mode: %s, alias: %s EDITOR editor: %s options: %s file: %s Triggers: (none) Triggers: "%s" Most recent trigger encountered: "%s" Packet log: %s Session log: %s Transaction log: %s (%s)ftpverbosebrief (separator='%c') Transaction log: (none) Connection log: %s Reliable: %s Clearchannel: %s Streaming: %s Streaming will be done if requested. Streaming will not be requested and will not be done. Streaming will be requested and will be done if the other Kermit agrees. Last transfer: %sstreaming%s, %ld cps. no , clearchannel --nointerrupts --bannerfile=%s (null) --cdfile:%s --cdmessage:%d --helpfile:%d --wtmplog:%d --wtmpfile=%s --anonymous:%d --privid:%d --permission:%04o --initfile:%s --userfile:%s --root:%s --xferlog=%d --xferfile=%s --timeout=%d --database=%d --dbfile=%s (db directory=[%s]) IKSD conf=%s CDPATH current directory: %s previous directory: %s cd path: %s cd message: %s server cd-message: %s cd message file: %s Nothing to show... Dŀ6(B0(B(BC(B׀[%3O(BP逅(B7KVcԀY(B(B(B(B3(Bƀ(B(B(B(B(B ! !###*(B(B ƀ$l'(B'( (0(9Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s Protection: %s %s = (null definition)invalid digit '%c' in number Invalid character '%c' in input ,',1,1,1,1,1,1,1,1,1,',1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,,1,,,,,1,,,,,1,,1,,1,1,1,1,1,1,1,1,1,1,1,1,,1,,1,,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,,1,-2-\-\-\-\-\-\-@-\-@-\-\-N-\-\-\-2?Divide by zero //ڀ/䀅/䀅/䀅//䀅/䀅/䀅/䀅/+-|<>#@extra characters after expression missing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript missing or not numeric ?Array dimension or subscript not positive or zero ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)Macros nested too deeply ?TAKE files and DO commands nested too deeply %0[%d] +M: "%s" \flit(Carriage return for home directory, or name of directory on this computerTLOGINPBUFSIZ=%dINBUFSIZE=%dOBUFSIZE=%dXFRCANPIPESENDCK_SPEEDCK_FASTCK_APCCK_AUTODLCK_MKDIRMINIDIALWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dCKMAXOPEN=%dZ_MAXCHAN=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dUIDBUFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMAXWLD=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXCK_TMPDIRPARSENSETIMEHCK_NEED_SIGCK_TTYFDTNCODEIKS_OPTIONIKSDBIKSDCONFCK_LOGINCONGSPDHDBUUCPNOSETBUFPATTERNSCKEXECNOKVERBSATTSVu3bu3b2__STDC____GNUC__CK_ANSICSIG_ICK_CURSESCK_NEWTERMCK_PCT_BARHWPARITYCK_TTGWSIZCK_NAWSDCMDBUFCK_RECALLCK_TIMERSTTSPDLISTCK_PERMSCKTUNINGSTREAMINGUNPREFIXZEROCKREGEXZXREWINDCKFLOAT=%sdoubleMajor optional features included: External XYZMODEM protocol support RESEND command Fullscreen file transfer display Control-character unprefixing Streaming Autodownload Major optional features not included: No debugging No built-in help No network support No Kerberos(TM) authentication No SRP(TM) (Secure Remote Password) protocol No Secure Sockets Layer (SSL) protocol No Transport Layer Security (TLS) protocol No encryption No X Windows forwarding Support for most modem types excluded No hardware flow control No character-set translation No REDIRECT or PIPE command No pseudoterminal control None att3bxc3Target: %s GCC version: %s 2.3.3Compiled %s %s, options: Jan 13 200021:25:22byte order: %s endianlittlebigsizeofs: int=%ldlong=%ldshort=%ldchar=%ldchar*=%ldfloat=%lddouble=%ld/after/ask/before/dotfiles/except/heading/l/larger-than/list/log/noask/nodotfiles/noheading/nol/nolist/nolog/not-after/not-before/not-since/quiet/simulate/since/smaller-than/verbose  #/ :AK R` :`/append/fromb64/swap-bytes/tob64 :` /as-name/binary/calibrate/command/delete/filenames/filter/image/move-to/pathnames/recover/recursive/rename-to/text : & /protocol : & cdctsdsrfilemodem-signalsricreationdeletionmodificationXaj=:=::=!read!writeappendhostlineportreadwrite !!=&&()<<===>>=||andasktimeoutabsolutealarmavailablebackgroundc-kermitcommandcountdefineddirectoryemulationequalerrorexistfailurefalseflagfloatforegroundiksdk-95lgtlltlocalmatchms-kermitnewernotnumericokopenorquietreadableremote-onlystarted-from-dialersuccesstapitruewildwriteablehj*m&p(r)t vy| ~'&#!",1  2  3 %- * . 20 8 >. H N R Z ] b' e+ k$ t     / % 6!read-file!write-fileappend-fileconnectioncx-logdebug-logpacket-logread-filescreensession-logtransaction-logwrite-file P  [  g  s" ~a '     cryptoencryptionk4k5kerberos4kerberos5krb4krb5ntlmsrpssltls t {            Variable name?Variable name required ?Read file not open ?Oops, no READ buffer! Prompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).?Timed out, assuming "No" Please respond Yes or No ?Timed out Please respond.by amount1?Variable %s not defined or not numeric Macro or variable name?Name too long: "%s" Text to be ignoredoperatorDefinition of variable?Argument vector array is read-only Definition of array elementDefinition of macro?%s failed ASSIGNDEFINEError - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK Opening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippedSorry, dialing is disabled. Please SET HOST first, and then SET MODEM TYPE Sorry, you must SET MODEM TYPE first Sorry, you must SET %s or SET HOST first LINE/dev/null Sorry, you must SET SPEED first timeout (seconds)0Number to dial or entry from dial directoryNumber to dial?Lookup what? %s ?No DIAL command given yet?You must specify a number to dial Lookup: "%s" - not found%s - dialing as given Lookup: fatal error - dialing skipped %s => %s ?Bad phone number WARNING - memory allocation failure: redial number Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... WARNING - No modem signals detected. Is your modem is turned on? If not, use Ctrl-C to interrupt dialing, turn on your modem, then %s.ANSWER againREDIALWARNING - SET FLOW RTS/CTS is in effect but modem's CTS signal is off. Disabling flow control temporarily %s... while waiting for callduring dialing Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number TESTING... Number: "%s" => "%s" Number: "%s" Will redial in %d second%s- press any key to redial immediately. Ctrl-C to cancel... %c?Not a regular file: "%s" ?Can't open file: "%s" %s: %d line%s s%s: %d match%s es/all/array/ascending/backup/brief/descending/directories/englishdate/files/isodate/message/nobackup/nomessage/nopage/norecursive/nosort/noxfermode/page/reverse/sort/xfermode X]d o"w~  !##/!   K R ` $datenamesizeDIRECTORY/DIRECTORIES/ALL/FILES/VERBOSE/BRIEF/PAGE/NOPAGE/ENGLISHDATE/ISODATE/DOTFILES/NODOTFILES/BACKUP/NOBACKUP/HEADING/NOHEADING/RECURSIVE/NORECURSIVE/XFERMODE/NOXFERMODE/NOSORT /SORT:NAME/SORT:SIZE/SORT:DATE/REVERSE/ASCENDING/NOMESSAGE/MESSAGE:{%s}(no options set)Switch?This switch does not take an argument ?This switch requires an argument Sort keyMessage to append to each line?This option can not be set LU_ir{Ѐ3=GR]ŀgr|File specification; or switchFile specification*File size in bytes?Array name required Array name (a single letter will do)?Bad array name - "%s" File-time?Date-time required Pattern?Pattern required ?Sorry, not implemented yet - "%s" does not match switch or name of accessible filenot found or not accessible"%s" - %s ?Array declaration failure ?Empty directory - "%s" ?%s %s match - "%s" NoToo manydirectoriesfiles* Warning: Failure to allocate memory for sorting. * Will proceed without sorting... Directory of %s Files: %d 0000-00-00 00:00:00xxx%2d-%s-%4d %02d:%02d:%02d%10s%-10s %s %s%-10s %s %s%10s%10ld %s %s%10ld %s %s (T) (B) %s?Memory allocation error - try /NOSORT %ld director%s, %ld file%s, %ld byte%syies (%0.2fGB) (%0.2fMB) s~Ā€NYdp~π݀2zꀅ->;''EEEÈ瀅Arguments for lsDirectory and/or file specificationCK_DIR%s %s?Sorry, not valid for guests ?Sorry, DISABLE ENABLE can not be undone Жђʀ؀怅``'5CQѼvm_ф {҉Ҽ뀅 DELETE/ASK/NOASK/LIST/NOLIST?Sorry, this option can not be set րЀʀտŀۀ怅File(s) to delete?Does not match switch or filename: "%s" ?Not implemented yet - "%s" ?Not a deletable file: %s ?A file specification is required ?Sorry, DELETE unavailable to guests Deleting %s...%s (SIMULATION) %s (SKIPPED) Delete %s? %s (SELECTED) %s (OK) %s (FAILED) %s (FAILED: directory) %s (FAILED: not regular file) %d file%s %sdeleted, %d byte%s %sfreed%s would be (maybe)?Can't delete: %s 뀅߀ӀRRRR;IV۝۝۝۝ۃېۗ瀅̀?ELSE doesn't follow IF command to be ignoredClosing parenthesis?Closing parenthesis required _switx series of cases{ %s }?Unbalanced braces _switx?SWITCH macro definition gone! _forx initial value%dfinal value-1incrementCommand to execute_forx?FOR macro definition gone! ?Incomplete FOR command Before requesting technical support from Columbia U., please consult: . The book "Using C-Kermit" (type HELP for more info). . The %sckermit2.txt and %sckcbwr.txt files. . The %sckubwr.txt and %sckuins.txt files. . Your own organization's support staff, if any. . The comp.protocols.kermit.misc newsgroup. . The Kermit support website, http://www.columbia.edu/kermit/support.html. . The Kermit FAQ, http://www.columbia.edu/kermit/faq.html. . The C-Kermit FAQ, http://www.columbia.edu/kermit/ckfaq.html. If you still need help or have a bug to report after consulting these sources, send e-mail to: kermit-support@columbia.edu Or contact us by post: Kermit, Columbia University, 612 W 115 Street, New York NY 10025, USA Or by fax at +1 (212) 663-8202. Telephone support is available too: +1 (900) 555-5595, USA only, $2.50 per minute +1 (212) 854-5126, from anywhere, $25.00 USD per call, MC/Visa Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. seconds to wait, or time of day hh:mm:ssseconds to pause, or time of day hh:mm:ssmilliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required eventFilename?Wildcards not valid here modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. ?File does not exit: %s ?Can't get modification time: %s Filename or switch ?Multiple files not allowed - please specify a single file. destination name and/or directory?Name for destination file required ?Sorry, /APPEND and /SWAP conflict ?Wildcards not allowed ?Sorry, changing existing files is disabled %s => %s ?Not a regular file - "%s" ?Not found or not accessible - "%s" ?Permission denied ?Source and destination are the same file ?Input/Output error ?Error opening output file - "%s" ?Can't copy %s to %s (OK) a?Phase error: %d ?Swap error ?Encoding error ?Decoding error ?WARNING: source file contains odd number of bytes %c%cs]New name?New name for file required ?Can't rename %s to %s & ++++++++++++ & ?Can't return from level %d _xif_for_swi_whi<<< %s: "%s" <<< %s: (null) mode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled System command to read from?Command name required ?Write to pipe disabled ?Write file already open System command to write toCan't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implemented ɀɀ E vvthis commandRECEIVEGETREGETRETRIEVECRECEIVECGETMGET?Sorry, %s works only with Kermit protocol Optional name/template to store incoming files under, or switchRemote filename, or switchOutput filename or CommandFile(s) to GETRemote filename?Sorry, system command access is disabled ?Sorry, no GET /COMMAND when RECEIVE FILTER selected Command, or switch?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending?Destination required?New name required?Sorry, as-name not allowed with MGET Name to store it underFilter program to receive through?Filter must contain a replacement variable for filename. onconvertedFile-transfer protocol?Sorry, this command works only with Kermit protocol ?Unexpected switch value - %d ?Unexpected function code: %d Local command to pipe intoName or directory for incoming file?A remote file specification is required ?Command required ?Sorry, no GET /COMMAND while RECEIVE FILTER selected ?A Kermit Server is unavailable to process this command Sorry, you must specify a name when receiving a file with XMODEM protocol ?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?Can't get current directory x.x?Can't create %s ?Can't access %s \=RRRRR=RR\\\RR逆ÀFꀆꀆ=FORWARD_FORWARDGOTO?Bad label syntax - '%s' ?Sorry, %s only works in a command file or macro :default?Label '%s' not found ?Stack problem in GOTO %s ]Number, numeric-valued variable, Boolean expression, or keywordDirectory nameFile?File or directory name required first word or variable name?Text required ?IF: strings too long second word or variable namefirst number or variable name?Quantity required versionargcsecond number or variable namevariable name or constantFirst fileSecond file?Failure to get file date file or logString or variable?String required File or directory nameWord?Boolean expression too longLLLLLLObject commandelse?XIF macro gone! { \flit(if ( not ) goto _..bot) } ?Internal error parsing WHILE condition _while?WHILE macro definition gone! ?Can't allocate storage for WHILE command?TAKE files and/or DO commands nested too deeply [%d] +F: "%s" /connect/serverrrrbinary-patternsbytesizecollisiondestinationdisplaydownload-directoryend-of-lineeolfastlookupsincompletenamesoutputpatternstext-patternstypewarningrXrh rq r{rrrrr' rrrrrrrabsolutenoneoffonrelativesssssautost ssssasciibinarytexttttzttttztblockingbufferednonblockingunbufferedttttglobalkermitsystemuseruGuKuSuGdynamicfixeduuechoeoffilllinefeedlocking-shiftpauseprompttimeoutv3v8v<vAvJvXv^veappendbackupdiscardno-supersedeoverwriterenameupdatevvvvvwwrecord-lengthrq rrwhrcrcrlflfw ww convertedliteralstandardwwwapcautodownloadcr-displaydebugescape-characterheightnewline-modeprinttriggerwidthx0x4rhxA xLv3xR xcvJxjxw4x}0rxrnormalwyDuncheckedssydaudibleysssrundefineduythermometerno-thermometerzzbriefcrtfullscreenquietserialz<zBzFssszQzWpacket-lengthzvecontrol-prefixdouble-characterend-of-packetfilterignore-charactermove-tonegotiation-string-max-lengthpad-characterpaddingpathnamesquoterename-tostart-of-packetvtzz5{{Z{%X{6u{>`z{\{j{rGvX{|{v{verattributesblock-checkfilereceiveretryservertransferwindowxfer|x"||r | ||#|%|$|% alldatedispositionencodinglengthprotectionpermissionssystem-id}<}@}E }Q }Zss}a}l}xr buffer-lengthcancellationcasedefault-timeoutsilencetimeout-actionx4~ ~ ~'~,v3~<~Dproceedquit~~ignoreobserve~~disabledenabledsst ss ?Value required %s?Not a number: %s ?Sorry, %d is the maximum Control character, numeric ASCII value, or in ^X notation, or preceded by a backslash and entered literally ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d /case/key/numeric/range/reverseArray name or switchArray name?This switch does not take arguments Column for comparison (1-based)1low:high element?Not numeric: %s ?Unexpected function code: %d ?Array name required Second array to sort according to %s?Bad array name: %s ?Array not declared: %s ?range %d:%d exceeds array dimension %d ?Bad range: %d:%d ?Array %s smaller than %s _π_m_a`,a/after/ask/before/delete/dotfiles/except/heading/keep/larger-than/list/log/noask/nodelete/nodotfiles/noheading/nol/nolist/nolog/nopage/not-after/not-before/not-since/page/quiet/recursive/since/simulate/smaller-than/verbose|      , 7=DO V` nPURGE/ASK/NOASK/DOTFILES/NODOTFILES%s:%d/KEEP/LIST/NOLIST/HEADING/NOHEADING/PAGE/NOPAGE(no options set)Switch?This switch does not take an argument ?This switch requires an argument How many backup files to keep?Please specify a number between 0 and %d ?This option can not be set ijj!j(jUjUjjjj;jBjUjUjUjUjUjUjUjUjHjOj.j5Filename or switchFile-time?Date-time required File size in bytes0Pattern?Pattern required ?Not implemented yet - "%s" %s.~[1-9]*~*.~[1-9]*~?File deletion by guests not permitted. Purging %s, keeping %d...%s (SIMULATION) %s (SKIPPED) Delete %s? %s (%s) OKSELECTED %s (FAILED) Matches = %d: Not enough to purge. DELETEDERROR %s (KEPT) %s.~*~ (KEPT) Files purged: %d%s (not really)mnnnnnnpـpـnƀnЀo€o€nـnـnـnـpPpπp5pCpǀoToonofile transfer display styleRemote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 local text-file line terminatorhow to handle filenames301file record length312type of file transfer300Filename collision action?This command not valid for guests 3023102Name of local directory, or carriage return?Wildcards not allowed in directory name output file writing methodoutput buffer size32768?Bad size - %d MEMORY ALLOCATION ERROR - FATAL ?unexpected file parameter 倆 Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. ?Sorry, command disabled. bytesize for terminal connectionwhich side echos during CONNECTremoteapplication program command executionnumber of columns on your screen8024number of rows on your screenString to trigger automatic return to command modedv 逆CWhether Kermit should ring the terminal bell (beep)Confirm with carriage returnParameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character 13Sorry, the legal values are 0-31 Maximum number of characters in a packet90?Sorry, this command does not apply to %s protocol. Use SET SEND PACKET-LENGTH for XYZMODEM Sorry, 10 is the minimum 401 Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Adjusting packet size to %d for %d window slots Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start characterHow many padding characters for inbound packetsPacket timeout interval402?Out of range - %d Minimum timeout to allowMaximum timeout to allowMilliseconds to pause between packets?Internal error - malloc failure Character to doubleCharacter to ignorenonnon?Please specify a number or the word NONE ?Please enter a character code in range 0-255 Filter program for sending files - use \v(filename) to substitute filenameFilter program for receiving files - use \v(filename) to substitute filename?Filter must contain a replacement variable for filename. Max length for protocol init string-1?Please use SET FILE COLLISION to choose the desired action Directory to move file(s) to after successful transferTemplate to rename file(s) to after successful transfervg>`(;ဆ;Characters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill characterNumeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmissionSeconds to wait for each character to echoA/рL Type your escape character, %s, followed by X or E to cancel. > filename, | command, or type carriage return to confirm the command?"%s" has no effect in remote mode ?Not confirmed ?%s missing FilenameCommand?Access denied - %s ?Sorry, access to external commands is disabled. Hint: try again with an output redirector. ?No connection User ID?Internal error: malloc PasswordAccountUsername: ?Canceled Password: ?Parameter name required Remote directory nameName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specificationCommand for remote systemCommand for remote Kermit?Remote Kermit command required ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage returnRemote function invocationRemote variable name or functionQRemote variable nameAssignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to renameNew name of remote fileName of remote directory to createName of remote directory to delete?Name required ?Not implemented - %s π]瀆Tb~~~H~7~a耆/D}}??File specification required File Attribute packetsSorry, command not available 132143142141135133139134145147?Not available e9kkkkπkđ'ííƣk ePositive numberSeconds of inactivity before INPUT failsNumber of bytes in INPUT bufferEԀcuɿހ Closing connection on_closeMaking connections is disabled?Sorry, making connections is disabled Network connections not supported?%s Device name, or switchInternal error?Internal parsing error Timed out - no carrier?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Access to lock deniedSorry, write access to UUCP lockfile directory denied. ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Access to device deniedSorry, access to device denied: %s Device is in use or unavailableSorry, device is in use: %s Device open failedSorry, can't open connection: %sSorry, can't open connection: %s on_open; C-Kermit SAVE KEYMAP file: ; Clear previous keyboard mappings set key clearset key \%d \{%d}%cset key \%d \{%d}; EndName of Kermit command filekeymap.ksc?Sorry, %s is a directory name DispositionnewNot implemented - %s rYour username, or "ftp", or "anonymous" Login cancelled anonymousftpEnter e-mail address as Password: Enter %s's Password: Enter Password: Login cancelled  && ޝާ€ް€޼Error number out of rangeModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s Clear To Send (CTS): %s Ring Indicator (RI): %s Data Terminal Ready (DTR): %s Request To Send (RTS): %s Fatal:setgen: can't allocate memoryCK_NOPUSHHOSTmore? ?IKS idle timeout - Goodbye. Y or space-bar for yes, N for no _apc_commands^C...^C... suspend disabled %sJob control not supported ?T-Log string too long%s %ld %s %ld?String too long[%s][%s] %ld%s: %ld%s %s%s %s: %ld?Invalid format for tlog() - %ld:󭀆V΀뀆I00000000SENDRECV"%ldFAILEDOK%s"%ldsec %ldcps"%s"%s"Status report: file type: labeledimagebinary undefinedbinarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length window slotsCanceling batch, wait... Canceling batch... Canceling file, wait... Canceling file... Resending packet... rqԀ333ԀqrqԀ3rԀqrqԀ3rԀqрs@Type escape character (%s) followed by:X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Ctrl-C to cancel file transfer: Transfer interruption disabled. Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: File Percent Packet Bytes Done CPS LengthҀ%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld %s %s (%s) (%ld byte%s)s: OK (%d sec, %ld cps) [OK]: DISCARDED [discarded]: INTERRUPTED [interrupted]: SKIPPED [skipped]: ERROR: %s Error: Message: : REFUSED Refused: : INCOMPLETE [incomplete]*** screen() called with bad status ***%c SUMMARY: %ld file%s, %ld byte%s, %ld sec, %ld cps. ERROR: %s WARNING: %s *** screen() called with bad object ***р H 뀇 !m퀇;ҀW L 耇 I  RProtocol Error:Transaction Log ClosedClosing %s...OK on_closeon_exit8ASeERROR WRITING SESSION LOG, LOG CLOSED!TERMWarning: terminal type unknown: "%s" SCREEN command will use ANSI sequences. Fullscreen file transfer display disabled. clcecm[%d;%dH%-3ld(unknown)LABELEDIMAGEBINARY UNDEFINEDBINARY / partial / resendTEXTygwFullscreen display not supported for terminal type: %s %s, %sCurrent Directory: %sNetwork Host: %sCommunication Device: %sNetwork Type: Communication Speed: (network)75/1200unknownParity: %sRTT/Timeout:File Type:File Size:%s:Percent DoneBytes so far ...10...20...30...40...50...60...70...80...90..100Estimated Time Left:Transfer Rate, CPS:Window Slots:%s N/APacket Type:Packet Count:Packet Length:Error Count:Last Error:Last Message:(Transfer interruption is disabled)<%s>X to cancel file, <%s>Z to cancel group, <%s> to resend last packet<%s>E to send Error packet, ^C to quit immediately, <%s>L to refresh screen.RESENDING:SENDING:RECEIVING:File Name:%.55s.. => %s => %.51s..Percent Done:Network Host: %s (%s)Communication Device: %s (remote host is %s)00 / 00%02ld / %02d%dSTREAMING%d of %dDamaged PacketUser interruption or connection lostTimeout %d secTransfer OKFile discardedTransfer interruptedFile skippedRefused, %sRefusedIncompleteSUCCESS. Files: %ld, Bytes: %ld, %ld CPS Elapsed Time: %sFAILURE: %s*** screen() called with bad function code ***' ()o7258*57Q87777880 222222222222222222222222222222.̀0ǀ222222222220ۀ2.1o22222.̀22222222222222222222221+2 373y334N4ɀ5   0ASdhlp  r+/var/log//iksd.db%s%s%s0000INIT7F000001%08lx:%010ld %s%08lx.%lx%s%siksd.lckr%s [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory If no action command is included, or -S is, enter interactive dialog. Type HELP OPTIONS at the prompt for further info. :ƒȀ OˀCNĖĸ'aş݀f"%s" - %sUsage: +--invalid command-line option, type "%s -h" for helplocal action=%c No actions or connections allowed with -A-l or -j or -X required-a without -s, -r, or -gcan't change to '-a' directorywrite access to -a file deniedunredirected -k can only be used in local modeanonymousbannerfilecdfilecdmessagecdmsgdatabasedbfilehelpinitfilenointerruptsprividrootuserfilewtmpfilewtmplogxferfilexferlog($/6@ F(O(V[(d q(x (} (Ȇ (ȏ(ȗ(Ƞ(0123456789falsenooffokontrueyesɄɆɈɊɌɎɐɒɔɖ ɘɞɡɥɨɫɰNQHPPP|RRRRQ PĀOODPRRO耇NN8Q|QRQÀNExtended option errorNo commands given for -Cinvalid argument bundlingmissing delay valuebad delay valueconflicting actionsinvalid argument bundling after -s-.No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missing/dev/ttycan't open deviceon_openmissing bpsunsupported transmission rateinvalid argument bundling after -mmodem type missingunknown modem typeinvalid argument bundling after -emissing lengthUnsupported packet lengthmissing or bad window sizemissing parityinvalid paritymissing usernameinvalid command-line option, type "kermit -h" for helpSdjRˀdjdjadjdjdjdjdjdjT〇b-djdjdjdjdjdjdjdjT逇cSSƀTdjYd`[`djdjccǀdjU dPTUTTǀdjbNdjdjZԀdjdjdjdjdjdjdjZ4]Y뀇dj_€UbYZadjV[^YdjbcaUVJcbdj`ÀaˀU Z ccc3c3c3c3c3c3c3cc*cc3c3c3cUser Interface 7.0.222, 1 Jan 2000binary-patternssend-listtext-patternshxЂА/off/on/redirect /binary/command/nowait/pipe/text/transparentT\emsyА !#.:@aboutaddanswerapcarrayasciiasgaskaskqassassertassignassociatebackbeepbinarybugbrowsebyeccatcdcgetcheckckermitclearcloseclscommentconnectcocopcopycopyrightcpcqcreceivecsendcwddatedcldeclaredecrementdefinedeletedialdirectorydisabledoee-packetechoediteightbitelseenableendevaluateexexecexitextended-optionsffailfifinishfoforforwardfotftpfunctionggegetgetcgetokgotohhanguphelpiifiksdinincrementinputintrointroductionkermitllineoutlolocallogloginlogoutlookuplsmailmanualmdminputmgetmkdirmmovemoremovempausemputmsmsendmsleepmvnewsnolocalnopushoopenoutputpausepdialpopprintpsendptypupurgepushputpwdqqueryquitrrasgrassignrcdrcopyrcwdrdeleterdirectoryreadreceiveredrediredialredoregetreinputremremoremoteremoverenamereplayresreseresendresetretretrievereturnrexitrhelprhostrkermitrloginrmrmdirrmkdirrobustrpwdrqueryrrrrenamerrmdirrsetrspacertyperunrwhossavescscrscreenscriptsendserversetshshiftshowsleepsortspspaspacespawnstastatstatisticsstatusstopsucceedsupportsuspendswitchtaketapiteltelnetteloptterminaltexttracetranslatetransmittypeundefineversionwaitwermitwherewhilewhowrwriwritwritewrite-linewritelnxechoxifxlatexmitz^_asg_assign_decrement_define_evaluate_forward_getargs_increment_putargs$&*(*.,.?4|8q?_CIsO7S5W6\7`g7nx}kӂtӉQӍӔӘӚ&ӞӡӦ\Ӭ~ӴӺB*G G;%,(1; C2F HOQ V[d<i@p0th} Ԁԅ Ԋԛ ԝԢ ԥ ԬHԯHԳiԻԿ   gV/+-9 #~*,47}=AGNoUX]dvgdnsvymՄlՉ]ՐPՕP՘P՞]եըխյ{ռվDr0f3  &+3>ECKSOSTS[`nf8nrw~օ֌&֓e֗e֜e֣֩Cֶ֭Cֽw %).05)8)<C)JOVZ ]c hns!v!z!׀׆"׊"׏"ךס1צ׮Q׶N׾$s%& z?>#~*0I6':A=AAAFALaWa_eJio%tNvxX}X؅ؐYؘآثTشؿUА!#.;:@^{nookyeskeymapАalarmask-timerattributesbbabackgroundbatchbaudbellblock-checkbufferscarrier-watchcaseclclecleaclear-channelclearchannelclose-on-disconnectcmdcommandconconsolecontrol-charactercountddedebugdefaultdelaydestinationdidiadisconnectduplexeditorescape-characterf-ack-bugf-ack-pathfileflflagflow-controlhandshakehintsincompletekeylinelocal-echomacromodemoptionsparityportprprinterprefixingpromptprotocolq8flagqnx-port-lockquietrecrecvreliablerepeatretry-limitserserialsession-logspeedstartup-filestop-bitsstreamingtemp-directorytransaction-logtransferwildcard-expansionwindow-sizexferK"r,"7393<3G3MRIWc2k.y7Ӟk~dddӴdddo666'4T00,0o 'Y.txԅE?sIyTY \^a fn xw  ~  **@AN+DphFML?q{? C  aCAJ"#&nO#-1hh9?OLmVb׶<(CCj`P!oc%/h;$%o/Аlcleolmove-toӴashostOgӞ%1ԅ#*4=AGs օ Vz6connectionscxpacketssessiontransactionsT`cksАappend-filedebug-logerrorpacket-logsys$outputttrtratrantranstransatransactransacttransactitransactiotransactionT<- !*4?osbothdevicedevice-and-inputdevice-bufferdial-statusinput-buffer?hLQXiw x@<ЂА !read!writeconnectioncx-logread-filewrite-file06='H'''O- !*4?osYАargargumentsargsarrayscharacter-setscomcommcommunicationscontrol-prefixingdouble/ignoreescapefeaturesfunctionsglobalsignore/doubleklogsmacrosnetworkparameterspatternsscriptsstacktriggervariablesversions',Ӟ<""=>`>,*'+ԅ Ԋ;Ta@#* 21348??5GR6![ x(O cך V711:    A i3q{Ao АBLw7allOgӔӞ% 1iԅԥXsօ֭JV z  6 /after/array/as-name/b/before/c/calibrate/delete/dotfiles/except/filter/filenames/image/larger-than/listfile/mail/move-to/nobackup/nodotfiles/not-after/not-before/pathnames/print/protocol/quiet/recover/recursive/rename-to/since/smaller-than/starting-at/su/sub/subject/subdirectories#*36T> A \ LT^fny   * 7 ; @I s &/list6TL^ny(   * @s /quietly/triggerT]/brief/verbose/count/head/match/more/nopage/page/prefix/tail/widthА assignmentscommand-level| TYPE /PAGE/NOPAGE(no options set)/WIDTH:%dSwitch?This switch does not take an argument Column at which to truncate?Sorry, this option can not be set _array_x_Filename, or switchFile(s) to sendCommand?This switch does not take arguments ?This switch requires an argument ?Sorry, system command access is disabled ?Sorry, no SEND /COMMAND or CSEND when SEND FILTER selected Command, or switchPattern?Pattern required ?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending%s ?Destination required?New name requiredSize in bytes0File date-time?Date-time required ?Sorry, sending files as mail is disabled e-mail address?address required ?Sorry, sending files for printing is disabled Print optionsName to send under?name required 0-based positionFile-transfer protocol?name of protocol required Filter program to send through?Filter must contain a replacement variable for filename. absoluteconvertednumber of Kbytes to send1024Name of file containing list of filenames?Filename required ?Wildcards not allowed Array name (a single letter will do)?Bad array: %s ?No such array: %s ?Unexpected switch value - %d ?Sorry, %s works only with Kermit protocol CSENDSEND /COMMAND?Sorry, no /RECOVER or /START if SEND FILTER selected ?%s - "%s" No files matchFile not found?Unexpected function code: %d ?Sorry, a command to send from is required ?Sorry, /DELETE conflicts with /MOVE or /RENAME ?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?/RENAME for file group must contain variables such as \v(filename) ?Sorry, /BINARY required ?Sorry, wildcards not permitted with /START ?Sorry, this command needs 32-bit integers ?Sorry, SEND /START works only with Kermit protocol Sorry, /RECOVER is possible only with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON Sorry, you can only send one file at a time with XMODEM protocol Names of files to send, separated by spaces?MSEND list too long e-mail address (optional)e-mail address (required)printer options (optional) Optional as-name template containing replacement variables like \v(filename)Optional name to send it withSorry, /MAIL and /PRINT are conflicting options Sorry, %s available only with Kermit protocol /MAIL/PRINT?E-mail address required ?%s too long E-mail addressPrint option stringCALIBRATION?Failure to open %s ?Filename required but not given ?Read access denied - "%s" ?Invalid switch combination ?As-name for file group must contain variables such as \v(filename) ?/STARTING-AT may not be used with multiple files. ?Bad array range - [%d:%d] ?A Kermit Server is unavailable to process this command. ?Start a RECEIVE command to complement this command. ?File deletion not allowed for guests. jj~j耇mommpj~jHmsGjiՀjtsrjjmmt$u΀vIl)l)vwj~jjxd?No switches match - "%s" String (enclose in braces if it contains spaces)?String required ?Too many patterns - %d is the maximum ?Sorry, REMOVE SEND-LIST not implemented yet. ?Sorry, ADD SEND-LIST does not work with external protocols File specification to add?A file specification is required WARNING - \v(filespec) buffer overflow type of file transfer As-name template containing replacement variables such as \v(filename)Name to send it withSorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list nodedestroyresizeӴ  VcnА Array name?Array name required ?Segment notation not allowed in array declarations ?Memory allocation error Initial value for \&%c[%d]=Carriage return to confirm?Declare failed &%c[%d]Array initialization error: %s %s New size?New size required ?Bad array reference - "%s" ?Array not declared - "%s" ?Array segments not allowed for this operation ?Sorry, \&@[] is read-only Name of source arrayName of destination array?Partial arrays can not be destroyed ?Failed - destroy "\&%c[]" Value?Array %s is not declared Sorry, BYE only works with Kermit protocol ?A Kermit Server is unavailable to process this command %citem to clearText of comment line?Sorry, COPY is disabled ?Sorry, changing directories is disabled "CONNECTION", or log or file to close?You must say which file or log ?Connection was not open Variable name?Variable name required Integer arithmetic expression?Sorry, DEFINE/ASSIGN disabled ?Sorry, DELETE is disabled ?Sorry, DIRECTORY is disabled Server function to enableServer function to disable?Name of server function required mode?Please specify remote, local, or both optional return value ?No macros defined Macro?Macro name required optional argumentsbraced list of commands?Not a command or macro name: "%s" ?Not a command or macro name. ..tmp:%03dText to be echoedApplication Program Command text%s%c_%s%c\Text to be output?Sorry, printing is disabled File to printLocal print command options, or carriage returnexit status codeOptional EXIT messageSorry, E-PACKET only works with Kermit protocol Sorry, FINISH only works with Kermit protocol ?Sorry, reception of files is disabled label?Label name required Seconds to wait for input, or time of day hh:mm:ss?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. List of input strings?Memory allocation failure Material to be input?INPUT timed out ?MINPUT timed out ?REINPUT failed What to log?Type of log required ?Already logged in ?No connection. expect-send expect-send ...?Sorry, CRECEIVE works only with Kermit protocol Sorry, REMOTE commands only work with Kermit protocol Remote Kermit server command?You must specify a command for the remote server ?Sorry, renaming of files is disabled ?Sorry, sending files is disabled Add to which list?Remove from which list?File to partially send?Sorry, wildcards not permitted in this command starting position (byte number)?Sorry, no PSEND while SEND FILTER selected Sorry, PSEND works only with Kermit protocol Sorry, SERVER only works with Kermit protocol option?You must specify an option to save ?More fields required Parameter?You must specify a parameter to set ?Sorry, host command access is disabled Command to overlay C-Kermit or switchCommand to overlay C-Kermit?Command required ArgumentSystem command to execute?Sorry, SPACE command disabled Confirm for current disk, or specify a disk device or directory%s %sCarriage return, or optionMessage to print_xif_for_whi_swi%d?Sorry, IKSD can not be suspended ?Sorry, access to system is disabled ?Take files nested too deeply \v(home)C-Kermit command file?A file name is required ?Wildcards not allowed in command file name ?Can't execute a directory - "%s" Optional arguments%0File to transmit?Only a single file may be transmitted ?Sorry, TYPE command disabled Filename or switchNumber of lines10patternprefix for each line?Too long - 63 max Filename?Name of an existing file required ?A single file please %s, for%s Numeric: %ld THIS IS A TEST VERSION, NOT FOR PRODUCTION USE. Patches: %s ?Sorry, WHO command disabled user nameCK_WHOto file or log?Write to what? %s%s?Write error ?File or log not open ?Sorry, directory creation is disabled Name for new directory?Directory name required ?Sorry, directory removal is disabled Name of directory to be removedkermit command-line arguments, -h for helpkermit date and/or time, or carriage return for currentEDITOR?Editor not defined - use SET EDITOR to define File to editCan't create "%s" ?Sorry, editing not allowed File most recently... Sent: %s (none) Stored as: %s Received: %s If the full path is not shown, then the file is probably in your current directory or your download directory (if any - SHOW FILE to find out). pattern, or first few characters of a previous command*?Sorry, command recall can't be used now. %s%c?Sorry - "%s" not found %s SUCCESSFAILURENumber of arguments to shift1fastcautiousscreen actionRow (1-based)Column (1-based)?Row and Column must be 1 or greater Array operation?Sorry, not implemented yet - "%s" Trace object; Or switchTrace objectTRACE %s ONOFFRest of commandSorry, "%s" not configured in this version of Kermit. [ÀÀdÀ,Sd[銀闀X鰀ĀĀ鼀 --홀!r#1?[ՀM[ р ܀   Ā CONNECT Command for UNIX:fork(), 7.0.104, 14 Nov 1999  ɀ ހ j Ā+ERROR: Failure to kill pid %d: %s, errno=%d (Back at %s) local UNIX system 26܀Rn?setuid error - fatal Communications disconnect Connection closed due to telnet policy Connection closed by peer Remote Logout set proto %s, %s, set proto %sserverreceiveWARNING: Old CONNECT fork seems to be active. Attempting to remove it... Sorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated Sorry, can't open %sConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. . ESCAPE CHARACTER IS DISABLED (Session logged to %s, %s) binarytextDebugging Display...) ---------------------------------------------------- Sorry, can't condition console terminal Sorry, can't reopen %sSorry, Can't condition communication line ?Carrier required but not detected. *********************************** Hint: To CONNECT to a serial device that is not presenting the Carrier Detect signal, first tell C-Kermit to: SET CARRIER-WATCH OFF *********************************** Can't make pipeCan't make port fork Communications disconnect (Back at %s) Can't send characterWARNING: Failure to kill fork, pid %d: %s, errno=%d (Back at %s) ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK U to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. 'F']'y'''Ӏ'((!(2(H(k(((ـ))U ---------------------------------------------------- Press C to return to the C-Kermit prompt, or:Command>---------------------------------------------------- Hanging up %s: %sHostDeviceSpeed %ld Terminal echo: %slocalremote Terminal bytesize: %d Command bytesize: %d Parity: %s Autodownload: %sonoff Session log: %s(none) Elapsed time: %sError resuming CONNECT session -V-;0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0G0̀0̀0̀0̀0̀0ǀ0l0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀00̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀00l0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀0̀-V-;0̀0̀0̀0̀00̀0̀0̀-c0̀0̀0̀0̀-0̀-0̀-p0̀0̀0̀0̀0GDial Command, 7.0.131, 22 Dec 1999- 1313233352353354358394445464749/\/^/a/d/g/k/o/s/w/z/}///Any CCITT / ITU-T V.25bis conformant modem,:VALCRN%s CIC DIC /0 0 (0 0 Ȁ00 0 00 0 0 0 0 0 0 0 000 0 0 0 0 0 0 0 0 Hayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 00ހ0#0000 0 0L+00 0 0 0 0 0 0 11 0 0 1111%1+110 `jLUnknown%s 1̀0 0 0 0 0 0 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 (dummy)2l0 0 0 0 0 0 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Any ITU-T V.25ter/V.250 conformant modemATQ0X4 AT+IFC=2,2 AT+IFC=1,1 AT+IFC=0,0 AT+ES=3,0,2;+EB=1,0,30 AT+ES=0 AT+DS=3,0 AT+DS=0,0 30ހ0#03100 0 0L+0393E3Q3]3u3~311 0 0 1111%1+110 }jLGeneric high-speed AT command setAT&F ATQ0H 4(0ހ0#04J00 0 0L+4P0 0 0 0 0 0 0 11 0 0 1111%1+110 =jL0$181؀2t4X3ccitt-v25bisdirectgeneric-high-speedhhahayhayehayeshayes-2400itu-t-v250itu-t-v25ter/v250itu-t-v25bisnoneunknownuser-defined5555/5154585=5C5N5Y5k5x5}50 +%s(%s) %s %s T=DIAL H=%s D=%s N=%s O=%s LOGDIAL BUFFER OVERFLOW%s WARNING - speed change to %ld failed. Speed changed to %ld. PT@W;7Z7u7~777À7K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_DIAL_METHODK_TF_AREACODE011800888877866199610119990000K_AREACODEK_PBX_OCPK_PBX_ICPK_PBX_XCH%s Failure: DIALANSWER%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. Interrupted. "%c" Call not completed. Call did not come in. Error initializing modem. unknown ?@6@~A/ DIAL command + phone number too long! atd%c%sSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... No response from modem, retrying%s... again No response from modem, retrying%s... WARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - Trouble enabling compression ATM1L%d%cATM0%cWARNING - I don't know how to enable autoanswer for this modem. ATS2=%dS7=%d ATS7=%d%c Dialing: %s... CNXINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callPROGRAM ERROR - No response handler for modem type %d WARNING: Carrier seems to have dropped... %sall complete: %s. Partial cC %sall complete: "%s". %sall complete. OfOfOOSorry, DIAL memory buffer can't be allocated Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. %sSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... Ret Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) ************************* HINT: interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. (Use SET HINTS OFF to suppress future hints.) ************************* %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). OK OK ERROR ERROR at at AT AT Local phone is ringing! No Carrier. Modem Command Error. No Dialtone. Busy. No Answer. RELIABLE LAPM COMPRESSEDllÀlрlm+mXmpmm€m뀈mCONNECT Can't change speed to %ld Speed changed to %ld RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXWAIT - CONNECTINGWAIT-CONNECTINGDELAYEDBLACKLISTEDCOMPRESSIONPROTOCOLDIAL LOCKEDRINGRING1RING2RING3ERRORCARRIERDATADIGITAL LINEDATETIMENAMENMBRMESG Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup errorScript Command, 7.0.030, 21 Oct 1998Dpz&{;{;{;{;z{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;{;yဈzkzy{;{;{;{;{;{;{;{;{;y{;{;yyz=yʀ{;{;zzTexpecting sequencegot it (null sequence)received sequence: returning with got-it codesending sequence EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. SCRIPT string: Sorry, Can't condition communication line Script successful. Script successful.Sorry, script failed Script failedNetwork support, 7.0.194, 30 Dec 1999KTelnet support, 7.0.191, 30 Dec 1999KEOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBWILLWONTDODONTIACLL L%L+L/L2L6L Negotiations.. ?Telnet Protocol Timeout - connection closed ?Connection closed by peer. ?Telnet Option negotiation error. ?Connection closed by peer. (OK) hր$Abրbtn_push called but not implemented - data lost. TELNET negotiation loop %s %sSAKTELNET SENT %s %sTELNET SENT SB %s FOLLOWS IAC SETELNET SENT SB %s SEND IAC SETELNET SENT SB %s IS %s IAC SETELNET SENT SB %s %sINFOSEND%02x USERVAR VAR VALUE ESC IAC %c IAC SETELNET SENT SB %s %02x IAC SE׀  iks_wait() me_iks_req_startiks_wait() me_iks_req_stopπ߀k/`pre-encryptend of telnet negotiationsJJPJPPPPPPPPPPPPPPPPPPPJJPPPPPPJPPPJPJJJPPPPPPJJTELNET SENT SB KERMIT SOP %02X IAC SESTOPREQ-STARTREQ-STOPRESP-STARTRESP-STOPTELNET SENT SB kermit %s IAC SE2222'TELNET Subnegotiation error - used DONT instead of SE!TELNET Subnegotiation prematurely brokenSCREENOFFFB64_IVFB64_IV_OKFB64_IV_BADFB64_CHALLENGEFB64_RESPONSENTLM_AUTHAUTHNTLM_CHALLENGEREJECTNTLM_RESPONSEACCEPTNTLM_ACCEPTCHALLENGERESPONSENTLM_REJECTFORWARDFORWARD_ACCEPTFORWARD_REJECTEXPPARAMSOPENON%s %s FOLLOWSCLOSERESTART-ANYDATARESTART-XONSOPTELNET RCVD SB %s %s %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %s%02X " %s%c" IAC DONT0֛#zۥۼӀꀈĀπڀ倈Խ怈H՜倈A]yuՀՖՖuՖՋՖՖՖՖՖՖՖjɀԀ߀߀ɀ߀߀߀߀߀߀߀߀߀վЀ߀߀߀ׂ߀߀߀߀߀߀߀Ԁ߀߀#PچA2À쀈>هЀ,Hdkvففkففففففففف`ٴٿʀʀٴʀʀʀʀʀʀʀʀʀ٩Ѐ߀ Httt^ittttttttSt=TELNET RCVD UNKNOWN (%d)TELNET RCVD %s[Yes] TELNET RCVD %s %sLINES=%dCOLUMNS=%dPeer refuses TELNET DO %s negotiations - terminating connection%s Peer refuses TELNET WILL %s negotiations - terminating connectionTELNET DO %s (implied by receipt of SB - protocol error ignored)TELNET WILL %s (implied by receipt of SB - protocol error ignored)TERMTERM=%s>@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@<:86420.,*q 񡀉TELNET SENT SB NAWS %d %d IAC SEUnicode support 7.0.106, 10 Nov 1999vHNo PTY supportvtvSVR32Kn,X `%K @w򨀔Ѐ#$" !+,&unknownTERMTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/.LINESCOLUMNS !"#$       n ijk    l+,opmq/.r0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab&5   %)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}y+#-( !"#$%&'(,$- z؀zـz{*{C{[{{/usr/lib/terminfo is unaccessibleI don't know anything about your "%s" terminalcorrupted terminfo entryterminfo entry too longTERMINFO pathname for device exceeds 512 charactersmalloc returned NULLterminfo file for "%s" terminal is not readableSorry, . Àƀɀ̀πҀՀ؀ۀހဓ䀓瀓ꀓ퀓󀓂  #&),/258;>ADGJMPSVY\_behknqtwz}€ŀȀˀ΀рԀ׀ڀ݀〓怓逓쀓򀓃 "%(+.147:=@CFILORUX[^adgjmpsvy|Āǀʀ̀ЀӀրـ܀߀–倓耓뀓񀓄􀓄 !$'*-0369ADGJMPSVY\_behknqtwz}€ŀȀˀ΀рԀ׀ڀ݀〓怓逓쀓򀓆 "%(+.147:=@CFILORUX[^adgjmpsbwamxbxsxneognhckmhsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGcoitlilmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@7@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%d%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyTe\~\~Te\~\~\~\~\~\~\~Te\~TeTe\~TeTeTeTeTeTeTeTeTeTeU€U߀UVV/VGV_VwVT@[l\T@\\NYWǀ\\XX&\XmT@XT@T@T@T@T@T@T@T@T@T@T@\ZɀZdZ\\Z\\\\\\\\\\\\\[@V\\\\\\\T@\\\\\Z\\\\TT@[ۀ\WB\U~\\U@YF\T@U\\T@[\\\T@\\WYր\[5MS7) `*a:f'g#o-q-s_x|~o,<+>.v-^h#i#0#4   liorkp:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /dev/ttyDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shPATH:/bin:/usr/binshpwd 2>/dev/nullr/etc/utmp/etc/passwdrr؀耓 $6HXk}€΀ڀ쀓 +?Sds̀؀.Jcrр'09Qh|ŀڀ〓쀓 8Vl}̀܀倓 &/8SpӀ󀓡1XError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageError 78Error 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directly/bin/shsh-c+'''+0+5GGG..򆀉򎀉h򖀉UUU斀斀@@UUU..򆀉򎀉.lAGC0..򆀉򎀉选ր܀W`/Lw/K:/JMFw/GMT TZ/etc/utmp/dev/ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASSascii/lib/chrclass/@:'i _;U?3RE)?9p8)5D}[ % /-I /w5b6,6)d>a<M*N5[!kj@g#*)3)5T?=D=)3+DZ^?* n#%9XVY'A H0n:?vr'"Q"`(d+42M;C~:<q(Ff"7&>nG 978 5q5& 1Z$.H+tj']!6$J !w5%_^LKzaN } dP@ff&f&hQ!G+ A D )K m5\W?Y U?}F^ z!%ph]( Z(J9H/9!Y,䀕$@(#)/lib/crt1.o.sl 1.3 4.1 04/24/86 61859 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/termio.h.sl 1.2 4.1 09/02/86 34662 AT&T-SF@(#)/usr/include/sys/termio.h.sl 1.2 3.1 04/16/86 26218 AT&T-SF@(#)/usr/include/sys/ioctl.h.sl 1.1 3.0 09/25/85 47484 @(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/pwd.h.sl 1.2 4.1 09/02/86 48003 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/utmp.h.sl 1.2 4.1 09/02/86 55530 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/utsname.h.sl 1.1 3.0 09/25/85 37228 @(#)/usr/include/curses.h.sl 1.20 3.2 09/29/87 16990 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/termio.h.sl 1.2 4.1 09/02/86 34662 AT&T-SF@(#)/usr/include/sys/termio.h.sl 1.2 3.1 04/16/86 26218 AT&T-SF@(#)/usr/include/unctrl.h.sl 1.9 3.1 09/04/86 26397 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/lib/libcurses.a/_newterm.o.sl 1.6 3.2 01/06/88 17650 AT&T-SF@(#)/usr/lib/libcurses.a/_wclear.o.sl 1.6 3.2 01/06/88 29678 AT&T-SF@(#)/usr/lib/libcurses.a/_werase.o.sl 1.6 3.2 01/06/88 50541 AT&T-SF@(#)/usr/lib/libcurses.a/curses.o.sl 1.18 3.2 01/06/88 38340 AT&T-SF@(#)/usr/lib/libcurses.a/endwin.o.sl 1.20 3.2 01/06/88 59346 AT&T-SF@(#)/usr/lib/libcurses.a/mvcur.o.sl 1.19 3.2 01/06/88 39361 AT&T-SF@(#)/usr/lib/libcurses.a/newscreen.o.sl 1.13 3.2 01/06/88 65222 AT&T-SF@(#)/usr/lib/libcurses.a/newwin.o.sl 1.11 3.2 01/06/88 18906 AT&T-SF@(#)/usr/lib/libcurses.a/outch.o.sl 1.7 3.2 01/06/88 27160 AT&T-SF@(#)/usr/lib/libcurses.a/printw.o.sl 1.18 3.2 01/06/88 41608 AT&T-SF@(#)/usr/lib/libcurses.a/reset_sh.o.sl 1.18 3.2 01/06/88 3021 AT&T-SF@(#)/usr/lib/libcurses.a/setupterm.o.sl 1.21 3.2 01/06/88 25516 AT&T-SF@(#)/usr/lib/libcurses.a/termcap.o.sl 1.21 3.2 01/06/88 50132 AT&T-SF@(#)/usr/lib/libcurses.a/termerr.o.sl 1.8 3.2 01/06/88 305 AT&T-SF@(#)/usr/lib/libcurses.a/tgoto.o.sl 1.3 3.1 09/16/86 19519 AT&T-SF@(#)/usr/lib/libcurses.a/tinputfd.o.sl 1.11 3.2 01/06/88 32129 AT&T-SF@(#)/usr/lib/libcurses.a/tnames.o.sl 1.7 3.2 10/27/87 37362 AT&T-SF@(#)/usr/lib/libcurses.a/tparm.o.sl 1.20 3.2 01/06/88 39807 AT&T-SF@(#)/usr/lib/libcurses.a/tputs.o.sl 1.20 3.2 01/06/88 21887 AT&T-SF@(#)/usr/lib/libcurses.a/ttimeout.o.sl 1.13 3.2 01/06/88 23284 AT&T-SF@(#)/usr/lib/libcurses.a/typeahead.o.sl 1.21 3.2 01/06/88 17403 AT&T-SF@(#)/usr/lib/libcurses.a/vidupdate.o.sl 1.12 3.2 01/06/88 4157 AT&T-SF@(#)/usr/lib/libcurses.a/vwprintw.o.sl 1.16 3.2 01/06/88 16223 AT&T-SF@(#)/usr/lib/libcurses.a/wclrtobot.o.sl 1.11 3.2 01/06/88 11815 AT&T-SF@(#)/usr/lib/libcurses.a/wclrtoeol.o.sl 1.12 3.2 01/06/88 40976 AT&T-SF@(#)/usr/lib/libcurses.a/wmove.o.sl 1.11 3.2 01/06/88 27060 AT&T-SF@(#)/usr/lib/libcurses.a/wrefresh.o.sl 1.13 3.2 01/06/88 31243 AT&T-SF@(#)/usr/lib/libcurses.a/wsyncup.o.sl 1.11 3.2 01/06/88 26939 AT&T-SF@(#)/usr/lib/libcurses.a/wtouchln.o.sl 1.11 3.2 01/06/88 21186 AT&T-SF@(#)/usr/lib/libcurses.a/_waddstr.o.sl 1.6 3.2 01/06/88 48136 AT&T-SF@(#)/usr/lib/libcurses.a/cbreak.o.sl 1.19 3.2 01/06/88 29787 AT&T-SF@(#)/usr/lib/libcurses.a/chkinput.o.sl 1.20 3.2 01/06/88 4222 AT&T-SF@(#)/usr/lib/libcurses.a/delay.o.sl 1.19 3.2 01/06/88 63384 AT&T-SF@(#)/usr/lib/libcurses.a/delscreen.o.sl 1.12 3.2 01/06/88 55610 AT&T-SF@(#)/usr/lib/libcurses.a/delterm.o.sl 1.11 3.2 01/06/88 3659 AT&T-SF@(#)/usr/lib/libcurses.a/delwin.o.sl 1.18 3.2 01/06/88 10211 AT&T-SF@(#)/usr/lib/libcurses.a/doupdate.o.sl 1.19 3.2 01/06/88 17267 AT&T-SF@(#)/usr/lib/libcurses.a/init_acs.o.sl 1.11 3.2 01/06/88 12883 AT&T-SF@(#)/usr/lib/libcurses.a/init_costs..sl 1.11 3.2 01/06/88 45214 AT&T-SF@(#)/usr/lib/libcurses.a/makenew.o.sl 1.19 3.2 01/06/88 63908 AT&T-SF@(#)/usr/lib/libcurses.a/memSset.o.sl 1.19 3.2 01/06/88 35761 AT&T-SF@(#)/usr/lib/libcurses.a/tcsearch.o.sl 1.3 3.1 10/30/86 61667 AT&T-SF@(#)/usr/lib/libcurses.a/waddnstr.o.sl 1.11 3.2 01/06/88 8568 AT&T-SF@(#)/usr/lib/libcurses.a/wnoutref.o.sl 1.18 3.2 01/06/88 44985 AT&T-SF@(#)/usr/lib/libcurses.a/wsyncdown.o.sl 1.11 3.2 01/06/88 19729 AT&T-SF@(#)/usr/lib/libcurses.a/delkeymap.o.sl 1.11 3.2 01/06/88 31050 AT&T-SF@(#)/usr/lib/libcurses.a/waddch.o.sl 1.12 3.2 01/06/88 46300 AT&T-SF@(#)/usr/lib/libcurses.a/wscrl.o.sl 1.11 3.2 01/06/88 40762 AT&T-SF@(#)/usr/lib/libcurses.a/winsdelln.o.sl 1.11 3.2 01/06/88 22714 AT&T-SF@(#)/lib/libc.a/atol.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/chdir.o.sl 1.1 4.0 01/16/86 37805 AT&T-SF@(#)/lib/libc.a/chroot.o.sl 1.1 4.0 01/16/86 26301 AT&T-SF@(#)/lib/libc.a/crypt.o.sl 1.3 4.1 07/16/86 47988 AT&T-SF@(#)/lib/libc.a/ctermid.o.sl 1.1 4.0 01/16/86 37297 AT&T-SF@(#)/lib/libc.a/ctime.o.sl 1.6 4.1 07/16/86 57583 AT&T-SF@(#)/lib/libc.a/chmod.o.sl 1.1 4.0 01/16/86 37853 AT&T-SF@(#)/lib/libc.a/dup.o.sl 1.1 4.0 01/16/86 25981 AT&T-SF@(#)/lib/libc.a/dup2.o.sl 1.4 4.1 08/29/86 20110 AT&T-SF@(#)/lib/libc.a/execvp.o.sl 1.3 4.1 06/15/86 40277 AT&T-SF@(#)/lib/libc.a/fread.o.sl 1.5 4.1 08/06/86 6427 AT&T-SF@(#)/lib/libc.a/getcwd.o.sl 1.4 4.1 08/29/86 6283 AT&T-SF@(#)/lib/libc.a/getegid.o.sl 1.1 4.0 01/16/86 17860 AT&T-SF@(#)/lib/libc.a/geteuid.o.sl 1.1 4.0 01/16/86 20740 AT&T-SF@(#)/lib/libc.a/getgid.o.sl 1.1 4.0 01/16/86 54806 AT&T-SF@(#)/lib/libc.a/atoi.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/fseek.o.sl 1.1 4.0 01/16/86 26876 AT&T-SF@(#)/lib/libc.a/getlogin.o.sl 1.4 4.1 07/16/86 64898 AT&T-SF@(#)/lib/libc.a/fputs.o.sl 1.1 4.0 01/16/86 50668 AT&T-SF@(#)/lib/libc.a/getppid.o.sl 1.1 4.0 01/16/86 19716 AT&T-SF@(#)/lib/libc.a/getpwnam.o.sl 1.2 4.1 07/16/86 54032 AT&T-SF@(#)/lib/libc.a/getpwuid.o.sl 1.1 4.0 01/16/86 58506 AT&T-SF@(#)/lib/libc.a/getpwent.o.sl 1.2 4.1 08/06/86 55465 AT&T-SF@(#)/lib/libc.a/fgets.o.sl 1.2 4.1 07/16/86 57555 AT&T-SF@(#)/lib/libc.a/getuid.o.sl 1.1 4.0 01/16/86 35351 AT&T-SF@(#)/lib/libc.a/calloc.o.sl 1.1 4.0 01/16/86 34911 AT&T-SF@(#)/lib/libc.a/link.o.sl 1.1 4.0 01/16/86 37757 AT&T-SF@(#)/lib/libc.a/mkdir.o.sl 1.1 4.0 01/16/86 26097 AT&T-SF@(#)/lib/libc.a/creat.o.sl 1.1 4.0 01/16/86 37790 AT&T-SF@(#)/lib/libc.a/errlst.o.sl 1.1 4.0 01/16/86 43171 AT&T-SF@(#)/lib/libc.a/popen.o.sl 1.4 4.1 08/29/86 11124 AT&T-SF@(#)/lib/libc.a/fcntl.o.sl 1.1 4.0 01/16/86 26317 AT&T-SF@(#)/lib/libc.a/fdopen.o.sl 1.2 4.1 06/15/86 26778 AT&T-SF@(#)/lib/libc.a/pipe.o.sl 1.1 4.0 01/16/86 17378 AT&T-SF@(#)/lib/libc.a/putenv.o.sl 1.1 4.0 01/16/86 11077 AT&T-SF@(#)/lib/libc.a/fprintf.o.sl 1.1 4.0 01/16/86 62983 AT&T-SF@(#)/lib/libc.a/memccpy.o.sl 1.1 4.0 01/16/86 59532 AT&T-SF@(#)/lib/libc.a/rand.o.sl 1.3 4.1 07/16/86 9415 AT&T-SF@(#)/lib/libc.a/rew.o.sl 1.1 4.0 01/16/86 35152 AT&T-SF@(#)/lib/libc.a/rmdir.o.sl 1.1 4.0 01/16/86 26081 AT&T-SF@(#)/lib/libc.a/scanf.o.sl 1.1 4.0 01/16/86 41570 AT&T-SF@(#)/lib/libc.a/doscan.o.sl 1.7 4.1 07/16/86 60596 AT&T-SF@(#)/lib/libc.a/atof.o.sl 1.6 4.1 07/16/86 7683 AT&T-SF@(#)/lib/libc.a/fdtos.o.sl 1.1 4.0 01/16/86 43457 AT&T-SF@(#)/lib/libc.a/filbuf.o.sl 1.1 4.0 01/16/86 51875 AT&T-SF@(#)/lib/libc.a/ptod.o.sl 1.4 4.1 08/29/86 34562 AT&T-SF@(#)/lib/libc.a/setbuf.o.sl 1.1 4.0 01/16/86 40863 AT&T-SF@(#)/lib/libc.a/setgid.o.sl 1.1 4.0 01/16/86 5833 AT&T-SF@(#)/lib/libc.a/setuid.o.sl 1.1 4.0 01/16/86 22228 AT&T-SF@(#)/lib/libc.a/setvbuf.o.sl 1.1 4.0 01/16/86 17449 AT&T-SF@(#)/lib/libc.a/sleep.o.sl 1.1 4.0 01/16/86 27946 AT&T-SF@(#)/lib/libc.a/alarm.o.sl 1.1 4.0 01/16/86 47639 AT&T-SF@(#)/lib/libc.a/pause.o.sl 1.1 4.0 01/16/86 26337 AT&T-SF@(#)/lib/libc.a/setjmp.o.sl 1.1 4.0 01/16/86 38006 AT&T-SF@(#)/lib/libc.a/sprintf.o.sl 1.1 4.0 01/16/86 19303 AT&T-SF@(#)/lib/libc.a/strchr.o.sl 1.1 4.0 01/16/86 52023 AT&T-SF@(#)/lib/libc.a/strcmp.o.sl 1.2 4.1 07/16/86 44085 AT&T-SF@(#)/lib/libc.a/strncpy.o.sl 1.2 4.1 06/15/86 14163 AT&T-SF@(#)/lib/libc.a/faddd.o.sl 1.1 4.0 01/16/86 59022 AT&T-SF@(#)/lib/libc.a/fcmpd.o.sl 1.1 4.0 01/16/86 40105 AT&T-SF@(#)/lib/libc.a/fdivd.o.sl 1.1 4.0 01/16/86 10630 AT&T-SF@(#)/lib/libc.a/fltod.o.sl 1.1 4.0 01/16/86 18580 AT&T-SF@(#)/lib/libc.a/fnegd.o.sl 1.1 4.0 01/16/86 37593 AT&T-SF@(#)/lib/libc.a/ldexp.o.sl 1.1 4.0 01/16/86 15998 AT&T-SF@(#)/lib/libc.a/fmuld.o.sl 1.3 4.1 07/16/86 50506 AT&T-SF@(#)/lib/libc.a/dround.o.sl 1.1 4.0 01/16/86 62856 AT&T-SF@(#)/lib/libc.a/dspecial.o.sl 1.1 4.0 01/16/86 7979 AT&T-SF@(#)/lib/libc.a/fpstart1.o.sl 1.2 4.1 06/15/86 19738 AT&T-SF@(#)/lib/libc.a/strtol.o.sl 1.6 4.1 07/16/86 31550 AT&T-SF@(#)/lib/libc.a/execl.o.sl 1.1 4.0 01/16/86 47265 AT&T-SF@(#)/lib/libc.a/execv.o.sl 1.1 4.0 01/16/86 65461 AT&T-SF@(#)/lib/libc.a/execve.o.sl 1.1 4.0 01/16/86 17110 AT&T-SF@(#)/lib/libc.a/exit.o.sl 1.1 4.0 01/16/86 52308 AT&T-SF@(#)/lib/libc.a/fork.o.sl 1.1 4.0 01/16/86 8429 AT&T-SF@(#)/lib/libc.a/strncat.o.sl 1.2 4.1 06/15/86 23221 AT&T-SF@(#)/lib/libc.a/time.o.sl 1.1 4.0 01/16/86 39659 AT&T-SF@(#)/lib/libc.a/time_comm.o.sl 1.8 4.1 01/30/87 25579 AT&T-SF@(#)/lib/libc.a/times.o.sl 1.1 4.0 01/16/86 26013 AT&T-SF@(#)/lib/libc.a/fopen.o.sl 1.2 4.1 08/29/86 10450 AT&T-SF@(#)/lib/libc.a/findiop.o.sl 1.1 4.0 01/16/86 36044 AT&T-SF@(#)/lib/libc.a/access.o.sl 1.1 4.0 01/16/86 25853 AT&T-SF@(#)/lib/libc.a/strlen.o.sl 1.1 4.0 01/16/86 64518 AT&T-SF@(#)/lib/libc.a/tolower.o.sl 1.4 4.1 04/24/86 57420 AT&T-SF@(#)/lib/libc.a/toupper.o.sl 1.4 4.1 04/24/86 57548 AT&T-SF@(#)/lib/libc.a/ttyslot.o.sl 1.2 4.1 06/15/86 20093 AT&T-SF@(#)/lib/libc.a/strncmp.o.sl 1.2 4.1 06/15/86 28844 AT&T-SF@(#)/lib/libc.a/strrchr.o.sl 1.1 4.0 01/16/86 63356 AT&T-SF@(#)/lib/libc.a/ttyname.o.sl 1.2 4.1 06/15/86 39588 AT&T-SF@(#)/lib/libc.a/fstat.o.sl 1.1 4.0 01/16/86 22233 AT&T-SF@(#)/lib/libc.a/lseek.o.sl 1.1 4.0 01/16/86 26177 AT&T-SF@(#)/lib/libc.a/stat.o.sl 1.1 4.0 01/16/86 22223 AT&T-SF@(#)/lib/libc.a/strcat.o.sl 1.1 4.0 01/16/86 27798 AT&T-SF@(#)/lib/libc.a/umask.o.sl 1.1 4.0 01/16/86 26285 AT&T-SF@(#)/lib/libc.a/uname.o.sl 1.1 4.0 01/16/86 24881 AT&T-SF@(#)/lib/libc.a/ungetc.o.sl 1.2 4.1 07/16/86 60367 AT&T-SF@(#)/lib/libc.a/unlink.o.sl 1.1 4.0 01/16/86 37773 AT&T-SF@(#)/lib/libc.a/utime.o.sl 1.1 4.0 01/16/86 26353 AT&T-SF@(#)/lib/libc.a/vfprintf.o.sl 1.1 4.0 01/16/86 31733 AT&T-SF@(#)/lib/libc.a/vprintf.o.sl 1.1 4.0 01/16/86 34757 AT&T-SF@(#)/lib/libc.a/vsprintf.o.sl 1.1 4.0 01/16/86 9222 AT&T-SF@(#)/lib/libc.a/doprnt.o.sl 1.1 4.0 01/16/86 32739 AT&T-SF@(#)/lib/libc.a/ctype.o.sl 1.3 4.1 08/29/86 37429 AT&T-SF@(#)/lib/libc.a/ecvt.o.sl 1.2 4.1 07/16/86 62646 AT&T-SF@(#)/lib/libc.a/dtop.o.sl 1.2 4.1 06/15/86 45240 AT&T-SF@(#)/lib/libc.a/biglitpow.o.sl 1.3 4.1 07/16/86 58018 AT&T-SF@(#)/lib/libc.a/frexp.o.sl 1.1 4.0 01/16/86 14207 AT&T-SF@(#)/lib/libc.a/fwrite.o.sl 1.5 4.1 08/06/86 53377 AT&T-SF@(#)/lib/libc.a/flsbuf.o.sl 1.2 4.1 06/15/86 45043 AT&T-SF@(#)/lib/libc.a/close.o.sl 1.1 4.0 01/16/86 43481 AT&T-SF@(#)/lib/libc.a/data.o.sl 1.1 4.0 01/16/86 48837 AT&T-SF@(#)/lib/libc.a/getenv.o.sl 1.1 4.0 01/16/86 12739 AT&T-SF@(#)/lib/libc.a/isatty.o.sl 1.2 4.1 06/15/86 29812 AT&T-SF@(#)/lib/libc.a/ioctl.o.sl 1.1 4.0 01/16/86 26189 AT&T-SF@(#)/lib/libc.a/ltostr.o.sl 1.3 4.1 07/16/86 47790 AT&T-SF@(#)/lib/libc.a/m32_data.o.sl 1.2 4.1 08/29/86 49169 AT&T-SF@(#)/lib/libc.a/malloc.o.sl 1.3 4.1 07/16/86 52312 AT&T-SF@(#)/lib/libc.a/memchr.o.sl 1.1 4.0 01/16/86 43452 AT&T-SF@(#)/lib/libc.a/memcpy.o.sl 1.1 4.0 01/16/86 41010 AT&T-SF@(#)/lib/libc.a/memset.o.sl 1.1 4.0 01/16/86 31300 AT&T-SF@(#)/lib/libc.a/open.o.sl 1.1 4.0 01/16/86 10730 AT&T-SF@(#)/lib/libc.a/read.o.sl 1.1 4.0 01/16/86 10714 AT&T-SF@(#)/lib/libc.a/sbrk.o.sl 1.1 4.0 01/16/86 30288 AT&T-SF@(#)/lib/libc.a/strcpy.o.sl 1.1 4.0 01/16/86 10565 AT&T-SF@(#)/lib/libc.a/wait.o.sl 1.1 4.0 01/16/86 31301 AT&T-SF@(#)/lib/libc.a/write.o.sl 1.1 4.0 01/16/86 10722 AT&T-SF@(#)/lib/libc.a/signal.o.sl 1.5 4.1 08/29/86 60416 AT&T-SF@(#)/lib/libc.a/fpstart.o.sl 1.1 4.0 01/16/86 31329 AT&T-SF@(#)/lib/libc.a/getflth0.o.sl 1.1 4.0 01/16/86 27494 AT&T-SF@(#)/lib/libc.a/getflts0.o.sl 1.2 4.1 07/16/86 32658 AT&T-SF@(#)/lib/libc.a/fpsetmask.o.sl 1.1 4.0 01/16/86 38940 AT&T-SF@(#)/lib/libc.a/kill.o.sl 1.1 4.0 01/16/86 5824 AT&T-SF@(#)/lib/libc.a/getpid.o.sl 1.1 4.0 01/16/86 18967 AT&T-SF@(#)/lib/libc.a/cerror.o.sl 1.1 4.0 01/16/86 56106 AT&T-SF@(#)/lib/crtn.o.sl 1.1 4.0 01/15/86 0 AT&T-SF