ELF4)4 (44DDDD+ -/usr/lib/ld.so.1W A o` ] Vl |1  "O~p^'1O n  ^ 4[!9-, |e5 6  O% a  & T! w  & k M H 8y  F ( #HG p2 C ` #$W%=<F! Q" y q\JO~ k yW7 l o~ $   1 ,K//>  R|Y &]'  ^ 8 sa}v s @  e   i  H| % 4 2 <  D 6}k %9 + &>~"O H #]FjbR C  Y 7  B23  0lb < a ikA < D    : ~C& U ; {  9@ :  b B)+ P ^   }T ]6  (L , ;pc  } : 7;=D >hfc   sl  2! mY ZcI V SL kXP 7 sE 7h  O Wujp Jv cD  w6   E  v %  " T\@d m.yw j }  J 89 p  jU */ <  R : @    $y  0N u-P-t z   7 xM- r % ,P   / Z ? Z `%#  .X #  VM# {l  8   0 qt   5Q |' cx*K  k@Gz 4j- PZDi m TxB \ lN  W h05 3MB" ]Vm7F $ e vfOV$=]mP  =~x u= v  6h] " W4Z d  K ~g* Q Y ~"}7a4  _TNK CL  ifI ]   9$ < (VQ[* Lrb }m g ++ u N( %  4h 'z @/M A& 0' y=? bXp!^ o 0 4O =F  t{ G?: 0 w etu 2uZO V 5S : aurn . j  X cfjqt zQ p Y, x*& [ 4  ` t > i Rd p | | ? P ^   8 )/ = J zdn0 x_  ~h.Q Q /e l  x { . e- i I .(  ( x1 T J  q q  v>  )  8 *  u, a/ B ! &CA H  I,  m>{7} a 0D  F; V 5 h8 w R  \eko  XH M ;" S \ +  `SG g {  s3r=  t 6<J@q R$ \j M G _ G9KRB<8 f 02 v !  - b e l  h9 E y  ( vd\ +_ y\X rL 8  K _ @)A u2+KP_c  AU[U@ u !X- + "   ar4 ) ) / H1 (t3CLc r $ [:fE?   '} yB T .  @<|Q 1a D ) I   ,pb9 Y g* . s 4 O| %) !3 ':qS WhxS] ;   /5 W {g  K 6FY 2 [ dA#kZU"TwRV-NW6H~:#aKIA, oLI\ >@sc\;$`OZNF>71YJIS[|EZ Tz1Wbb5.ER^RH3iY\&eUT9$9m<g'*F32nAc2M{q:_E?6fNnf oS1aS_ `]B e& 3HlC'^'@J0{C7#iqodL#tXeP3ZM,%/=o>G UsFw  +QLI vI?JK*  c*w,!mz>g%N%B+"EAn+B]r_jQ.m}g6? 6 ERn;8o>g_U rEC1nn)q p8(&U V 9zTDvyM^8?Yw!Y.)<k(fyi1~;NqG 7?sAt$4ijsU:'9z,[Q?3zN`G^(4w3 d?^s'`*W -fd)f =# bDKMpk/` 5 G!Wr5 2gSX B jV EdD# "Pb; {+X`v5C H hlz  ):N&nZ{dC$|.  S 6  x }xht <u o n 3 ; J ; P - i_wL Lk ( r AF5= [ 1X * l    G[ > [ 2 0J  Dm  g I- o 5 U ԀP`4  `   D+-... !qX 0  $x,C &x,3:n  A"  Iؙ4P,& [lLdH mTKqKz@1l lJ  ~ $/ < "J4 $i H X   x ;f `PC C| | G PV  w  Jx%H7,(Y <L ALLH@ Q!0 ^HfP lc qP xx@ ^, L/`  @ (@0Q bTPD@g$D G4Hx  @ } SD#0 +G1x ;JD@( LSU \Gc$l,H r!| ` dL8Hl^< ;\xܭ| Gr |X ( H P   F0  $ B  P( " n\ (G.6P8 < D& MlVH^hh ejqT? wPT ~L 4 $- )- 1 HX HL  |D \$4   0 F \  4? "[D (1pw @ 8P ?h$ HL@  O T, ^L( fhn xh <^DG$MpM( S\<\gn4 tT@{  ,9h  PB p ԏ H ԙ D:qx |  tH 4P<   ,I / 9D 5 o ( < D JL @T [ d |I,l L s X 0 D N xK     J  d H 8 | 4o |7 P L < K K( b0 H9 LD sK lT |Z |Vc s8 k oq DKx P~ L H   a 9  @A T N d L:  xM M @ $   @    ? P (-  G  N x?,V H@ ^ Tg Hn +0 u  |  < @ t$  G $/ <` H ; X ` 0 q  Ch   c  +-   d  pH t % \* E0 0 9 E C 0 K  R TH  X Ԋ 0 _ Gd `h dm N  t "~ ! J Y  , L  h  L p  L : Z |  4 Ա  A ̻t  m  M |M$ H  , l3 e  9 tA t QKXd `d  jX\ oċyt#0  D G< R  d*0 DI( p  < $l,lXG\Kܡ r `K XGK"' +2_ 7> ` >F8MM,T$-`pP  g<%0 t|B0 (p  P D 44  Lp    / B  X c $d ( $  < t  Ђ  `M&8 X#l $ĩ.7%- >GBJ  P$V[bdx p $ w`], ܭD? Jl ^0 Ha4 T^| JM44  x@   #+L6XGk <(CX!0 N  Y$ `h p xl$0 H0nC@ lH E c l7+- |tXT `I ? U P  L p @6 sl % tG, N 2 h; @B @N ȋW X ` i o LF u P ~   G 0( mH -  <$ G @ G  . LG J I? D<   S  !, !! h #!<1!p  :!`AA!hH!@?D R!JY! , c! j!Gq!I? w!@z!`* !TDX !I  !4I!, !P !$" !D!`( !J!О h !q!̍!lI! !Ѝ!!ԍ"؍"d " + "D ""K& )"|H2" 8"0+0 B"܍L"dIS"c]"c 3 d"l o"  v"0,4"(/"L"q""  "\Fh ""e " "h"$""\ ""XP # #$:E$8-Q$@-X$!0 a$Ll$8-   v$-}$X  $$l $@$Vt $<$$t9$x, $4, $$ 0 $܆t $K$P $`8 $ A$%hm % K%%H#%y  +%`7%?% ( D*-M*KT*[*Id*`Vn*pv*!L |** *G *$ *x[ *t*O p *H*N  *L*h*A  *J*1p *<* 0 *!  *+Ȫ +x9+ H+}( $+$-+5+ =+p  E+qL+.F..P. W.ȢP _.$ ` f.m.s.@x..n  .4~  . .X.;D .! # .T.p , .4.D.#0 . )- . G.@.D.H.$/J /` /A $ /x "/H)/L0/p W 7/g >/*- I/ P/Ћ x W/K^/d e/y : m/u/,; /://xu /G / ] /t ( /tL/  /la /C  /7/0  /P/H/q/0^1Ge1m1 s14\ |1|.  11`1ؐl 1' 1$1rH11q11  1d1H11t11L1 3 3$3@u 4` 44P d 4& %4,F +4N  14li  94dKA4\H4 9 N4S4t[48eT `4t  i4hqL u4#H }4<L 4t4~4<\l 4Z04,/ 4|@4`L4\Q4T]4hq4x4$4|4 4 4 445ԗ 55 H 5H$5,- (5( $ 150I:5@ | E50 L5\U5H\5Tc5Jl5xLu5|5DJ H 5(K55|z` 58Q H 58u  5.5P5J58$ 5̋558$D8h N8@@ Y8(^8 h8n8 w8Dq  }8p8 8x8,  848 8Xe  88 8K8t| 8l\ 8N 8$8(p 8t8=3H=`W Q=XZ=|Aa= =.=D r > *>|  >,8 $> +>@; 1> 0 9>D4 @>dG>dO>0/  X>^> Ie>h!m>l v>TM}>>> >TF >L>3, > >G>$>, >: >>l >L  >H H >4>e ? ?$K?L?0%? 1? 8? A?JN?XMU?]?pc?< l?, u?{?<{?hM L ?P ?Q ?| ?LL??D?pp ? ? 8 ??q?4?8 ?0?pK  ?PM  ?S@d?  @G@ @ܨ0#@+@+0 5@ =@pt G@N@<d T@X@]  `@xHDg@? m@@u@|@-@ @H, @t!   @$@@v@ @<@@h@H"0 @J@8 @8L8 @m` @ @ @ KtK  Kx0 LT L\`LLL9 X L8 \ )Lxn , 1LTd ;LBLر KL?0 UL\L  cLHlLj  uL"|LLLtLD$ LHP L 5OXu  ;OAOJOH( ROGWO_O8z fO,HmOpOd<  vO0s  }OXpO3OHO< OtO,-OGO|O0HOHR O O4KO@LObOE` OGO9D P PP Pi P> %P %- /PCD ;PXu  DP_ NP,M TP -[P6  aPD  hP(qP${P Pt  PA PXP7 P,P$(P@ PLPSPiz PPP P4MPJ P < PD P| Qe  Qh9QF #Q(Q UpGUMU U: UB Uu |  UKUx1 P U UUxU|V,Vf  Vg VJ | !VxW*V+(8VLCV9JV  QV ZV@MaV|fV|mVuV~VPVV!VPV8VLV@VK  VM  Vļ0VV  V<[VP T VlX VVԋW L WDW@ Wp7|"W | h )Wd1W7W>Wo EWl8  KWPSW@ ` ]Wp[eW,0 nW2t tW{W,4 WW WuW\  WWbWIW8 W|qWWQWW4W:WW8XX X$0 connoitilde_expandfctabtx_italianfspeccknetvsocketnetincident_uispipenextstep_ustreamedgetsysixcpsslostartxfcasdologtx_nextstepprescanck_alarmxas55fttabaddmacdoshowwclrtobotmemstrxdgl1ndialpuccxdgl2xl2ge_y16updatelpcapbzinptrdiaopndoclslognetworkdialmprmtsavtabckgetfqhostnamechk1triggervalchk2portuguese_ucksysidzcopychk3xkanjfx1250l1cs_is_stdquerysighupx1250l2g_pcptcrctaxkanjidirlineg_prefixingmyflagscrctbkbcharauthtype_nameslastspmaxatblkidodebugdialmthhttp_headaskflagiso_8859_4_ucapasu_qnxgrphhwparityx1250l9readsize_startlpcaprtcharsetxkulcpeerhexippadbufoptbufonoffinetimeatblkocs_is_nrccmdadliftabrmstab_mbaddchlpcapugetiobstod2seccurscrzchkpidu_dglinepty_getptycmifidomacz_nopenisendwinninpsxeofspsizopktcntxukl1xitwarncp1250_uwtmpfiledialescsrinitreadgmtimexl2l1xkanjzdoswitchiso_8859_8_uhpmath_u_mcountaddliststoptblgetpeernamezprintxferstatfilcntlogpktxl2huckradixzsoutwildtabckrcharxasskdolocaltx_frenchcallocxl2l9dialnamedostopCOLORSinitattrcmriniforce_doupdatettscarrckxwtmpsgetpwnamzstartynel1y1251lcdialcqiattrDeleteStartupFiledialtonedialdctn_wait_flgonoffautreset_shell_modeckxvcmpushtmpbufhintsen_xitdopingniot_change_colorfrecfmdbfilevernumrbufuseprotocolavailtabdpxtabatoihttp_indexis_rockwellcurs_parm_errisfloatdoicpgetcwdtakerrckindexatolfilecasenoprinterdoxconnfmaskrcv_renamezstateyfcl1cp1258_udialecmrvalu_cp862srvcmdrdigitsdotloghttp_putckcputcpeakcpsnoinitu_cp864ptyibuftn_no_encrypt_xferclcmdsfcpsu_cp866g_fnactck_lcnamestdouffilcpsdoprmgettcsrewindu_cp869u_dgiyeglgyh7lhdesttabtanxspasu_tvignorwegian_usndexceptyl2mzfnsuccessiksdconftopcmdmypida_dimu_cp850cp1254_upty_open_cttydeltermxfrintdialfcu_cp852cp855_ulastxfersetuidckzvrpsizrealpathdum001byteordertn_doopfreaddum002dialpulserlog_nawsu_cp855dum003gtvdn_expandu_cp856maxtryen_hosu_cp857rcvtyprecvu_cp858getdialenvsacktbltblwscrlendwintx_portugueseinitflggetpwuidrmdirxl2lgcxtypeswrttsamplessrttblxchasiksdcfconchkMAILCMDxnel1savdirdialnprtimezonesndlargerxnel2Mouse_statusbrowsersetonautcwdon_recallnatrtimelimitlockpidshowassocchktimoxsinitvvbufpty_initialize_slavexnel9delmacacs_mapncxnamegetpathcmdlvldialdconflonameckdialtapilinetabnabltabBCtn_debugdebsestcp_dontroutevfprintfbestlenwhatprintontoupperpktintvlxfcl1wnoutrefreshgetlocalipaddrwhil_defck_cleol_environ_endlocalfackpathdialfldrpathtabg_rcv_moveflfnamepktsentdbdirnqvswtabtgetnumyl252fncsavosizezchincmtxtshowarrayttsspdttcstabxl2nestartupdirxeglgnfuncstransmiten_maixh7lhfreclchk_acsl_tn_waitcm_recallgetdmdecodexl2mznprotosnakstatele_putstrck_errstrunm_mchz_inle_cleansetinpcseqtabx1250assleepcanpartbltvig_usetintdialatmopathtabforgttchkoldevalss_saveversioyspl1mydbseektx_usasciiflcidoexitttldnxargsu_to_bdodialu_swisssniibm_uctlpforkgetpidsrfspecctlqzstrdtrptnxl2r8i_activeisunicodesysinitgnfilexlatedogotorptqtfcflcotraopninbufsize_iobnettypedopauszchkigattrnumbufsetdestdbpidrlog_stoppedzrtolapcactivenwaittabospeed_ex_registerreaddirxxstringzchkoxl243zxcmdszeofcmarg2en_prizchkspaxfrbelmlooknetsaveychl1asktimedoutcswidthikdbopeneditfilexl_ucp869_unlocalacprefixingyesno__flsbufwcurcminizfcdatu_decmcs_GLOBAL_OFFSET_TABLE_cdmsgfileatsidickhostpriv_inishxpandcalibratele_putcharflotabdopurgeunm_nampriv_opnyh762whoareuspktldo_openfcctrlgetj7xl252dialecondomydiratsidoserverreliablesetdiroptsfnval_curs_scrwidthc1tabshocharsetdialcountnfilcsleephomeyeg69ebqflgpipexl258urpsizcrunchedinintrcmd_quotingapcstatusauthtabng_pswdck_lingerxfubigrbuflangsauthtabacknscopytabnfntabu_italianttimeoutrprmlenx58asdial_fctcp_lingerdooutputnetbreak__ctypettocxas1251xspl1fcharsetgetpktxfrmtabhupokmystateck_patchnfilsnbeltabptyver_use_envunm_modzfnqfpdologinepktmsgxlavstchr_called_beforefsecscmarggetnetenvckstrchrckferrorsndcmdu_c1picsjis0201r_unetfluidoxdiscongspdttolzgfs_modewinloooatabcmsetpckxprivencstrnqvtnscntabconoladir_dotsdoxoptssxxz_getlinefinnish_ufspeclen_slk_initgethostbynamefuncstrxwordsm_cautiousfileheadcdtaboptlinesu_quickdrawpncvtrscapbxchl1nvarsfailcmdlinefnparseconolljzdatemyxipaddrxl2skprintoffnrpathtabu_8859_1u_8859_2u_8859_3cmaskttnamedotakecmsavpeditoru_8859_4filterhhmmssu_8859_5zrenamearraynamu_8859_6_quick_ptru_8859_7rpktlcmdinizstripfseekspdtabshoxferu_8859_8mkdircmargpu_8859_9reset_prog_modelock2freelocalxl285rscaprnoheraldckxprintfsignalgeteuidwyse_g3_uretransmygetbufrscapuckxsysthermometeracceptx_loggedttpeektn_infiniteshodblhz1500_unzxoptswindowatexitcxnamecmdintsesfilsaveasknxmitxleft160actionxmitatcpsrv_opentn_initexitdialogsysidlistrandcktelvxmitfswcapbisguestcmfldflgscmfdbtimeoutsalrm_timeg_varasgtabckmatchalarmznewnplogindadabigsbufbgchkstrcodesnnetkeydoelsexmitlz_countu_dgspecepktflgfilhelpnflohexbufu_c0picscmd_rowssopktdialhcmdslrestorg_sfiltertn_sxdisploccmdvtn_debxmitptn_duplextra_asgcp37_uxmitsncdmsgxmittcreattechonvlooktn_snawszgtdirckxanonchkfnzhometn_sttypcur_strsswcaprxmitwiso_8859_1_uxmitxptyint_vhangupfatalio__minorswcapuwearealikegetlogindialsponprinternamettynameshoctlbgsetznextopenlogrttvariancexmzascmonthssniblanks_uchknumrbufnumsrtabshotabcx_activeshoparurclearxaqasdisplapriv_onlogdoargreofdialecoffiso_8859_5_uxaskmoreshmdmlinxkrlcdebopnftpappqnxgrph_utolowerpktinitOldcolorszsyscmdlockfxlraccessxlsofn1ofn2f_ctlpsetxmittncntssrvdistlevelmalloccp1251_u_xstatreotcmdatedialsfxen_mkdxl_tcutn_rem_echorcvfiliso_8859_9_usprintfucs2_to_utf8makelistsh_sortdoaskmdmhupu_8859_10delkeymapmaxnamzkselfackttgwsizcmgetlcyystringpopencmdirpdolognetsetfilu_8859_15en_typb64tob8ckopenxncxtypeswdiallcackoi7_uebq_nunamedoescs_pktnrltdialtest_mbinsshiftputsrvwhatru2x58l1ndialtoccg_spsiztx_germanclsondiscxferfilex58l2initxlatepownewscreenautoflowen_enakermrctx_cpsubbdecodeadjpklnoutptabinstatussechog_skipbupmdmnameg_snd_movetinitatmbufjis0201k_u_countcharzrmdirylcacckcuniDef_termx_passwdxleft128x58l9dialnumgetokshomodemu_hproman8opendirdialrtrfatal2termbuf2clearediksloginziperma_ptrm_fastnrmszputfildoxlognrmtu_dutchrptminx25fdshotcstyp_widxlatypewritabescapebindtx_quickdrawdir_backcmresdialnofclog10cmdmskckxechtn_env_dispdialdcoffbit_attributesttvtCOLSlsetzinfillu_hungariancolxtab_initloginvg_wslotrz_openisinterruptedwasclosedymzl2wclrtoeolsuspendcp1255_uyaql1dialx3ckxsyslogttsndlbzvusercp852_ufwriteseofczseeneditoptstelephony_frst_strsmodemp_do_slk_tchwtouchlnpktfilqvswtabhpline_usrvtiminiflagssnddeldialcnfdosaveg_patternssndaftertx_icelandicseolzvunamenzltorpwflgmodfsetsockoptsndsrcidentmsfilespatternsdoconectylcbuckpromptshotelPCsl_uid_savedcountduphmsgalunetg_urpsizfxdinitseotcp856_umemSsetnzxpandumasktsleveldiallacdbenableddocmdliner_pkt_change_videocs_sizefabsflowremappdckzsysfputsprotosshotoptgfmodenhcounttx_koi8rrptenazoutdumpiso_8859_15_utcp_sendbufsinittx_koi8usendstartxlcacm_xargck_timepeerxipaddrxfrcanrmailfz_closeu_jis0201kheath19g_udgline_utx_smileyspacketsdefumasktopxargmackeydialconwsyncupifcondchkwini_isopenxitwtabifcntcsetsfnctabiswildnexitwtxrinfomaxpathwaittabrmsg_outwchunm_verspacktralogmyinitdecspec_uclfilssndstringwaddnstrsstelnetyl21250xlcascmfldtermerren_asgsseqtblunungwcbreaktimeu_finnishrpacketsatcapbnfloname_fxstatz_getnameconcbxmzl1dialtabxmzl2setjmpzgetfsxaql1tcpsrfdndialdirkoi8u_umystchunm_relxaql2nftrpadchmakeverz_getfnumnsavwyse_gn_udialcmdtcsetpgrpmbgetwidthxfinishzdtstrxmzl9ckdatediractivexferlogfor_deftgetstrrttflgxlgasg_displacmdfiltn_env_acctdialaaondosetkeycur_numsylgegxlcbupushqcmddotypeatcaprcp862_umypadcsj_to_uncrrtabatcaputtimoffspmaxendlineck_s_xverwmaxtt_rowsx1251asflushiftellactivecmdu_jis0201ru_maclatinmaxsendprtopt_do_slk_norefpriv_cannetkeydisptbarrayatoimdmtypsettrmtyp_delaymypadnxk8asSPhextoulongttclosrinitanonfiletn_sdsbsnddiralrm_datelocalheadcp866_uduplexdologendtelnetfdopnerrspeedrtimerxtusscanfxufocctzvlogoutsettypoptszgpermfnlistfilefilezsinlsnieuro_u_sys_nerrztusectyp_lineslookupcurs_errnoxarrayenctype_namesmynamenopushttpipegetuidrpackptyint_void_associationpipedatattgspdckitoaepktrcvdvoltabrdataprttinitfpxfsecstxtpatternsxutylck8xlch7xlcegtt_colstn_set_modescc_intxlc1251slmsgmovingntapilinenclearopthlptempdirpdsfxrfspeccxseenzfseekx55aszmkdirtyp_pagestrftimeu_sniibmdebtimxdmasmatchpxxwsyncdowncnflgvsprintfdofilewclearu_snibrackUParghlpmbscrwg_snd_renametx_swisspty_init_endwinxlgegsqrthomdirtn_auth_enctnoppsdanish_uckxlogginginitfloattn_locmjdnrsrtabdelscreenfblksizeu_to_sjbeltabgetpwnamintimewcursyncupxtimerhtfcpsicelandic_uztimestdinfcongmfreerpktscntabnettchkcmd_colsfclosefackbugshowoffsys_errlistsetvbufybulcsndxhigetenvg_fncactvartabzgfs_mtimesndnbeforez_maxchanatgprireal_uidpktpausprotogetservbynameTYPCMDintimten_quekeymapermsgchktabwfswifreeslot_scrmaxatgprohavelinebackgrdxduastx_identxfrnumdup2xl91250dialmstrarrayboundssrvidlsetbufb8tob64strncatafcsetpwbufcc_alrm_executesndhlpprotvck_s_vertn_env_jobckscreencmcvtdaterempipeoldcpsshodsatsysiksbufgmdmtypen_renmydbslotboolexpxfrchrxlck8chkarraytcsetattrckxfprintfinidirreadblockTABSIZEwaitzkanjfnetcmdis_motorolatx_8859_10atsysosndxindflocooflagboolcodesen_retsndsmallerdialcvtgetyesnoshowtypoptscfilefsetreliableis_a_ttyzkanjitrap_tapilinetabreadpassselectdoxsendauthmode_nameszinbufferdbinitzdeletidletmotx_8859_15ck_clsifdtabattypizxinntohlckcgetckactivemktimenshowyse_g2_uwinsdellnstrncpyputmfilofn1xattyposetgengethostbyaddrmaxtimemsleepzdstuffntohsen_fingetdnameautoexitchkckwarntt_trmatchsuccessg_xfermodex1251lccur_termwslotnttxinsl_tn_savedxmitbufdeblogmtchstn_b_meushomacnclsfcs_saveydml1ncmdheraldzkanjzdidsetlinsessftlocate_srv_dnswslotrmacrotabxlgl1tx_maclatinwslotsstreamokkwdhelphomepathu_hplinekeepaliventnopttnoptswfirstByteMarkeoldataikpromptttpktckcvtdate_DYNAMICzchkidsrvptrsndarraybigendianofpermskgetfmacargcgetrbufxbulcdotakeininetopenrenamedoforatdatix69astt_unicodeintrotxtz_lineturnxitasy69egusagekgetmtcp_dns_srvtn_ssboptinpcasatdatovidupdateucsorderoutptabonoffswtx_cp37ttpushyk8lcsetatiso_8859_2_ucmaddnextoptactsstatetb_namedectech_uincastsetnumu_snieurodestutf8_to_ucs2atdisidialkspdiallcpdormtndresetdgword_ufnerrordialtfcsizef_tmpdirtsecslinknamediallcsk_info_dirlogchartzsetdialmautooutescckxloginxmakestrwhoarewecannedydul1indefatdisosndxlostrncmpcmcfmguestsetccispatterniso_8859_6_utx_usubinitslotgetsockoptsndnafterxlckrnrfilpdofastle_inbufinpbptx_decmcswildxpandtn_sikssrvpingtn_b_nlmxlckudialtfpspanish_umaclatin_uchdirntcpoptg_fnspathdialldpu_dgword_csmaxxnoaswhoaminfctabdutch_utn_exithcflgxfiasdialldsitalian_uinit_termbufpriv_chkadebuevaladgi_ucp1252_utn_env_flginitpat__iobexecly55lcinitmac_sys_errlistsetgiddohfuncxdml1teloptsck_s_testconecttn_pushputtrminwaitncolxdbfpmsgflgxdelmacshotrmtcp_keepalivedialstaxdml9cmkeydialcapasshomdmoldgtvndinitedkoi8_udgspec_umaxrpsxarg0cxlogbufnh_passoctabturnchcmnumgetncmhttp_getpktnummactabincvarprintwsnibrack_ucmdbufintmsgf_savesyscmdshowooaattrtabu_transparentinpbufcrdtabtparmxk8lczjdateevalxsnd_renameslotdirgetsbufgetnctxxdotpusharray_useidlnrcvfilterttspeedfp_roundingylc55feoldfmdmle_getcharclsifcmofic1pics_uctimefsizeconocyitl1dologshowstrcatfailoseqcryptdiallccfp_digitsu_norwegianconnvfailnetincxl_ufcpopclvlmazovia_uxdul1doxarginsilenceexec_cmdioctldobugfncnvsattrlblbufmyhexipiotabconolend_ptyndbgntypetab_setidlndialdpyck_s_daten_xargmyctlqpriv_offmakebufsrvtxtrptflgrrfspecdoftpgetsysidxgeasz_errorg_fnrpathpsuspendcp1256_utermbufmyrptqshortbytesttflowinet_addrtx_hproman8setsidooptswritencrrfmodcflgen_rmdtcp_linger_tmozl1asx55lcx_ifnumreallocnamecopytx_dutchaxcsetatencifncactq8flagpromptxquietfndiagsdbipdialtypehungarian_uzchkodclearrqckstrcmpr_csetynol1sw_defnopnnfdtabclsconnxonamezsyslogckltoamechoyfil1y1250l2_first_termatenconumerrsylg69_tcsearchdialsrttra_cmdcp857_ucxflowtcp_recvbufylcsknspddialmacnpadffcdbrecxargcqvtabcdtimofnspathrs_lenshowdiropts_rip_init_virtscrparnamdialhngdfttym_linediscardtn_resetx85asu_sniblankshwpartbltgotog_matchdot_dgettextndinitzxrewindxlc55x69l1ftresetfpfsecswhatruxitl1npargetppidwartsetalarm_blast_keyskoi8r_uwcscrwxargsy69lgzl9asmstabcopyrightcdmsgstrstreamingbinpatternscklibvttmdmxargvfdopenLINESdochku_dectechxvernum_exitDELCMDdiafilcmifi2eoltabsmiley_uckgetpiduserfiledoiksdinitfstatsdialtoccnhwpartttapistopbitsrcv_movefilnamungwordnolocalzincnt_branchtosesopnshodialck_s_tverin_recalltnlmtcsinfodialaaoffsbufuseyl1aqqnxportlocktn_fluiyl1asbrowsoptsrecpktack1mxxlookquickdraw_uxlhasludialtrmbufCPYCMDygel1ylhh7ndeltabdoopenxnol1dblthelpfilepacingmaxdataxfil1expttptypipesendxlg69dialswfcm_foundfilesinlistu_mazovia_ex_deregisterrttstddevxlcskdialdirz_filcountg_spmaxenvironparityzobufsizeg_protou_cp37cmdatebufm_robustfr_canadian_uiso_8859_10_ufnrpathsfspecdialspoffdblastusednwritx_koi7xpoasnnetdirshokeycodemyipaddrtx_britishtx_koi8_frst_boolssrandttspdlistzvhomeu_to_b2inibufsyl1chpushcmdmonthsbannerfilettcarrerrnolanguagentermcclsofdumprbuffntabu_wyse_gntx_hebrew7ntcshttp_postxl_txckstrpresdebutopargu_wyse_g1ttytypecmgkwflgsm_ibmu_wyse_g2cmdsquou_wyse_g3b_saveckmemcpyttfluix69lglstabgetlocalipaddrsunlinktx_8859_2tt_printdbfldy85l1ylc1251x52astx_8859_3tn_inisyscleanuprf_erraskmoretx_8859_4tx_elot927__fpstartttsndbtx_8859_5pty_cleanupzoutcntbrstriptputstx_8859_6ttfluoyl1dgaddcmdd_nameno_delaytx_8859_7_frst_tblstrsendbufbldlentx_8859_8ptyibuf2newwinpflagcp437_utx_8859_9gftimersetxlatypetgetentxitstagetpgrpkstartactiveversioxiniopthlpgetegidyl1dmnetdirrsetcarrctlfilenextcsetsinitednmdmcapttfluxnifpcloseendusershellg_rfilterhttp_nowu_heath19gxl1aqputenven_getxl1assw_armedyl1duinet_ntoattyfdle_initcmfsavnzrtolcmifipdologlinersrtabu_portuguesezvpassgetptyslavexgnbytexgel1vwprintwutimexlhh7xgel2cmgbrkchktoknsyslogPRINTCMDiks_retryaddmmacdocmdunkcsfreedfflowxpnbytenyesnotelopt_modesdoenableterm_parm_errdef_shell_modeacknzofblockagnbyteyl1fcxhuasck_s_whog_fncnvcksysloggetsocknamefilrejmdmcapdialtmomodemmsgcmargbufyl1fixl1chswiss_u_frst_numskeepclosettwaitu_snifacetsetuptermautodlscreencfdisplausepipesrecvbuf_lxstatrdebukstartuservtn_auth_howttgmdmypol1localtailsj_to_eug_binarynlangsyl1frxl9asreparsg_pflgsndtypconincmkrbufanonrootxacasx85l1__longdouble_usedyl1gex85l2tx_hungarian_timezoneen_byefailicpulongtohexdumpsbufsetmodemz_getposaa_dimstptrapconxozchoutxl1dggetdnumchkaesmyhostrprintfun_to_sjdldirx_acctevalbufu_cp1250en_senclosedirxargtabu_cp1251tx_spanishprintpipedialhupu_cp1252spsizfcdmsgu_cp1253xl1dmrcflagu_cp1254x62assetoncm_retryu_koi7u_cp1255remonlycxtypedialmhutcp_addressu_koi8u_cp1256tcp_incomingen_setmaxsizey52l2u_cp1257u_hz1500rctsxy62h7pktopnnewterm32u_icelandicu_cp1258xreliabledialpxiptabconintcmdate2tmfixcmdopentvtflgfpxl1duxl_fcuxl1h7xl1egreadbufz_flushspsizrzchdirdbgtabdialpxowyse_g1_ufastack_chkinputncdtabopenanlssavkeysclstabopencwdottabmdmvoltn_termhconnecctrapcmkey2ifdatabnumcodesyl1l2dialpxxhmtoplineprmbufswedish_uclienthostxl1fcxlhl1netxinz_execopeniyl1huxif_defwhyclosedtstatsdoincrrlntx_mazoviaatlpristrcmpsystemttincfcsinfoxl1fitimintignflagopenoinitmdmsetpurgoptsz_getmodetx_cp1250zshcmdfgetsxl9dmtrafilwrefreshtx_cp1251mintimeinitflowqbufnnmstx_cp1252sprmlensnifacet_utx_cp1253tcgetattratlproqbufptx_cp1254getreasonopentyhul1xasacusermdmdialrstrtx_cp1255filetailtn_msgtx_cp1256ttinlxpol1tx_cp1257bigbufpxl1frtx_cp1258uidbufSPACM2yl1itshoattcur_boolsxl1gedialini2__majorz_seekDIRCM2mdmsavtn_waitttsetflowhmsgsetdelopts_mbvalidcmresultcwdfacs32mapdocrco_isopennettoutctermidgettimeofdaymksbufdialidtshoflowsndtypex52l1savbufdialvol1shofeanh_p2zsattrautodownx52l2tn_b_xferdialvol2_PROCEDURE_LINKAGE_TABLE__edatadialvol3tcpoptshoxmshoparpmacpftruncatefopenreadtextiso_8859_3_ufilestatusSPACMDcmpeekntnoptswxmitabpeeripoutchcountmemsetttprtyckmaxfilesinitgroupsdocdnnetssys_nerrhttp_deleteen_whomacxinserverstreamrqDIRCMDdelwincmlistscmdnewstxtnotfrench_utn_b_umetimerhxl_utc_do_slk_refautopar_mbtruefcntlnlngxl1l2setsriso_8859_7_unsrtabck_curposiks_timofloatvalrestorsigsxl1hushoparcu_danishcklowertlogfmtfreerbufcmdtabmyindexstayflgchkspktxl21250cmsetuprseqtbldfpromis_hayeshispdtx_dgimaxspsccpinptabck_l_veryskcymjd2datew32addchexecvpndial_mshoparlshowpurgoptssnd_movezltortrtrapzoutptrasctimexhul1slotstatematchdotccustrcpyxhul2ifcpdodofailcmdfileinautodldialmaxnlogis_suprahowcalledxl1ittelcmdsxascyu_nextstepcmkeyxlogwtmpndestsmvcurxskasdopars_csetxr8asg_recursivenettoccmdsrcnxlrsetlindogtainit_acsxfrasnxlscmddepipaddrrptdialudtsl_uidbufcp1257_udocleanascii_urqfcp850_utcs_transptn_pr_uidstdscrxl9l2dodefsrvcdmsguucplockdirdialpaceshonetg_spathyaclccmgetcmddoinputtflinenettol_etextxash7xasegdoconx_lib_versionopathkillyl1neslc_namescurses_versionresendcmdirlpdodelfflushzzndateshostrdef_makenewquietarg_xdontrouteck_l_xvernunamenxtpktnackdialvlitcmdtgetflagsbufnuminputtx_danishxflgcp1253_uck_s_namex62l1dostattn_sndlocu_smileyopktheadyl1nonmacdosortbinarytyp_mtchstcs_savenetclosy62lhwmovetx_cp862ftpoptsylh62tx_cp864initprotoconbgtgetrttrtimottpushbacknh_pxtx_cp866memcmpseslogdoinitdocmdfilettnprotogetusershellyl1r8xl1lgparsevarwaddstrchrootputfilfcstabxl1lhcmswimsen_cpyincounttx_cp869tt_bellrftimerttruncmdxl11250shofilhproman8_ulf_optsinitcsetsrparcp858_ushoverxskcywinchhtx_cp850_ctypefailtakeinidbchrzoutbufferzsoutlnmcmdstkhttp_dateu_hpmathtx_cp852isabsolutesetprefixucsbomyl143u_cp437german_unhshdialinidocopyres_searchfreesbufxswasxxescalrm_executetx_cp855_outchrsnx43asdbflagsshowpktbritish_utx_cp856hshtabntnz_outtx_cp857setflowchartostrgetgidtx_cp858arrayitoaRENCMDdohrmtg_spsizrdoreturnmaclvlurserverstatetx_jis0201kzsoutxyl1podclarraynfbtypu_frenchconbingnf_binarydialintmainconresdir_headtt_escapexfermodestathackckdelayrcvexceptg_rpathhtonslscapbpexitstatxaclcwartvsyslogxask8zzstringxl1neyr8l1ppvnambufttfdflgcmdgetcnprmdebfilrcvtimoyfrl1tthangrrttbldoifccntabxl1mzm_argCOLOR_PAIRSreadlinkntollfreenvbckmkdircmfdbibkupnumx_loginen_spaxargv0u_hebrew7g_spsizfpkttimxl1nomakestrsndbeforeiks_waitshowdeloptsc_savedeltabpty_open_slaveinterruptedyl2asgetslotlogtablscaprsysindexx62lhtfilefbufsipktxlh62lscapuchkintm_fatntrmtn_snenvlogintimodfprtyWHOCMDisdirsetnprotottnetxl1r8ndialnexitnmdmtx_finnishfatalchmod__filbufcp864_ubctldblflagremsetatlenipwdodirdoxgetcttnamlocalnextn_nametelopt_statesmemcpytn_sb_bugbctrnsetmdmatlenoj7initapcbufcarrierdblcharifargsset_termbufbctuxl9nestrlenckstrncpymyfillbufxl143elot927_utx_jis0201rtinputfdu_spanishttrestn_nlmxdgascmdlinzgfs_dirzgfs_linkzclosesparxl9mzmdmwaitdtoktabnnabltabcmjbufzclosflinegetcmdsdatatt_crdterm_err_stringsen_delu_germancmiofiiks_tn_sb_init_costs_imageifcmdtx_swedishlinkyl1spxl1posetbellu_swedishfnsvfromgetpathyswl1ngetpathparchky43l1xl152resetcgethostnameyl185rqcrc16yl1swlocaltimexr8l1xskl2opntabsbxr8l2dialpuccremdestxfrl1b_to_uiftestmtchptrautopathasktimeruntabmbeucwrxrejectionz_openmaxdecmcs_utx_fr_canadianmdmhangu_asciisosifptsecsxaslcckxlogoutbrowsurlmxlooknpathtabztmsecremfilexl2aqctltabtn_sbdbinitedsrimsglngtabxl162xl2asu_fr_canadianen_cwddo_ptyckxpermssfilebigsbsizxlookupnfttypptyipsqtt_triggerparservarnamwaitintervalrlog_modetn_rnenvaa_ptromodeskipbupzmailxl169u_british_finipktlogfbtabnucstabsxu_decspecg_rcv_renameremcmdsndfilterhaslockwerasePWDCMDcmdgquorxxmyamodetcslrpttabtypeaheadeofmethodlogstrgtimerzopenisgetsavelslooktple_putssindofilcrctcsrxl958rltabterm_errnoexitonclosexfsecsatxbufdorenamzopenodohlprecursivefileselectinechosndxnamxbufxl1skdialixpckcdpathcmpftrtabdoreinpmyipredirswu_koi8rtn_env_sysdialixsdoupdatetopargcttopenxl1spcmpopu_koi8uifdnammyatypetlogsepxh7asxegascal_atcstabydgl1xswl1doshiftlistenx43l1varvalx43l2unhexxl185timefzofbuffertn_soptxl1swxl2dgdoshodialsendmodemacinitx_cp437fprintftlcical_jtntabdohoptsu_elot927shostackncopytabencrypt_namesbye_activemerrorchkvar_mbclrchen_dirtlcocmbptrsysconfck_znewnxopthlplongjmppsavetnopttabbigrbsizquerybuftn_env_prntxl2h7xl2egdial_mmdmspdsettrmnwfswirfilopckgetpeersetmdmdialhwfcjustonevprintfzstimeprmtabdohsetpwcrypttfnamisattyrsattrxl1ukxarghlpdohexdumpnasgtabc0pics_uxneasmdmspkckxperrorcoserrpktyl2l1updslottcp_rdnsavailtabnx_usercc_executefdflagndialpxxpktmsgbuf_xmknodcmflgsincharconnectrttdelaymdmtabhebrew7_ulibsocket.so.1libnsl.so.1libm.so.1libresolv.so.1libc.so.1..L  +܍P+T+RX+\+M`+3 d+% h+l+-p+t+x+|+++++N+& ++1+(+H ++++: + +++<+v++++ +8 +++++++N++,, , ,,D,,b, , $,(,,,0,`4, 8,V <,@,D,mH,L,P,T,h X,\,v`, d,wh,ql,p,t,x,J|,,, ,, ,,,(,, ,,@ ,,,,,,,,,{,s,,,,,U,,,,,l,-h--r -|-Z--/- -w $-(-,-0-4-8-b<-@-oD-H-8L-P- T-/ X-\-`-Ad-h- l-p-:t-\x-|-j- -~---6--*-@-= -c ----- --i-g-m --^------ 5H+%L+%P+h%T+h%X+h%\+h%`+h p%d+h(`%h+h0P%l+h8@%p+h@0%t+hH %x+hP%|+hX%+h`%+hh%+hp%+hx%+h%+h%+h%+h%+hp%+h`%+hP%+h@%+h0%+h %+h%+h%+h%+h%+h%+h%+h%+h%+h%+h%+h p%+h(`%+h0P%+h8@%+h@0%+hH %+hP%+hX%,h`%,hh%,hp% ,hx%,h%,h%,h%,h% ,hp%$,h`%(,hP%,,h@%0,h0%4,h %8,h%<,h%@,h%D,h%H,h%L,h%P,h%T,h%X,h%\,h%`,h p%d,h(`%h,h0P%l,h8@%p,h@0%t,hH %x,hP%|,hX%,h`%,hh%,hp%,hx%,h%,h%,h%,h%,hp%,h`%,hP%,h@%,h0%,h %,h%,h%,h%,h%,h%,h%,h%,h%,h%,h%,h p%,h(`%,h0P%,h8@%,h@0%,hH %,hP%,hX%-h`%-hh%-hp% -hx%-h%-h%-h%-h% -hp%$-h`%(-hP%,-h@%0-h0%4-h %8-h%<-h%@-h%D-h%H-h%L-h%P-h%T-h%X-h%\-h%`-h p%d-h(`%h-h0P%l-h8@%p-h@0%t-hH %x-hP%|-hX%-h`%-hh%-hp%-hx%-h%-h%-h%-h%-hp%-h`%-hP%-h@%-h0%-h %-h%-h%-h%-h%-h%-h%-h%-h%-h%-h%-h p%-h(`jjR-th}ETLRU RPuL  PrjUWVSE#udV?M40+;=PP}&VM.#tG;=PP|[^_ÐUWVu#t,+;=PP}"VM#tG;=PP|޸^_ÐUWV+}#t?u+?W$WhhVjsu+EE#t 8uE]#t;u+ۋE E#t 8uEE$E#t 8uEEE#t 8uEE,KD=~GD=~GD=~iGPhVhVjæ=Gt5GGGPhVhVj薦,K,KD=~0GD=~0KE=~@KE=~KE=~K E=~KWEPV,KEPu,KEPu,KEPS,K EPu,K$EPwu,K(EPV[^_ÐUV++ɉ XP \Q@=@|+4`RXPP<`RtF@|+4tT\QP 5 5 9 5 6? 5 : 5 *< J uh\h\jb-jh\h\j3諓hh$$SE 5@h@h\j=@tjhhS @5Juh\h\j趓b}gkLLPh\h\j耓L#t j!&e#}贐5Lƀ=Lt6=KtJPy譒hhSM L#u= Lu =Lt=\Iu5{uVH<}uF^ÐUWVSEEj}Wh8hj'#tWV#u"E uFVdE#tWuq}WEW<{tgFV(E#tGWu5} #t PcE"VuP uuh\hj^}Q[^_+E+"U9U]MMMMMO<\uPE EF}+}+EE#tF";]|<{u}t<}u}uM}uSuhHhj蒌E #t P[FVM #tVuP C< `G< tT]EE ]MME8E;E} #t PFVuM#fUWVS+ۋ}u ;t4#u5#t PVSE#t Pv[^_VE#|ڋE@P#uE}~$jVP hEPE jVP jVhxhj%wUE #t Pu)UWVS+u #thM#ta]#~Z;tV+#};}SI#t7+;} ЊB;|#t +;} ЊB;|#t Ql[^_UWVSM#t-u#u5h} #u=h"u"t +[^_Ð"tI#tMEFG}t"t׃}u0Et PEt P8]r8]wEM#t롐UWVS+u#u5h} #u =hE EEFEG"t;}t5t P;Et P#E:]tE[^_UdWVSEEE%EE%E̋}#u=h?u #u 5hE hjVhhjۈuWhhjȈ}<..=TI{[jVhhjx+ "u+[^_ÐE؉EЋEMЍL1M MЋ}GPE;EG}ut P:]uE@E EGEE"tc}u0t PEt PEă}tKE8]fMMMMMu떐" *\+}t?uG8]G[+۹W+_+pu#t+s}ut P"m-u~;uv N+ɊF<]u+"u:w.Ƅ :v ƄF#oEĀE@E EX\t]t뼀{+ɋG"t<{uA<}uI|C"u#EE"tCP/+E+FVX#MЉM؉}MMMM]ԋMMEVuu0 +}}$EEG G}+GF}tEG"u<\t"t<,u"uEE8uEtEiEEEDP#truSE@PS[EuuuSES}M}[}-E؉EЋ}EZuFPuS#I+G*#?*uG?*t}+]Ȋ"t&dS#u=iWlEPWh ij}E8uW&#juh4i#juhHijuh\ijVhpijAWShij6PShij+jShijV4h,jj~jSh@jjv~+4*VjhjjU~jShXjjC~[^_ËE8tuWQ#:E8tuW5#*>tVW#}} ~GS臌Vhihij}#E~;E =~;}$tj5@Shi5#+},#E(;#j5@SP#F#;u(|UWVSE+ۋM $}}$U<+uBU<-u E됐< t<0uBU< t<0t"tHM ut Pz<0|U<9Q] #|F"u#u2xj+pj }t-H@[^_ȉu+};E#u:+Ƃ!00Ӌ+؈!@;|Ӌи+![^_Ð߁ |ĺ7ULWVS+EE]#uj;t} }+ [^_Ã?~?WS]S D=E"tՋMM]G=0t= u}u _Et P^=0|=9 =Am=FbCS% "uFUu=Uu)Uu uj0 Uu uj( Uu uj Uuu uj UVuV#~M 8Lt H#+D^ÐUfjh1ÐUjh1UÐUWVhjVh,tjt#tZV#~KhyjVh@tjt#t&Vh#~=JJ +^_ÐUWV+++W81+_=q=q=q^_ÐUÐUV+ qq;t+ %+VhTthhtjt^ÐUqq+ %+=ujhtthtjs2BqE81u qq+ÐUWVS++ۍtu VuP#z ;}}PPC;|Whthtj,s[^_ÐUWVS+5t]SE$SVy "tPF"t#t[^_ÐUV+ qu+; qt?81 qƁ81A quq; quq@^ÐUV=Ju.EPhhTj Vhthtj=r#}QwJɉ JPhthtj r5Jhthtjq-fEf#t fMf#ujhuhujq^ÐUtqjh0uh4ujqjhHuhLuj~qjh`uhdujhqjjDoÐUjjqjj qjjqjjqÐU5qjľ5qj 贾5qj褾5qj蔾ÐUWVSjhxuh|ujpe`#tUfthh@efthh@efth$h@kej]jjh/jjjq+=u@ qjhuhujoFjhuhujoq$#tjhuhujoq5qjdjr<^UjjI!jjjF xq+j襻#tjjj-j}#ujo#ujWhuj o5Xp#thWV Xp"uV޼Xp"uh58pVQ jhvhvjnjVh0vjn!j蚼qVr=WP$kS WV5,mV WPh0n WP=4oW =tKtLjShDvjmjVh`vjmjh0nh|vjmjWhvjm@5@=JushH=jVhvjm#u!hPjVhvjhm#ujVhvjKm#t j@WV jVhwj)mh\踺#tj?Wh hd蕺#tj?Who hlr#tj?WhL hxO#tj?WhL) hh8'h#t&V諸@P-#t VPhYP5TV SVd##T/UƇT/ƇU S/ujVh(wjkL+[^_ÐUxq=~ Pjj藹 q#t j Pù+U@WVS5qh@whDwjk}WuhXwjjk5qhpwhtwjPkM 1hwhwj7kjhwhwj!kjhwhwj kjhwhwjjjhwhwjjdq+q=q~Sjuhxjjj/Sh(xjjhSu貸 #c5qL 5pI5q5q#w=hq߉}5|qrWuhjhlxhpxjhxhxjg뺃 =Luh1@#uh1/#thv^tq=#um5151Ҵj5 15 1贴j51Դ51薴u˴jѴ5 1s51e1010hP裴q#WhMMtAMu"u^uqPuhxjehuh/ =q(M r#5rhH,j؍5q5qjs#tje#uEuƣ|qPhxhxjd=hqE r5s}Whxhxjd#h,joqWQEPh yhyj}dh1<#t su qUuh yh,yj4d5qh8yhL#}Hh/hQ=tKt-5lhP5lhX~h\~jaZ=qpIjhp~ht~j;Z[^_Ð5q=Jt l[ jh[ }Qt =q=q~x50'50=0=0j5qͧ]E죠SwE;qt=tE#uEΉ5q5rpI=q=q=r=rt1jh|h|jY #thlh@N=q~ojh|h|jXjj5q誦 Pj5q藦 E؃=tKt&u!hOP$h}h}jXu5s=r h4,j)qj EPhD}hH}j6Xh1 s#}5lQ$hX}jW s4sh_N sUWVS=q| =r}}+qi" #|Yjh~h~jW;15lhhjUWVj5q [^_Ð=qtj#}l=qtj\=rIEjh~h~jVuVht5qy =~Sjh~h~jVh3:4$ht5q< =5lh~h~5lh~hjIVjhh j.VPrShT5qУ #jj5q֣ #yf=Trf%Ph8h<jUjhLhPjU Pj5q| fTr jhphtjUjhT5q( #}5lhhjNUjhhj8Ujhnt5qߢ #}5lhhjUShT5q譢 #zh,|8jhhjTjh/EPjh$h(jTf=TrShT5q9 #fVj5q; #UV=q}'q++=qu=ru҃=qu݃=qujhDhHjShrhT5q腡 VhXh\jS#}5lhlhpjSqVhhjuS^ÐUWVSuV%Whhj=SlShhjS;ul*jW5lhЀhԀjRShhjR#}d=lu[WVhjR=tquWVhI BV{!CWVh jgR~+[^_Ð=tquVIU(WVSj}Wh4jR#th?tcTBW`BVh@hDjQ#|50!BjWݠsBWhThXjQ#N?EEPh0EP誠 WџuhhjnQE[^_ÐE~+VEPWp VEPhhj.Q#}mu3jEPW? VhhjPe6XjEPW VhhjP} ]%EډEUXWVSs sr_Ej/}W#lPW_#oE.h5.VWg SWhjP~ ƃ. EuVhjO}t-j/VL#t@ƣsjPhjOujPujPljPh88V՛Vh́hP= sW軛uVhjFO}t`tWVh́h\5rVyjVh0j OWV-#ujh@hDjNruh́hhV jWh\jNjVhpjN>h$V#5lVhjmN=luh́ FhxD =Ku h́EV$>B\>PjhhjM> +[^_ÐuhP j PS& u􍅨PhjMSԛh$V=sREEh sV#s#}t=rthrh s贜jj5q貜 #tM55lVSjLG}3=l u*j臜jj5qe #usQ5܂h s蔛؃}t=rt hrvSh sVjiLs+#t&6<h s#!}<s#uG=V<=s!UWVS5s= sWhjK=s4= s'Wz蔚;t(VWhjKVWh B ;l+WaSWh8jRK#}-=lt=Ku h/BWhA5s s=rt`5l5rVWVhLjJ#}-=lt=Ku h/tBVh6Arjj5qE =;+[^_ÐUWV+=qu =q+jhdhhjMJf%5VXW5q PhhjJjhhjIf%VW5q街 Vhȃh̃jI^_ } VE=jhhjI=WhX5q7 Vh hjdI~ WhX5q Vh$h(j-IZ=Njh@hDjI=WhX5q訖 =f%WhX5q耖 UWVS=q+5lhąhȅjyHf,rjh0h4jNH r5r6r#u1rljhhjHVhT5q跕 #`qjhhjG+[^_Ð]Sh`hdjGu VhthxjG}WhhjG`q=q#tdq#t+ qPhhj:G5rhhj G=rv=qi=q\=qt5q.#=t t5q=r ǙWhȄh̄jFW$hhjFt#lq=t=u=hqt+P5(rVA4q5(r Jf(ruFf%f(rVj f%f(rVjQnf(r/f%f rff #t tttt rf.rfʀf.rf% f(rf%*rf,rf%Ћfϰff˰Nj=J## JuGff,rjhhf,rjhhjEf,r=JtЋȀff ,rewmu-jhxh|tf,rjhThXYotstɋ rSf%f,rCUWV=q}Whhj]D=q=quw5(rt tu/VjWf%(r/f%(rVjj}u )r㐐#tVhT5q藑 #}+^_ÐUWVS5qhhjC5qh,h0jCuVh@hDjrC} WhThXjZCdq q#} #}=qu =qt5+,#qjhhhljB+[^_Ã=ruЃ=qt+;5qu#;=qu r9lqujhh벃=qtQ#ujhhĆjhhj}B=rtQ ƙPt%lq=t=u=hqt +PrIrJrShT5q蓍 #5q=qqjh(h,jUWVS}Wh<h@j}?5qhPhTjc?5rhdhhjI?=q|(=rt=ru=qu =q5+(jhhj>Sh|hj>Vhhj>#t}xt=PrWhT5qG Shhjt>#|fTrf%f fTrf@rf%f f@rf,rf%f f,rfrf%f frWhT5qɋ VhЈhԈj=#[^_Ð#+u=<t`=vE+$<~ r f=xt=t=k B 7E #  =|t=xt=t=t=UWVSrr=qqVhhjq<r=q[^_ÐUWV+Ҹ@+ʍ<--2-K-n----,-X...`  ..%.K.--^_ÐUV=rC=q6=q)5qhhjN;q# fhrf%VhhfTrf%Vhxh|j;Vhhj:+|2uKmne^UM,EX>5-` %%K $VhhjF:^hPrhTP Vh4h8j :5lhThXj9#몐UV+=q|#~t^UWVu Vhĉhȉj9=tuE=|85th؉h܉jn9=t~FPՅt#u5'=)VuW0 5tt+^_Ð5t=)WP t t븐UWVl+t=tKt#~Phhj8t# t=tKtPh$h(j8t#5tt5lh<h@jU8r#t9=u0 l#t&teQhThXj8jD#u<=rt3 l#t)t$Qhphtj7j#}Ht5t)^_ÐUV=qt505qljhhjl7hh)V腆 VhhjB75lqh؊h܊j(75lhhj7} ^ÐUVS]3r#t=rt =t#=,jh h$j6hd5JPw Vh@hHjo6 $''jJ+sJ+cZ'jhdhhj57jhhj5Y' +[^Ð=St=Lt =Jt=PuӃ=Lt땐'jD=Jt=Kujj23또UVr#t=rt =t #u=,t+5thhj4#tLt#~MHt#} t@t)WVhxjc*}#!u+Phhj4*Wuuy ;#},5lhhj)l= >Vh؏h܏j)u+#~ j c #K#`tUVq#=qt 0EEh,j:wqjxE#}Eh1xu##~ Vw=ru:EPhhj)q=uPhhj(^cVw5lhhj(,jEPux E=|V:w+^ÐU\WVSE+}}}E=q}p:jhdhhj%(uh@hLj'pI~ju h(h,j']Sh<h@j'=qt0qE؋E#}}#t5h,j9uqSvEPhPhTjG'h1v#}Љ}̋EPhxh|j'=`qtEuȋƣdq=qtEEĉE}EEPhhj&E H;-E]lt~]Shhjm&tHt#} \Et@t)]]#=tKt/Shhj&5lhؐhܐj%=lu:#~6Vhhj%Shlhpj%]jhh(j%pIjREc]u=rt:tuWr#t=rt =t #u8=,t/SE#uHE= t]=r=G# dqG;MAM; G}t G= }@Ph( h4APShj0$}tuPShj$[^_ÐE}u#ME;E}dq#È7Fu}G$E=EPhh5E @+ȊG$DEEPhhjA#.G$Eu}t݃u}tu#D7E#=?}tEH;~M#tӁ;t;u#]B]+=tKM;MPh̑hБjx"Vhhjc"=t~jEEj5E;Et"Phh j,"=t1ȉ tPhhjuh h$j!3=q`q#VuS; E`q#~bPh8h<j!jShTj!dq};} $@E;|jShlja!`q =`qljE=q}t<#EU0WVS+uE5t=quPhhj qqHEPhhj ]"ShȒh̒j jQ#dqr#t=rt =t #u=,tEu}q#%=qtEP##8=qt0qE]t#~#~\Ht#} t@t)EE؃=qt#~# #[^_Ðh,j(mqS nEh1 n#tETۉ]Lt@t)E؉EShhj]#}EEV}#~6u+}}#}u܋#tWhhjWDm=rtu5rl}tHt#%<-UWVS5qhhj =q|'=qu =qt=jB'hH{+[^_=ruNju|ǁVh,h0jƙ+;}TjS5qk #|G;|듐UhÐUhÐUWVShj]Sj M tE 0+0lh0jjShl l#}#Qh@hDj+>5Qh\h`j#tVhphtjq#u+[^_ÐUWVuVhhjF#~"|'ƙPk } +zrVhhjh0=0Wk#|0+ƍ0WjjjjkPhhj+^_ÐUjkqUVjuk+5qVhԓhؓj\#}+^ÐUjh)%kUhVjEPkM+ )E+)#}I@BEE5dME]lUv]؃=tKt)uuh\uVgjVhjE^ÐUVhIdIh050Vdj=~C0dIhIV]j$ejM5dIPhj.^UWV=tquj_f#u,r+=rjhhjjhth#}+hdrTVWUg #|hrVWBg #|hxrVW/g #|#~ Wgr^_UV5rh,h0j15tqh@hDjr=}=tqu r=||5qhXh\j5qhlhpjjdVhhj#t#5PKhhj~=tqt +E0qrPhhj=frf% frfrf% frrPh̔hДjr0rrrhrhTje Vhhj^ÐUjc#u+bjhhjwE0qf%~rf xrff xrf%zrrrrrhxrhTjd ÐU5rhhj=r|j'c#u+Jjh$h(jqjh<h@jhdrhTjEd U=Jt=KuEPjEPje ÐUME =Jt=Ku QPV QPje ÐUVu#u5\V9b=Jt=Ku PV  PVjOe ^ÐUWVSu#tW+G#u`;t==Jt =KuSa$S Sb#}+[^_ÐUWVE E E}#u=du=Jt+=Ku"W`a$WGjV<WjVjqd ^_ÐUh#uj%a#thPhlhpj=tqu =h}+ jjÐ=Jt=Ku5qjUWV+}=lJ# =Ku##=tt PhhjqqEPhhjEE=s0oE##Vhhjy5lh(h,j_u=lu =su#u =l^_Ð#t3=ru*q#=qtEP,#u#UujVj b E#t#5lhhj=l=st=tKh,jR`qV4aEVhhj`h1a#jEPjga EUElqPhDhHjlqÐUVu VhThXjMfA#t f%fA+^UVjhdhhj=ru=qu =qtH5lhhja r#t =q|Mt#t QP5qQPj^ Vhhj#yuhhj+M tt @t t t V^ÐU}u7Xh:5lh̖hЖjl*jjs^#|jhhj=+ÐUX`t^`$td` tj`(t t9 tu  t9$tu (t= tu =tu  tÐU(t=t5P`#t(<=(tt5$t_ t=t P_#u+ÐUV+= tt5t_#t=(tt5$t_#tf^ÐUÐUV;u u]^ÐUWV+x#u^; tt _; tu#u^;(tt ^;(tuz ^_ÐUtÐUj]q#tPj\qjj[ÐU WVS=qubh+Ijhhj +.%Pu\0P}t+[^_Ð=Lu\#ub#t jYj5q[j5q[uV[WVhjH #Y+W=hjjZEjjZE=,EP[SWh0j ;tu؋u}E#t PhDhHj 5hdhhj WjRZVjGZUWVS}WX=u u :u :+S\VW=! _^+ŀDOI@G G!G GD!G G!G  G !G  G !G G!+!![^_Í]S[5!} S [VW=! _^UWVSuUE =Jt 0;t[ @;tQ ;tGVPR;[ E-#t=BuƇ!Gh0Wjh![E[^_ÐVP%S[ E++S~V+;}EB%ځߍS#t"u Ƈ!SƇ!Ƈ!+@#t "uƇ!G! t#t "uƇ!G!+FG;ug u#uƇ! ƐUWVSM E=Ju;QP)Z*#t=BuƇ!Gh0Wjh!Y[^_QP%SY ++SJU+;}EB%ځߍS#t"u Ƈ!SƇ!Ƈ!+<#t "uƇ!G! t#t "uƇ!G!+FG;uk u#uƇ! ƐU 8t  PQuhÐUu ujTU ÐUu ujLU Uu ujDU Uuu uj9U UWVS=h,=luhhl{]#u} #u=u#u5p#jj 5lIV p#hjShОu5pWjShij S(Puu j WWcu hVvPNu TPVj$W5pV =$ujShjxQP#w[^_ÐUWVS=L]#u u#u5}#u=} EEjShjjVh(jjWh8jlWVShuV5lhHhLj[^_Ã} u{Uj~VPSPQ+UV5bbVhu!` b"tu5l#tP=Put ,NP=Kt bauoi=Jt ar#UE=Jt]=KuT#t=uIjM #|+0σM "PM=tȋE +=u1=IuH#| @ 띋 I #|HAHAUWVSEE+] #tu=}NAEEPh̢hТj}uEWuhjE[^_Ð]EuN#tʋEEE=@tEEEPuy#oE@M"t ;t t} u i CNGM CGN#uPUWVSE=Jt+=Ku"#t=u=}'+4uju HK[^_+;}ڋ};}ӉE] jn3F;u};|UWVl=J=K 9#|c+;}&j 1F;}|Ή  #uxI @ c\Ujhģhȣj6I @ jhh j^_Ð50hhj A =0t =uu$ψA =0t`=tW+=`GtDVhh jNV@ PVh<h@j$#5hj5MIPhThXj #@ tCjhlhpj5lhhj=l l`gjhhUWV}W=}L@+;V~C$V@ PF  u4nH^_Ðu #t>t=Jt=Ku #ttt4V;H=t+랐UVu uVD#|==Jt=Ku #t.t)u"jh@ PE +^Ph G=t߃ t u4GUVEu=Jt=Ku #t#=tVu @ PpE ;u^UVu=Jt=Ku #t_tZ ujE PA PE =u+2E PhQ =u@ t +^ÐUWVFx=tKtPhhj-x#tE#|.=Jt>=Ku5 09 u'x+x+^_Ë5#~PV@ P7D tK~0#tWhh jx+ǣx#룐#t5lh h$jaWh<h@jLUUE#|= |'=tPh\h`j+<tÐUWVSE}W@= u>hW?#u,+#(}|E[^_Ë>~uV;F#u5x>uhVVa #~=/uƄ=($,0pPV jh|hj#3%=$hSVA WVhj~W}OƇEpPVZjhhjZ#%h,S>%=Whhj #lhSVA WVhȤj#}5lhܤhj jShj~}$Ƈ,0%=@+UWVSE]#tSh=}nl5lVh(jKWVh<j-WVhlj+  uh@V<#t߀>~uVHC#u5>utPVUjhh jU#3E%=@uE}t =Ku=t =WVhXjjVvA#E hVhZa^ 5 Vhj =[^_ÐUWVSE]#S;5KShjk uhPS;#tm>~uVA#u5>uރ=Ku SF#u+GP;#u(h`h@ +[^_ÐSVq;#~|>/tO#EWhhjuhhj}tZ#~VD>"tVVE#u:V:#~|/tH#D#u"tVE#tƊ >.G>"uh|V:jV?#}5lVhХWVhjV:#UWVS}=Jt W<jWhj=L|S=LtJb5bVhW8H jVhjR#}VhVhj"> [^_Uhjju uU WVSEEE} u#u5jVh jƀ8~uPq?#u08tƅhV8#u+E}uK}uEPVhhVW`9 EVhW8 1}u}t̃}u VpC#uhVWZ EjWh4j}썝E+hhHhLj"t@MUA~"tuWu Y %hu 7ju h|j[^_ÐM "tnU;}c]}UU< ~E}uujVhjV\9#u=(?ujWh,jW8#u?=Jt/=Lt&=Jt58I58UPVB+^_ÐUju74#}+ÐUh3#u<UWV=QVhDhHjVW\7#ud^_ÐUWVS=LtnjhlhpjLE+?ę jhhj6+[^_Ë}Wu hjW#|t#tt u+Vu hj#tR#Uhu h6#6ؙxF6EP2#'2#CQ#t jj05ḩhЧj4uu2jk2jh3#jJ2u5=qj*2u5=Qu 2hL1#u7*Ph5Vhhj#t^ ;uΊ"tA=/u"ujVSjH8rju hVS 5jA/=ujhh Ph$h(ju/1ؙh ut1L=0?jj@ Pv0 Vh8h<jzfVj@ P:0 PhXh\jIUWVuVhthxjt u+Whhj<ؙtx#tt43Whhj5hhj+ęؙ#=@4hШhԨjT5ęhhj:#Phh jj 5$/}W/;t=tW/;t=uE#t Ph$h(j5h@hDj++41+ę<ؙPh`hdjD=u^_ÐUWVS]#jSh|j54hhj58hhj;~u Si2<$PWSV/N jVhju)+PhhjktV+/uh(V+$Ƅ*;v/u .t;tjVh̩jV`6WVhܩj#t*V+#~ЍJ|/t /J*jVhj =Lu/=PIt&#h*#uk+3#uh*#thQVt"  =tKt,=P1hjhQV [^_UWVSu V]Sh(j΁4ɉ 8+#t#t=4lj=8΁ <΁ @5DPh4h8jL58hLhPj25<hdhhj5@hhj5DhhjS=4=8=<=@=D[^_U #u ÐUVHu#~" H h0VJ @PVhj=@^ÐUÐU,WVSEEEE u#u 5ĪEĪV(;}#|>~ߍ{WVhȪjS(E#Vu((E++#~uE#uU<>~u/MD>EEWuhjM(><~u|>.t<0|<9tO#u#uEEV?'=}}PVhjuhh j}}E}~Euhh jh8AhVQ5 #w_V&VSh0jT?Wh8AhDj=F;E"h08AEP&jh8A+Vh8AhTjN#~0] H D8P (;~؋N#։]uFVh8u& jh8AhhY]}~ E u O=EuFVhLu% Ph8A%jh8Ahj7E 8A5}t u%[^_Ð}E+ƉEPh|hjh8APr%E+]hDEPK%jPVPhj#O#N#] H D8P&;~؋N#U WVS+u ujuhjjuh̫j=Jt =JuMVS/#EV $EV#u#D8P%$#u0"SVhjv(#t WY$E[^_ÐVW$E|/thXW#EPufuW#}juhܫ juhjuu)E#tE=L`=LSb5bVhu1 ^^Shuu1 }SVh`U$WVS]} EjVhjZjWhjH=J=JtjhhjWjVhجj;h^hbhj&jh@hDj[^_ÐhPV#jh(h,j}PWU#u6jh4h8jS9hu9xebhbhS/ #t5bjVhj^h^hu / #t=^jWhjWV #V,#W,#tPDžW ؀|/tƃ^/ƃ^CPV~^P jWhj3j5&f5%E|%I EEljjV" EPVhj}uhW" EPWh j}WVu" #~HMM}PVu" #| hVW" #܋؋EE}EE}Sh4h8j(5lhLhPj#u+}~ u9!}~ u(!u^l=uDKC;jhhhlj5lVhtj=t= t=L=L#ch^hbh^UWV5Qj}Wh`j#ujl]|SKPWj hhj#|uhV jVhj^_Ð?tx=LtPW띐UWVS5Qj}Whj\#t?u4++̭#-FjhQhܭj*Q[^_ËL#t 0#u=p#t PW PWj hhĭj#|M%V=`t =u9pEd<c4b,-%ls= t=@t?Vtr-Vtw-%@EދËW}uJ-xSSSPIsW?=g=e=bs}@t}t}@t tr-Vtw-%EދËW}u#-xS,SP"sW}t܁}t݁}ttr-Vtw-uxFTFttFUWVS  ы +#t‹uF+F=ZthZ8FPF ~ F~F~F ~$F(~,F0F4~8F<~@~D~HFL~PFT~XF\ =ZtxPhZj hhj#E%PhZhjE%PhQS SFP^T+ۋUt€t@t QQFXF\QFPNTPQh<j(vXv\hPjFddF`~hFll~pFtp Fx+[^_ÐUWVSuhthxj}}a\jhhj:.EP[#twVhhj1~VḫhЮjlVhhjG#`= U_ #YPO#QHW#I;@?#|;~+WRQS@PVh=lQW WVWh jc~}Q[^_ÐUWV}#,0|5lVhj ^PVj hdhhjWhphtj#uuhhjEP^_Ë"l<~uVB#u54>ulQ5LVh8jZ L#t ,#ux#4PV/j hDhHjWhPhT2UWVSu uVhj} t} u~ u~ :u ~:u Vh̯WVh u Vh,jVWhhjEu Vhj8u Vhj+u Vh ju Vh$j u Vh<jG E[^_Ë} WVhj+MC|} u VhjG}+>!D>|Ջ} WVhDjjh\h`jE+ L@=|} ]SWSh|jS9%+udǙ#uǙ#u+EύAA6O]􍁓d]+؍EEDEEPȃ <}Gu#;MEPBEuhThXj}Ex t EEPhhhljEx,0KBύAECe#+Eȃt tу #;E+э댐UWVSEEEjuhj} w whjG #P7jhhjjuhj+g+cuuhjuhhjE9E|ȸ(tjhhıjM[^_Pw3E#|uhܱhjw whjdPuڼ#t/jh hj5luhjnjh4h8jE+E=tKtpwPwTh@j{wXw\hTjfjwdhhjRxhLP jLPh|j 5Jhhj5`hhj=Jtp`xPhȲh̲jEf@EVhhj Vhhj{OP#~`~h$wdOP#t#}cET#}+;}"70|ҍtG@;|EVh,LPZ jLPhjf}XjShhjSfShh jG\EWh4h8jjjhLhPjTEtfjhdhhj3ftf΀ftf΀jh|hjfGAuhȳh̳j}t3Vhܳhjx% ƉxExPh4LP uLPhjguhhjPEHEDu#uh,h0jxȁ@u9PhDhHjx@xPhdhhj}t&xuBPhhj#/}DPu#5luhj UV=Jt%u uh<5YV V+^UWVS=Jt=/PShLVW jVhpjV+[^_Ðj] Sh j¿j}Wh0j譿j5Lh@j薿5LhXh\j|L5Y=Lt#U#t PSh\LSW5,hlV 9U WVSu[ 5LK D0E+H+;} ] #tQ 4HG;|5HuF E#u0"}u jk=HE[^_Ðu5Lh|u uj+hME=It/F) @ H#}XE=Z< t< uy5hMV=tcVW=4t#tM=8t#u@V @P: #hhMSB E G;}F=ItdE* @ H#}=7UWVS5@uVhj!+ۉ]hV: #u5hh@M"5XMhhĶj XM[^_Í5hMiM;/thM.jM/Sh`.jhhMh<j賺+ɋ`"t =tu =lt,}}jShj$}jShjjShjS9#W6#] }ЋMMԋMM܋MM؋MM+Ƀ8t#Gh P@P# @.A"t<.Bj@PhjBju hj'Su E/E+E=@~1#u-h^#tVPduu P U@M̉M@U "tM@A"uM@.u =<=@@#u=8u=4u =htf= hlu =tl%=@u+jWhjhWjܲ@+#~;#t7 d9*u,yu&uu h$j裲Su @P5`h`j|t'+PVh|jXuu hjCSu hj05<hhjE E#t=`@#t6#u2=h~)}u#}t=`jWhjDZ@#t=hu @E?.u/u?.u/tE8.ux/u8.ux/tEE؉E#t E%EME"tUA=/uB"uUujuW'=tKtluu h(j5hhDhHjW@PhhjӰuVhjuVhj議#u=@u E;h}<#t#u@#u }?#7#t=@N#Fu#&=hlu =tl%=@+[^_ÐUWVSu#u5} WVhjկ>#}EhlV袧=tl%=@u+jhhj胯=4t#t=8#WVhbVQ dM#t"|/tD/ dM] dM`M`M dMXM@XMPVhLj 5XMVhjԮXM[^_À>.u~/u>.u~/t\MH\M#|VEX dMD8\X;5XMVh0낐UDV=`tM5DE?DE`+) `Q#tj@05DEV ^Ð`h#t5hPV[ V2#t `9Huj@V랐##wj@PV V `#T9HKj@PhDE `*UWVS}PWhdj.?~t5,hWhE hWhF F[^_WhE#tW+;} 7/t GF;|ƆGu=Jth@?PhG#_hWhE hshF VhFGAUWV=Lu#t#}laE[#th{4$:juhthhhu4$U+^_ÍuV;tVv;uzUWVSj}Wh|jtju 6hj^jvhjJ]Shhj2l#t5q=~)jPj5qy5q;9VWl#}5lhhĻjª[^_ÐUWVS=L #5Ի耛#t jh  #uP(#tx ?uΊ"tA=/u"u!9E#t8ujhVWjPhVWj !ȉ #t+[^_Ðtjj~jjpEuVq;t=tV];t=uSj7uj*E#yqUWV+ɋu=PIt[jVE=;#t?hWr<$V%#W +^_ÊF#t<\u #u#u<*ttpjVhtj VS@P#u0WEEWE[^_ÐWVW^jWhj谦/uF"tEE/=Ju=Lu =JtmK#t=Ju 8Mu#t =JS8MF#t=Ju ,Mu#t =J,MWi#u'jWhjhWu#|EF"+5lhļhȼj襥U=Jt u,ÐUVuVhhjUjV5 #t +^ÐUWVS]#t ?tu#uD+;5lWhj+ @jPhLjۤx[^_u SVO x5|u Shj蛤?~u.WEjShjy#u;tVW*#GVx5|j5|h4j+xD;?8/H;s,UWVuV.@Pd#uhYjVW]^_UWVuWhdhtj蔣#u+H#tAPR5HD5H65H(5H5HVW=H _^7Hw HwHwHw H^_UWVS5PuVhj譢#u55Lhhj肢jhhjl=P=Lt=LtVh<j) TXhPVG#thXV5#5\hȽh̽j=\=L=LuJ#uPhh/J#uDPhJ#uPhj\ J#uPVShj2J#uPVhlj h#uh#t2jhhjߠ=L=LxhX#tijh`hdj藠TXhh&Xj@Vh +[^_jhhj.=Ltڃ=LtVU#yjhȾh̾jX #u;ujShj軟E#t1}jWh j蚟SW#t `#uՉ}jh$h(jhLjhDhHjMVWhdhhj-}u@jh|hj=L=L#pjhhjɞ=Lg=LZJ#uPVh8ajhԿhؿjq=L=L U WVSu#u5ViEPVh j>uM>jVh`j#}WjVhxjѝ+[^_Ð0I#u hPW50Ih4j蒝#tƅWhSn #t}}jShLjV#~WVSn #/ƅuhS #u*UV=L|%=Lt5Jh@hjj}5P5tVhjɜ=PthhV +PTJ^ÐU=LtO=LuF=Jt jjPd Ljhhj8ÐUWVS=P=Xu T#t#tQPhjܛ#u5X+ T#>=Ltb=LtYhjzHjhh ju="5lSh\jP-+PjjVm$}#Phл7 j WVhP"5L[^_Ë#uK#uBPV#/J9#QP#r r 2PZ=htV@Phht J#u P0htl 5Phth4j=uɔ=T8I#tSh8I =ljShDj赙S#>=lh#}5lSh|"jShjiS#}jShjjShj8 q I#}QhhjQhhjP=TJ=@KjVh0j贘j j hDhPR hVhZ Th=Lt\=LtSJ#u\VPhj.5~J#upP0h4jV5K=Jh5VhPn 0hR=Lt =Luh5hК0 VhD=MW W4$hP=HW WhКh`=IW W:Кj@Vh@ 5+=LP P T=tKQhhjޖjVhj̖jhPhj趖jShj褖j5hj荖j58Ihjv TP#t 5P$ PVjjPPh̻N j WVhPjj5PWPhh =T#u5>5U WVS=Hu!jhlhpj藕 ]#uSEPShjbx EvEvShhj7=x =uH5Ghhjj5G -Vhhjݔ~*]9vs5hhj讔Vh hj虔Ex Ev=u[^_ÐU@E+ÐUL#t5P@P} L@LELL#t Y$#u EPx}+ÐUS]Sh$h(jړ#KPj #}'(Ljh4h8j袓+[ÐUS]Shhhljv#KPj肝#}'(Ljhxh|j>+[ÐUEPÐU졐uHuMÐUWVSM u=Kt=Ju ;t=jQV8 )5lhhj豒+[^_Ðjhhj艒5u #~ҋƋ #~ȡu pH@uwG+;Gu4=Gt+@u҉G\@uw+;uD@uN%=@r=_v=?u#4@%F %= r=u #uF#uG#=LtEdh3ρ 3 D3h_F@FK#Èx@x;M|誛+#2dG=dt =MlJG#GTUSM ];uAF@Fx@x;M|*"+Phl #tSу#|` d=dtF=Ku==Mu4 h3Ё%3D3ʉ h[UWVSE++EE]E E 5+ɉ5 Qhhj螏mA <58>mA 85<+h+d}tWGTMHC92Ë*uQ3jhh j܎[^_ÐShhj躎 $t #t5$Ρ\V#t#t#u #tE} ˃} qEPQ- #uEffmÀuf@m585<{Ӂ ~ -DGV ?m+Ȉf>mP@f@m5ˀf@m&5=<u=8uؿt#Kf@mP fmf=,PhhjuVj?$#\V@mu"tVQ#\VV Am+Ȋ'uVEf>mPhhj:uf=>m9+\V>m"tVQM#\V ?mV+ȊP*#=?m+ \VPhh j躇\V>m"uMI(Jtψ5ξ#t$u-(Jƀq5΀tξ#tu3ыƂAƂ$AƂBqى5Ί>mэq5+$+;}WPf#F ;|/jhDhH+}=$?:} Ѝ#t>E @<$~ f4,F@FK#Èx@x;M}+#G=4$u =Kt%d=dt=Ku =M JG#$#p=$c=$$V=du/VS=0#&$5lhphtja +[^_Ð#K#~:u =Lt dPփ#|ËGJG#e}U= t!v6/ @ =IuޡH#}U졨v@v#uÐUV=|'U  0;u F|+^UV5Ghhj-G#}GZZPhhjG=\~ =`}\=\~=Gu\+5G=\~Vhhj~#} Vhhj~^ÐU(WVSuE+ۡK#t=Ju =x #u +Puajhhj~jhLhPj}$L+=+p+5H5ZR+HM u.+H5H#:+ E=tKtuhhj5}u{=d(=4=Lt ^=It( @ H#}#uY+5H5Vh0h4"]E袔u+5H5Vhhjs|#[^_u=8jhhhlj0|= 4=ud]=dtM=JuDE3hE%EE%D3EEh3EhK"EE 4u##t4(#~ȊAF4H4#u(=4=GEE܉]L#KG |M؋ d;|uI71PFP$hjiF;|+\}t-89WhhjhJ}t1= @8=XWh h$ =t =$88ƈ8Gj8P$h<3cn==f}\X}hta^.U4WVSuEE=KtE 5H#jhhjgYu=jhhjYg+*jh8h<j9g$L+=tKt45hhhjg5dhhjf=++5H5+H55Hh\jfb++Eܡu=T$= t= uddPhhj%fEPh4h8j f=x u= u=d(=45$$5$K#=Lt?=x u6E=uddEP=QE #=$/=x t!!P4#}lu=ujhLhPjhpht'u=jhThXjd]=u=x d=dt~=Jo=x tov@vE#=u 4vd]=uEPhhjGd 4B 46= tv#}u!#=K=4$5$$$4x?Shh'ShhShhjc#g+HPhh !Eu+HPhhj5c#a[^_Ã=IZH#| H :i.=I0H#| H h=u]=4$u =Kt5dd#t uЃE=dt=Ju S=tKtEPhphtj1b=d=JSx 4=u#Qhhja 4#t.(#~@F 4I 4#(=4u==G=E܉E̋EЉE؋Lx ##=d |Gd;|uH.]]+؍;~ ;]L |@d=dKG vYv#u u#ÉE5$$$4x?#}"3uu $LK#ÉE؃=4$t5dd#t uЃE=dt=Ju S=dGu+EEEEE# G#@"t=Ku 8EE8Eu#A G^^Z} tc=$uZ#t!!Pd#}/uuI$L=d5u)=x t#@= tv#|#K]} =Kuy=4$8==It* H H#}dSWhSWhj^==IuѡH#| @ d뮐A E \G ~Aݐ H#=K@"8Eu֍B#t==t4=Gt G qHO֍rBf=t qHMFF  FE HE$EE#=u>h؋=GG H#u#u%ENG=G GEEEpEO]jU=GG H#u#tȡGE.#t =uËG=GG=G#u#t}t }t}uEPE qHfj WhhjW#|5,Gë#}!5=xtK5x+^_ÐU+H PhhjWÐUEP<K#t"=Ktjuhj;4K#t8=Kt/=Kt  jPh j3K#t+=Kt"j@K4h8j3K#t=KtjhPhTj35@KhXh\jV+L u)#P}UV+5\5d5X5`KdKhK5|5x5`5F5F=JtLILIPhlhpjU5DG58G5@G5JWX=PWhDjJhW2#t=Ku =u#5@KWhTjIWwpjPhhjI5@Khxh|jI@K=UpPhhjiIR#h\KW)m=Kt =Ktj5\KhXj&jWhdjIj5\Kh|jHh\KWlX=Kt=KtjWhj%̍0LjWhjl%qpjhhj_HK#t7#=Kjhh#=Kpp0LShhjG=K=KjhhjjhhjGK#t8#=Kjhh j#t9=Kt0jWh4$jWhDjG#3jWhjGj5\KhjFj5phjFK=@KuI=t@ \K#t6#t'=tqu=tQjjjT7 \KhQ.#t!=tqu=tWjjj7hW]Sд =0L=KjWhjFWc#}Pjhh jE=Kt=KtjWh0j"Xc#~$=Kt=KtjWhxjw"=LthWhx hx5W3 jhxhjIEƀxhxhKUWVS5@K}WhjD50LhhjD+ۃ=0LjhhjDË #t t?u5PhhjlD0L+l=Kt =KtjPhj!xLPhkP5xLhjDVhhjC[^_á$L=tKtKPh(h,jC5(Lh<h@jCj5hPjC$L#u8D$L#u =(Lt5#u =(Lt+#uPh`hdj.C=$Lu =(Lt +PVhthxjB#}#tËL#u#tju W| L#u "5Khhj>5Khhj>5Lhhj>K=K=Lt++5h(h,jS>5Hh@hDj9>=u =Ht+ۿWhXh\j >Shlhpj=hWSVhT"u5L hV jhhj=jVhj==HDžDžh#j5HhjA=PP5H} Shj=Wh x3Slj+Qhhj<hhX5H ++jhhjqL @L P&5ud<TK `K!dKdK?Phhj<5`Kh,h0j; hShh S诈jhhj;jVhj;h覸# KK#u ==uJL#~AP# K(Kj5uVh$j1; KQh8h<j;VQ}tXF5H55HP W#5$$5$3}=KK#t.=tqu%=th5HjFj:+K#t,=tqu#=tPjjj +K#t2=tqu)=t L#uLIhLPjj*=It3K#=KjhhPjmWhS脔 #tS݅$Sh\j9=Kt=KtjShhjQShK#t&=KtjPhtjK K##=KQh|hj]=Kt)=tqu =thu5HjXj)=K/=K"jhuhj}#t$=KtjhhjTK#t+=Kt"j$$@(hj  $#K#t =Ku#=KvjI8$hT[^_ÐWVS5uh@hDj75uh\h`j7=uuu+u#t15 hphtjn7H9 m5XGhhj=75XG# =`L/Vhhj7=`Lt9H@%?+H Phhj6*;[5Hhhj6#5Hhhj6#=$L=(LG=tKtNPhThXjB65Khhhlj(65Jh|hj6G=Kt%=Ju=x u= u P\ jP؋=HHu =+#%Phhj5Shhj5S5Hhjl5WS5HjDQ#=`Lt H WhSj5#|`G;N#=`Ld+`Xjh0h4j4:0+=,G~ujhhj4+[^_Ð; tujhhjϐUWV+}#u=5HWhj/4H?tWjPjZ[P TL\LE;VED EED EWhhj&"uhhj"Shhj!#~b}];]|XWED P=HWn HPWh4j!=HtWxHPWhHj!E;]E`Ph\h`j_!` tT=Lt/t +KPhphtj#!`t=KuKxH= M=Kt =KtjQhjH#u"5H=HWhj hWl#uVjhhjl fffffffffff=TPu=Gu TP=tKt S+[^_ÐU WVSE+5$Whhj5L hhj5JhhjLI+ƅ=Jt:=Ku1=Hu(=LuKPh$h(j-5hHhLj==L uvh5M=HI5LI=$Whh\hR /hhMk=HI=|LLI=$W*=+hE0h =HI=HI+=Kt=Ktjh`hdjjhhjj j5|Hhjjh|Hۑ+Vh.B;hVh  Phhjj+[^_Ð$W==IO#=(L]}E.$Wjhhj}}$W#=|Ht0hSj a! #jShj5HIhhjHIHHI# =|H=H H##=hPS蹊 HA#u MAKA H5HISW-EEh1Sf 5HIShj!=$W~ =|Ht+5IhhjL]]I#_hr I#uL;~Hh4V‰ hhVn WVh0jIG*yhhVy jVhDjVq#u=KhVf#jVhXjVH)=DI+=TItDI=Kt DIPVk<Shhhlj4t4#L#t 9=I] I]V_=jVhj?uSVj=hSV6 ]"<~uV9l8thPV V(E=L#t 9=IjVhj/=Kt=KtjhVj=Kt!=tqu=tVjjj =K=Kh~}=Kt=KtjVhjo=Kt!=tqu=tVjjj) =K]=KPh j5K5LIV5JU)]}o$W ]$W=E5SG;=S-o#u}LIhj5K5 5hhhhxV袗(#EgUVHIKh5$/hu貅 5u5x EvKd^ÐUE=Jt 4(UV;K@Pm[RhX5TMPh@5PmVbVb@Pm^h5PmVbVvbPm=$It&=(IuhQpbVGbPmh,5HMPh Q[=Jt+xMhPPh`'h5lMPhh5,MPhh50MtPhh54MXPhsh05@Mt$hVW<{ jWhj hW)YjWh$j{ +ۉ$(,VhW&g #tjWh8j< WoXE=Lmt0PPVh5PmV`XV1XLWb#uAW7c#t4ϋEH8/u h,h4QXjWhLj DIÃ=DmtDI=Kt DIPWy- jjjPj5u5 h`hdj# = }OCWh<Q`W 5u5 vJVh|hj [^_ÉHI5KWV u=|hLQ7W땐UWVS ; }zA Pm` OAPm>QWhh\SVS[V ;|[^_Ð #H VQ-iVEVU;tjVhLjVj#jVhlj|= +^_Ð5uΈBA"uU BA"tBA"u땐UWVS}G4tWTSSWhjjVhj=t%=t|=VR0H,HVR@HV~P@"VbP@VIP@V.P@5pGPhG(G\G,$0$=$$$ @xVVOE#t EKPhhj1V]OX@+[^_Ð=w$=Jt =JuVOK#t=Ju 4M#t =Jt 4Mt|VNE=}#,>BTGVNE=-="QVbN==_LV:N#G+;='}"VD$K#t G;='|Whhj;='+EP59Vh3WVhjp#P=@Itp=/$(VnME#u E== 0GG58P5G$|=$UWVSu=,KtnVhhj] Shh j}Whh jlF;~ǙpVh4h8jE[^_ÐUWVH+5KhLhPj54hhhlj=H5HjVhj5HVI#t$hVI#thVI#uHHPhhjo=HtN=KWhhjK=Ku*Kjhhj^_Ð |$fD$f fD$l$|$l$D$T$ UJE#t-=Jt=u =Bu=Ku4=,t+?4ɀ)4$ȃetЃmt׃otڃsÐUdG#tM+ɉ  PG+ȍ  8 H +ҹ  B@|ÐUWVSdG#t=tGu?3+/WhhjVhhj[^_Ë=5,Ghhj5 hhj5HhhjlLEvH5C5Phhj$5Hhhj  Y ,G}@~ <=`Lt =HD (zWVhjW5h0jeu)Ǎ=@5DPWVjh'=etznxH=`Lt"QtTuHGhEEO QHGP#]Eh$M5Y#G*;&=Kt4=tqu+=t"ul|PjjqjT8GPh8h<j5 h`hdj5 # N+ $|1D3I  ,GEQP5D E5hhji5 hhjOuhhj8Y}tv}>=,G1Rhhj5C5  #OEh? ,0=T1 ;~/5 G;~RVQjc=tKt45,Ghhj@5hhj& G=Kt#G9=@G } =U5H;s)D7;r! H;s=mt=ot=stסH#t P+ۡG#t=uPh &؃=dG~6}Nu!} ~] K?B3M 5H}~E؋+$t #u=tKt @]血#t EPhhjR+5HWhء#5Hh0h4jShDhHj#=KtS}N=tqu=th`jjjl,LjPh 5H&L ]H#u83ׁ3D3FI#Vhhj^_ÐUWV5Hhhjp5 hhjVH@%?+Vh hj(=`LuT5,G5 V*4 Whh j#t0%Ph4h8j5H+^_V/#}ɐUhT5 UWVS 5H55HjEjPW5HNB =K5K5lU50LUY=K`L#tlGdG`L+ҋ Jl=Lt = LV,G=#BEEPhthxj=Kt%=tqu=thjjjE]蝷]E(ztEe0$ dGdG=} 55dGj2! ءKTtBzt=#t+=tqu"=th5PjTK#t-=tqu$=thjjj J J} =G'#RQPjWn#} #|+[^_#EE=H~xje#5Hh@uV$ EPH MP$#VP0G=u=}=Hj#5HhHuV EPsH MP#VVPG=u=Ex}5MءG;]j># CP(#FȍAQ^~#_Ù A QA 5MPG=ExPr4#5K#t%H H#RQPjH#t5H55HjV#tJR5H55HPzUWVS] uNjh(h4jJ= t =t#u!oH< ujh@hLjL:H=J u XPh\h`jXjhhjjhhj=X s @X+ʃ^}X:oH+#PhphtjVX@X5+΃^U@XVSVhj=X#tuSVhj+[^_#tU=JuLM"tE#u:u7@8u(jhhj+áUV=Mu= "u =P=xKuV^#tWjhhjhP5 :hlQ}:zV"#tk#}J L,K=wˋ $th뮐h릐h랐h 떐hL LhX5 u^ÐUWVS}#ttWxȃ|dFH;uUF#|EF u<FStIu/P;|(tEQGWcM;t +ESt[^_ÐU@WVSEE5Hh0h4j~膧#*zu$,L5DMh| h j2#t)=tqu =th 5HjTjŵjh jjr =Ju j3Tuh| h jujh 5j# e;Sh h jrucjh 5jrx Qu4jh jjrM =Kt)=tqu =th 5Hj%j軴Q=EE(M܉|(UT(T K#tU+ҡ#t=u}Dt =HDu+#t)#t%=tqu#tu5EPjE[^_ÐE#E+EE܋ (+Eأ=Jt JoHj=WhDj" +ۈGAC"uSHP5T 5JhThXjtVhphtj_~95JtJ5JdG=tKtVPhhj5hhj5`Lhhj蠦]dG #t =`Lt!#tQhhj55JHPSQ(M܋DHP5؋ J#t!st`q#t;t JJ=tKtCSh h j&]Ee Ph h j#Sh0 h4 ju}Cg5LhL hP j5DMhd hh M==1h M ME; H-=V (MD=dG h=UWVS=Kj{#} u]#}"<RShV!<RWShVV$Vj! #|8Eu#u VvPVj #|jh j #} K[^_ÐU 5h h j5L h h$ jɶ=L u9\K Ph8 h< j薶lK\KAlKlKћr lKPhP hT j7`5lK]EUv wEPU K#t%=Ktjhh hl j謒 K#t=Ktjuhp j腒L = K=#t*=Kt!+Ph h j< K#t)=Kt 5`h h j K#t)=Kt 5xh h j K#t1=Kt(5|h h j赑L  KL +=u~#t/=Kt&Phhjh K#=Ktz5h<h@EPhhj" KC#t/=Kt&lKPh`hdj K#t =Ku#t=Ktjhhj贐ÐU 艘]E%dKћr d]Ev ÐU`d`=tKtFPhhj5Jhhjj5Hhj=0LuQ=$LuH=(Lu?=Jt6H8u,=Kt#=Kt5dhhjsÐ |$fD$f fD$l$|$l$D$T$ UWVS} #u=uVWhj.?ur#u Ph5xV\ E064Ph5xV5 E0}tVhD[^_ÐWfhWW# W#~,/t"Ƅ/ƄjWhj^}t-hjjSW/jWhj+jWhj#uW`  Wb Sh h$ju#@#}W}t Wo}PWh5xV #Wh(5xV E0#uhxhW0 #tExU0GhZ#jhb GD=^~ ^ȉ GPhLhXjjÐUWVS}Whdhhj辯u Vhxh|j覯PP$#u(h$#uhH$++$+\A |(#u(h(#uh(+(+\A |=HuFdPYH#<#tP<>Et>(Vhhj薮Vhhj聮V<#uDލ5SVh jV+؁rFS<#tƋVh@hDj}ƙ#}WG4 < ,PhXh\jɭ+58=<=0Vhphtj蝭+[^_ÐUWVSuVhhju} Whhj]j hhjG } [^_Ð;|ǙȋE+;}ߋu++ڍK{ C C{B;U|몐UWVSXG+5$5,54]S#}FWhhj茬%+ҋƹ +W<XG5PG_[^_ÐWhhjF+ 4@=@|UWVSTG+5(5058}Wg#}Vhh jܫSVh(h,j«+Ҹ@+Whj-#hj#+ۍ5p;,G+$t8t8t8t8 t8484Sh8V(Vj#$D8#tCP# X=H~ P$t8QVyhViVj薭#|6C;,G75 5XGhV3Vj`#} tK+[^_hh뚐UWVS=tKhjͭ#h j趭#+=p;5,G+(tttt t44 VhWz(Wj觬#(47=H~ HPP(4hW*WjW#|6F;5,GX5 5TGhWWj!#} tK+[^_ÐUWVSE+ۋu VhThXjM#uf=v#t`+_=vf#vhpw0Vhhhlj#5vh|hjע L#t  pw w!#}YLH0u5Hhj肢5H5HP5HjA衾+[^_Ð+=HHEf=vuow9v|Z H.w HA+;w}w H1FB;w|CEfEvE=K @H#Ef=vv+=H2"΍qHA#t"2"H2BqH28q*2#H0AqH0MqH0JqCEfEv @HE#tu#uqE*E f=vuY$#Pv+=|*H0*FH0!FH0AFCfvECEfEv}t =L:=w-= Ht~=LuuEf=vud |w#~Zv+֍A;|HH0#FA H2F+;}w=H7FB;|CEfEvE0H#f=vuv5pwhHD0P HD0Pȋ=v+AH;|$2!A HD2t1Cfv 2E0H#txf=vun5whHD0P HD0PVȋ=v+AH;|!21A HD2t1Cfv2E=XHt~E f=vum w#~c=LuZv+֍A;|HH0,FA H2F+;}w=H7FB;|CEfEvE=`Ht{E f=vuj w#~`=LuWv+֍A;|EH0-FA H2F+;}w=H7FB;|CEfEvE=8H@#t|f=vur=LuiPhHD0P HD0Pȋ=v+AH;|!2(A HD2t1Cfv2E=du =,Z=(HE f=vh 5 v+΍xH;|m2+F!H2ƍpH=dt 2P2M+Ҡ "t H1FB "uCEfEv2E=KuEf=vu;v+=|*H0+FH0!FH0RFCfvEVhhj Shhjuhhj}t#u?f=vu5v+=|'H0@FH0 FH0Cfv#5@D$#u=W#v+֍A;HE2FA!H2FH0CF+;M H1GFB;U|hU=u<G?H3;vލE@Nu ÐUWVS}PWhj肚M A4$[@$$PhhjM5$$hhj3$=0$u>=~7= 0 #~%0 $$Qhhj$5$$PPT&@KDK@K E @dLxX`M AtYpE @TpxXPE HXjhhj5sKjhhj+y+;DGC;(|www+;}wGC;} |ƃwM AlYh=wA w"t M w"Jt ?#u(hQ#uh c+;} GC;}|;}+=LH+;}DGC;}(|D;}+EPM AxPEPh,j TH+;}pxGC;}|ƃpx;}+#rR$D \Hx++;}#uxGC;|x#tM A\x":+8EG"@u ]EEEEEEFx=,H=~jPu4#uUE1E=̍u>=Kt5=Kt,jh<h@ jh\h`jjFxMFxE~> Qu#uE!E=̍uʃ=Kt=Kt=~LI" LILI=tKt$Ph$}W jWhxjd#uEXxE}RShhj4=Kt,jh,hXx 5KhXxhL+0L5h4=ZxW5 Xx1W YxShXxhj誌#u"=0Ltjh<hXx džXxhXx#}10LYxDK=t@KDKShXxhj[^_ÐUWV}GxGGGG GDG@GLGHGdG`GtGpGGG GG(G$G0G,G4G<G8+p#upjPh j7pGT5p]؉GPG\ wXGl$whLJ(+^_ÐUV=tKjuh,jʊu 6hPhTj豊vvhdj蜊v vhtj臊vvhjrvv hj]v$v(hjHv,v0hj3v4hhjv8v~uV8thPV =Lt-=,Mu$EPVuV#uuu VW-|#jVh jVh!jUWV+=`=djuh!j{Vh !h$!jE~#|=K+^_ÐU+`d5LIh4!h8!j}=Kt)=tqu =thL!5LIjjnUWVS+5 hP!hT!j}+ۃ= =x tx  jt~=tKWhh!hl!j<}5h|!h!j"}5Hh!h!j}5LIh!h!j|5dh!h!j|5$Lh!h!j|5(Lh!h!j|5(Lh!h"j|$L#u =(L=l=Kt%=tqu=th"jjjl=K=Kh"5@huVY Vh@"j hT"j5K5LI55JZ_=0Lt[=luR=Kt&=tqu=t5@jjjFl=K =KP=h=l#=(L5dK=t=u5LVh("h,"jzK;5LI}C#t%=tqu=th<"jjjk=KtP=KA#t%=tqu=thP"jjjBk=Kt =Ku KL[^_UWV+t}WhX"h\"j'z5$Lhl"hp"j z5h"h"jy5h"h"jyDK=t@KDK#=Ljz#=Kt=Ktjhh"jLV=Kt%=tqu=th"jjjj=KtJ=KuAh"h4#h#j5K5LI55J X##jh#h#jxc=h=luy=$Lup=(Lug=Kt%=tqu=th#jjj i=Kt0=Ku'h#j5K5LI55JOW+$L^_Ð#4L#t==KJ=tthJ#=jh"h"jw=Kt=Ktjh#h#jMT=hu=lh=Kt%=tqu=th0#jjjg=K-=K jhD#hH#jvJ=0LuU#tQ=tJjh\#h`#jv=Kt&=Ktjh|#h#jqSJJ#==hz=lm=Kt%=tqu=th#jjjf=K2=K%UEÐUE?B H ji$|"' <[t<\tÐ<{t<|t<}t<~t搐UMA<# H eOven H eoR H eU7 H eA H eaá H aǐ$ H aȐUM<]wHt<@u2a6c,?$ue" <[t<\tÐ<{t<|t<}t<~t搐UM<^wHt<@u.a6c/i(o eu<[t<\t<]tÐ<`t<{t<|t<}t<~t␐UM<`wPt<[u:?>c4u-a$oei <\t<]tÐ<{t<|t<}t<~t搐U $E?u<`^ H EOd$?tӸOK H eo0<T$?t˸o$?6/&6.']6`/{&|} }=u>J)B(BJJ  Ð=t됐UV+ $$u uA }#t WF(FJPMu ºMɀ ^Ðt̐UWVSEH$$=uLt}|AG~E 8H fπ>ɀNVu =u+ }#tu-º$@BЍB<‰ @[^_ÐU+ }$}+ÐUWVS=$$u6h|jAH#~"+;}]|PӃ#| G;|+[^_ÐUWVSE+5$}M#uyu,h|QV$} |с ~|փth|QjEQP5|E7V$} ||=|tPh|E#~4+;}] |PӃ#|G;|E }$}+[^_ÐU+}}}ÐUWV}#~. }A }|H}#}X}L}+=It( @ H#}T#} }#ȋ= ==}Qug|Q} }A }Ѐʀ|d}ʉ|J }=u׉} |=It( @ H#}S#d=}=Iu^H#|k @ ^ @ K @ 7 @ # H +S#U=u&5}=IuH#|kQ=}|=Its) @ H#}R# }A }|=$=It+ @ H#}8R#g }A }|=@t =B }5}5}=IH#Y=(=It_& @ H#}Q# }A }|=Bt=Juw5}5}5}=IH#=u55}5}=IH##1}H}|^_ÐUVfEfE5\VL5ɍE+Ɗ$t}=|@Q~L5M+ \VE^UVfufu\VLE+|~|vnO M=~H=| AɀL DM+ \VfE<=|=~fE&#tPhhjOIfEf^U+}}}+U+ÐU WVS$$=_ }#I }}@}|A9C ɀ |}=}|}=}}@}I }|}I }|Uu+=}=}=|=~=|L=E֋##ÏO]~I=!==Y }#}+u# }#= =}Jurڋ|ڍJ }ыȀɀ |o}B}؀ˀ|Nډ }щ|7}+u؉ } |#}=u5}=}=}=}=}#}=tЍJ=l }|#}B}|=$u?#}B}|=@t=BuW}`=(u4#|G}B}|=B*=J =#85[^_ÐUE5(hxh|j>5($hhj>5$hhjs>+Ҹ1+ʍ<+ҹ +ʍ<54$5 $(,0!4$8&.<@  $(,048<@DHLPTX \ ` d hlptx|   ^_ÐU=dLt*jhhj<`LdGU L=Lt Phh PhhjH<ÐU0WVS} 5 dPh$h(j;=&j#*&d +5h5l5pe4}jI#3"=L%= L%jY#%-=L"= L"jd#"b#hЩA}=L= Lj贻#Dj۹#P;=L|!=Ltjh,h8jjY =LthDhHhL5JD K#t=Ju DMu#t =Jt DMuih`>=Ly= Lvj#x裼 K#t=Ju XM#t =Jt XMulhԫ9=L= Lj5#Ŷ#Φ#Λj#X胗8dG H9tي"ujPSQ X "u55 LhгhԳjUK0}=K=hkjn55HS20}KTy#u=tqt=Lu hļJ 5YU=LtЃ= Luj蔌#a^d=K=Mt]$M=Mt7P&@Pj"hXGj"5 h8V2VjkbhT P\0}~hT g0}g@P5,hLVS2Vjb0}9=L` MUPthT hu\0}#L=K=Jh 5rR$ jP5` #}~hxȨ=L?= L6j#k菎#u,=tqu#=Juh1h$5Lhxjjj ,x=Lgu M# K#t0=lI}'=Ju=tq5=u'E58K5JEPh GW#}L5Kh hj=K=tq=h&E=~ K KQh hԻjh=Kt=JulIJ=ءtLff=f=etmuf= Ju$f=f=f=f= JRQP&y K#}-#=tq=h6#tr=Jui=4Kt`=~NuJjhhjk=Kw=tqj=]h K#jjjh@EP1#+=Gt =SuK ,K=Lsu8=Kt E!EE#t#X?OEWP =Lsu" M8uMPWP WP hP =Jt =ءt/=Bt- -#t=t=u] =Jt1=u(-#t=u]+] =tP #|!@}| M@ƄPP藓 ,K#uh ,K ,K#LL袨hļ蕨 K|jh Kc K5LTh袧h Ih<=XGt j=Jt =  K#=K=tqLjAEK=L3[^_ÐUWVSK#t=Ju HMu`#t =Jt HMuJhhhjhпhԿjd}5\hȾh̾jA\ ti5Khhj\t +KPhhj=Hu\t+K5H5jh 56  MME}  =HE+G"EEuVh h$jNG< |.+*@t@+GGSh4h8jEjWhHj۹@Ejhhj赹K K}juhj|OWVhXh\jJft DLftEfK=KUjFcMzW Vhphtj͸|0TP#u Ku K|]"#EEu#u5>B<V~5<{u|>}t <"u"|>"uD>FWVhj+5xHVhj=xHtgK#t=Ju LMu#t =Jt?LMt6>!u1FMHIS5Mh$j蓷=u_#uVHIKDI+=TItDI=Kt DIPVXأHI5M}uRjh<h@j+=`Lu5pG5lGdG+[^_5<h\h`j蹶=<5  +Vhhj}5u+#t)V@PE#tVu ujVhjYhul}S ] EE4j^EEEĉE} EĉE}]E̋MԉMMMu}7EE 5(MME؋]EE#=JtjhjDء( jDءE؉EP5(hj1ShhjC = w$juFV#h}hvhnE8MuhH4 uuUjuU#!hhhh5(Phdΐ u~ :;=JtQh0艐jj=Ku hTg}t uE0h@-}t uF4  (E}t u +V#t W}t u1=Jtjh\o}t u[^_ÐhdFBEE]EȉE}u M8P jPhjsu #tb؀;t[S#uC;uDE<,EX}hX}EP7փ #, ,9tP8tjP7S#(jPhjΗ}u@7@P0E#7u8juh j舗]E7EP7h,j_}$P #u7=Lh7V#th7C#DI=TItDI =Kt DIP7udDI=TIt DI=Kt DIP7豸uV7hljzu5(hjbE+V7PjG}uv=Ltmj7hj%}u }$u+DI=TIt DI=Kt DIP7uEu#u~ }u+#uKPuhj舕}$t;t =L%}t}t }$K#}Yu#FEF:t"uEE8=(M9uhPhuP (~/thP1(uP j5(hj蝔:uFu@}$jPhTj]}+}h迊nWPh 覊 UWZ ]}#Wx}}=u}$u#u É}]}MMċM܉M#}!}$tWPh$Z#u~#jPWhjY}t E0趶}$tE0E}$tEE0ʡ}tNEuċE0h4jW}$t#ud=u-=Lth\8E0hx!}t uh=uU=Ku}t u%##uE0h誈L#}t u=u#uE0h\#:)uhDhHj褑}u #؀;S#u"C;uvEP_,EX}hX}EP7փ # 7[5,K+)5, ,9tP8tjP$L#M(h5(#h$"h,5 h}E:I h}j54K#55(h j:(h45(D#m8.u x/u*CKDI+=TItDI=Kt DIP7ձuV7h\j螏4#~h 1P 4ƀV54hpjVȋE## 4EQPhj 4 "ta]];}&uMU 4MU8 uC;]|u;uED44B "uMMuPhj胎}54EShՄ h}A h}C h}"tA h}C h}"uI h}j5 Vjj549I#55(hj΍(=JKjh/7=Jjh<=w}$t 5(PhDՃ }$h謃lQPhj54lȡ4#}$5PС4#~&} 8Lt 4D4=Jtjh SV h}Ah}C h}"A h}C h}"u}}$t:V_54#~'=} 8Lt 54D545VhbVFj54 G#F}$T54#>54hu E8u%}$t < PP܁uh ǁ#tq؀;tjS{#u C;uS,EX}hX}EP7փ #7'5,+)5,P{8tjPE#5(5Phpj舊 *Dj7hj_}$t +DI5TIVhj2DI=TIt DI=Kt DIP7"u##hau$jhhV#5 58h( h0#h(}0=tK5(hD5 58hP h0}I9}$t 5(PhX}$t 5(PhpM }8w}&eU WVS EEj] Shje}#u=#uhSl}S 54Shj#54tjj1jSDC#yhh h8hLhlJ~9h2~$P5(h\j}#t\,EX}VPhhjVhX}EPE0׃ #|j5,wB#C(Mu5(h|jE8u"jS8B# E8uVPhjȆAShd9}S|A4 jSA#+[^_Ð}} (E545(hjO0#u ;{=Jtjh|jx/=W5(h,jVh@hDjF = w$}W5(hPj…}ujS@# (E}#+50E8uh{uh{5 58h{ VUWVSEE#u EE E#u Ehu5l}Vo u54hhjƄ =4u6 d}EQT}E h} `} d})jhhj]ET}(h54}+j{-d}5Phjnh;:=Ku'hWzh8Dzs=JtQh zjjx=Ku h(y1*5 y#Vhy[^_Ð#}ދEEu+T}jg,ءT}T}P5(hjShhjтC = l$0g :;~u=T}uEM}#,EX}jE0hj^hX}EPE0׃ #5,o=}EMQRM  ,EPQh jE8WH#g< ]H#O=T}uW>t.VhXx=4= VV<g=JYjh`wE5(jSV5(#=JtjhhwShpwS;=4= j5 h8jӀE8uhx4wuhw5 58S w h0_UjuhLuuu uNÐUjuhPuuu u*ÐUjuhTuuu uÐU4WVSEEE#u XE}#u=\u#hMh Fh|>h6h.h<'h=Jtjhuhu=Jtjhu5(huE t4=Ku+=Jtjhu5(huu4FE t4=Ku+=Jtjh@u5(h-u4b=JtQh8ujjX|34+h\t4E t,=Jtjht(Rhyt4PRh j}&4t}}k=4t҃}u4@jEЍ@tt#t Hu MЍIDEWhs:jEЍ@t#t HEЍ@DW7}tFjMЍIt#t.h}HH h}:h}h}`} 4j5 hjZ|E"4E t =K[^_Ðu\E EE %Eu h`hdj{54hthxj{`4ujW6#} u +P$؉}܋EE؋EE} Whhj^{54hhjD{Shhj/{5hhj{u_bP\$SjhDhHjzE t=Jtjh4Oqj$S5(hjzEEP5(hjzC =n$^ :;} K+I} }ܡ#u u+PWp5#mu =M(#,ẺEX}hX}EPRу #j5,hjyE8u}j5(h`& u+Pu4#(}t :/<}t$+;} <:t <=tA;|  (EPu RVH;E=}u4E }~}C+;E8u}( 8 @;|5hh jx=ukE܀8uhnu93ju3#4 55(h0j%xM(#tJ,]X}hX}URPу #;u]jS$3#8(MQWPV9S5(h\jwu5(hpjwM#;E E'IDt uAM;|E ]Q5(Pj3wW5(hjwMЍA;} ]W4hjvj545(M#uYDuGtE t=4EЍ@4SEЍ@4hjv;]}]G;} q} ]MSI4hjVv'tt;~kMЍ IP5(((Ph\l(P5 Z+EE=JjhdBlu#=Jjhll} ]u@E =K=Jtjhtk5(h|EЍ@thhj#ujEЍ@t(#t E jEЍ@tMЍI#tPA;M }JËU I|9|u'jtӾ#ujtľ#tEЍ@A;|ċMЋ=<}tjt菾#KWhj FM(#tB,]X}hX}URPу #jSZ/#w(MQWPV6=] E؀8uhQjuh,?j(8tSjhhPWVν}~=4t hLi(8u3}u'EPhuPhi}5 58hi h0sGShiuUU "t(:t B "t:u"t+ÐUWVSEEE8E@Ej}WhHjr#u=XE? uG? tW蝾#u%jWh\j=rjhphtj@uShj.jVh\jjh|hjjhhjjhhjjhhjjhhjjhhjjhhjjh`hdj~jhhjnjhhj^jhhjNjhhj>jhthxj.jhhjjhhjjhhjplaFt E VE h(EPS臸SWhLh8EPƸS[SWh`\hXEP蛸S0SWht1htEPnSSWhj5P]S迸 hEP.<7tVEPW讷SWhEjuKv$]Sc hEPҷ<7tVEP轷WRSWhVMjuu$]S hEPz<7tVEPeWSWhjj#E+EEPu$]S>>E VE9EGEGEGEEGEGEEEPi؍EP[E ؋# KWPShH]SK>E VE+Z<EGEGEGEEWEPƷEPhh]Sѵ>E VEhW~4D5"< {<-sOt1Ot$ :u:u< q<-i<_ajWh@jgw |G}G~GE|EGxGyƅzxEGtGuƅvt5hE}u lEu贴$hEPò jWh0jUfjVhHjCfSvE="} uuuhhY+ۋh"< t<-t ^ +jhHa=4tAjb5H $h`eT?65 +#=u5(h#T^#}#uQ=JtnjhS]hS5 58hS h0蘮&#t"#~Ã=N5(hn=43UE MEAEAEA EAE AE$AE(AE,A ÐU WVS]++h}E,(04 ? EE3hLhPj\=9Ph hj[3h0oR;f.f"ff f fπ;sEPj ss莸;VhdhhjI[#^sEPss誺Vhxh|j[#0Wsss sEPEPss VhhjZuhhjZ#CsEPssVhhjkZ#sEPssVhhj/Z#tzsss ssssVhhjY#}@C:@5$lWVhhjY#Vh4h8jY54hDhHj|Y5hXh\jbY5hlhpjHY5hhj.Yv[ #7ttt Eh}`}d}4=Su=IX+( HMH;uMH ;u +҉PQhhjeX==55 hj>X=43hhjX;5 5(Ph\^N VhhjWWhhjWuu[!uh럐@땍덃$tAtDts==[^_ÐU54hhjW=\}u4\}4+U545(hjV=\}t\}4(ÐU3xL ShhjRT545 ++h}`}|jQK#545 +}̡h}}th}`}|j5d}#5 jhhj}S4PhIh}j5d}#4h}j5d}K#4 T\h4RK 5 58hp*I T49=JtjhHhhH4[^_h5d}5(R (Ɓ5(W (#N| CH (#0| t$`}d}j5 h\jQj5h}hpjQj5d}hjQh} ;MMċMMMMM؉Mȉ}̋M܉MMЉME#: =5=t=t =StERQPjP5:U SWVjPu5=$hjP=:t =Ku =;u =Pt8PɆ#t(+#} L  LH#tb=Jt#ud5lhhjP=lEȃ},K8,K#@v;#ShhjO}t) t uh}@h}\h}E} \u}u=tE u  u}t ;t#u!= u=tEh}E̡#} h}H h}uhhjN}t'Ph!E=:t h0 d}h}= u0A d} h}@h} h}U8u }+`}|jQc #hD5d}4$5d}h(#un}uh}tb=t:uXh}H h}}t'Ph*D=:t h0 d}E8`}VEM;uE;uM=t  t }t P h}}tC;ErŰHh}h};s@h}d} +EE #t5d}5 ;vPH t uC=XI h}PWh\jL h} h};v A< t< tNj;vH+F;vp+u#t =hl}\t-t:Mu+WRPjL#tX=teh}M8HuH h} h} Hh}h}H h},h}V==u˃?u.=t%=u}u#u =}-=Jjh8y=Jjh`c=JjhhM=Jjh|7=Jjh!=j=Jqjh5A]t  9h}vI, h}Hh}:MuM:MuE u d}U8u}u  -=Jtjh@@(h}h}9d}it{=0h}58hPO@5 F"t+XWu^PS@F"uW6+h}Ph}; v# h}h}H h}; w蘟 (h}5 +h} ;w4=JtjhH~?J (h}?Hh}!oh}h}Hh} ;r0|׀9~@|̀Z~a|Àz;rH"tD0|?9~@|5Z~a|+z&h}h}Hh}; r"u@h}5 #=D=@t  T#\#t05 R T#u#I T\# 5h}Vh} ;+h}h}H h} ;w#tx=Dto=@~fua TA; X/ T\#t45 R@ T#uA; X T\# } }}tgjPzWShhjFh}@h}\+}t WP3S5 VjaFh}}u  } H h}h}Jh} ;v/h}h}Hh} ;w܋ T\h4RZ 5 58h9< 50EShhjE ~?tt =ShhjWE ;UWV+ɋuh}P>t9= ;s)h}FAh}P>t= ;r׉h} h}h}`}|^_ÐU WVStE(E)E{E}=(]S詐=~[^_;u0hWSU ]u uS^H#| < uH#}D< u C]< t+"tUUU]:uA:EuI#}+#u6< t< u fu<=Y<:Q< I< ACG"u,UWVS"tQ=SuHPh@hLjWC=?zu=Ku =JuX#cNtjhhjBq==q"u=Ku=,t +V$.##Sh\hdj]Bt+h 5qP袃 #^=~===J jj?SF=t= =jj?jhxh|jAjhhjA =tw=Cu =tut뭐=tttjhhBjhhjAk t ttRh .?#ttuShhj@=Jt=(Iu[^_Ð H #|$H $듐UMÐUEPh6ÐU=t h6ÐUS=tw]} tIjh6j h6jh6Wu^Ph ShY6=:t h0[ÐU`}ÐU WVSE9E#C=\;{uC;E ExCC E9 E7C ++ "tA0|<:M7UU+ɍ| C@ "t0|:M=} ׁ|#t~$E0)NE0}t ;}u~CE[^_ÐoFЃ4w$ u?^P>#|^P(#|% 뇐zUE<0|&<9"-#hT6h4hDzhlDfhDR5>hD*{h4p6gh`H#ThpE?h|+h4FhmhT: hF h h\ hGN hG: hZFw hpY3d h<O hG ; hH ' hH  hA  hI  hpJ  hJs  hK^  h+j  h8L6  h|L# t h@M _ h. K hDT 7 h|S $ hM  h0N  hN  Ph~)jjjjj55h $/=uPh>)h U  h(O" s h4. _ h@B K h 8 hJ # hTO  h  hP  hL`  he  hdPZ  h(g  hR  hP o hp3* [ h Q H hlQ 3 h$  h4H  hdJ  hQ  hpR~  h$Sj  hSW  hSB  hN  54h`ThdT5DhB P!L hxT 7 h,{ $ h$U  5, 5` 5 5m hUZ 54hUhV5Ahp78WhVhVj/W ah K Kh$V7hV$hdWhWhXhXhfhxjzhlYFhLShk>oh/*[h0GhS4hZhU hZhhWh4[~h8.h7vh[Ch[.h0\khx\Wh\Dhs/h\h ]hl]h]hl^zh _fh_ShX`>5(hT#hW| YKc?h`+hlahahDh,"hawhdbbhbNh(c:h2&#'5 wt TD+;r< uJ ;r< t;r< t J;r< u< uB: tRhthhMvJ=u ,F ]QP4@Phl#b=L#RE$jh`h`5d5\Vu#^_Ð#}j(ʊ"t<(t A"u (ʊ<\uA<\uQftFu A h*shk_h$LhHl7hl#hhmhpm~hh,vhmChTn.h:hPC&ohHE\hGh3h(h\ hXh8h|hshn>58phH =Tpu-58phhhhh(hp+.hP hhhh@ hochdnh@p:hp&hq|hTghH Sh(?h(,h hhh\rsh ~h4jhD,Vhs#hd .whsch4tOht<h hH71 h7 h7 hD8h8h8hP9h9h:fhT:h:Fh;~hX;q&h;^h<Qhd<>h<1h=h`=h=h$>hT>h>h>hL?fh?h?Fh<@~h@q&h@^hAQhHA>hpA1hAhAh(Bh}hTBhBhB~h,ChXC^hChC>hCvh,DihtDVhDIhE6hXE)hEhFh@Fh|FhFhG~hPGhGhT54Vh h$~=#0S0=@`QxSS54Vh0h4~=tU#0MS0=@Q4VSx#}Z}x44WhIzShIzVh Iz=I+[^_ÐUVE54h@hH5th<#}%QV4KE8K3u"54EPj hLhT(c#| 舧#}^ÐUWVSDEDhh!JZuZ+5qC\] j^Z#tjhxh|5hTjhh5D7h7#}?tVu"N#t  QP5q[ 衦#b!!uPAY5D[^_ÐUWV54hh5=WB#|5(5L4Q #}:1PE@hlO +ƣ^_Ðj5LP$h5Ly#uu L=tV#t PhN&hOnPh4OW L#t|=tqtqj5LO$h5L y#uV L=t#u=,Ku닐#u =,Kt=tquhLOY+EP55LWAVE@hj=t#hc#w=tqjE@hO6IU(WVS5KhhjDPhhjl5LhhjR==Dj=DWh4jW j艵PuVp V EORhM|O+hP`O+ȍ4hSIOƉEO:R:EEEP"O+EPO+ȍ4EPNM+ˍA+uVhLhPj~[5VcjSh`jVhOWCT VSW8T jWhtj +Phhj=KtdjjhP PhhjcWj PhhjCj M$hhj%5Lhhj =LjjjWh~p5LWhjVh,h8j#~nL=|[j5VVhLjh`Vhdjj(j5VVhtjkhVhjj=}[^_ÐUWVS+=Du=}t = t hOhO5+5Khhj5hhj=Kt:=u#}5}BWhhji5hhjOjhDEPl EhhVSl jPPjSEPEjzP0Sql SEEEEPqK+EPVK+ȍEP@KE:E:ƅ;ƅ>~d9PK+4Ej hbWW h,hp@ hL-( hLh54EPhhhldE#} = uF6E#~M9{u|}u DE#~)u;}M<%u|st@E;|;|#tP65|#GW 6|uP6h54]Sj hh}F#$ 54EPj hh UF# 诊#M ]Lh# h4# =4q h8~#{ =8Ri 54hh5lh̺h#; hS54hhjhpg#诉#=<54hhjhL|gE##t  #u  h,#54hhjhL gE#A$ U54hhjhfE# 54hh5hļf#莈# uD5@=@h`heE# #w54hhjhf#K#>=HLhhE=#Pm#$hT592 # #uhTh Z=uhThY=j32d#hTP82j2h#tbhTP2j1l#t;hTP1j1p#thTP1=uhhTh&YThTP1C#u#ja1#thTQh1=uj51#uhT50#btjEPhhhl=_E#72hb+#u&u(h &t54MQSPd[E#|;M#t4Q-0#~$@P_0D#t uPk0F|E=&uE/#oE+;]}(&u jd jPWC;]|؃&u55+;})Dă&u PdPPGWC;|E+;D#t P/C;|TE54hh5th<Ub##t.54h h5بh$bE#^#QE=~T=PP54hh$jh0a# #=b+,54EPh(S[YE#|>M#t7Q$.#~'@PV.D#t uP_.G |E=ul;E#x+ۡ,;}% #tQ`.4,C;|ۉ=,+;OD C;|7+;D#t P.C;|hb54EPhhOXE#}=uM#t#9uuQ5LT-LE8E#~p$TU+]#u5u @54ShXPWE#|AM#t:Qy,#~*@P,#t uP,F|E=5u `ܭEs#E+;]})5u j j\PSC;]|׃5u 5` 5ܭ+;}.5u P P\PSC;|E+;} #t P,C;|[^_UWVS=Jt>h4V++[wPh@\d[^_hTVHJ#~ F#hh]*+h] }t h!$^ }t h!$<hh]q# ++  @=|말ShH]eh00!JPjNEJP[M#Q EM#;/; JuQh]&}tAhh!#h#5q%4j#]}5 #tX%jWhVI#} #u]uQ@EE++ =L"#~|Ktkuru|\t~#|\u|\t7\]FU=L~6|{u/|\u(D7\=L7{UFM=L   7]C]U F=L"]7=LD7EW-+ȉMHEPEP5LO #*LT0UE #tPtM URM#=uE u@PM M #uP[^_ÐULVEu#tPh]V? E54EPVu !D#|(u=G~jGh^"^ E8tPu␐UWVSuXEEE􍅀E8E썅EEƅXƅƅƅƅ854hhht5PhxK#tVhxE#=F,KV=u =Eu<Eu<Eu<Eu<Eu<$uuuuuVS# uhE#|{#uuhE#|`#tjuh@E#|Euh E#|.uh$E#|uh(E#}=k#[^_ÐUV54h@hH5PhI#}5K k#}^UV L54EPQhTv)#=~Thl^h^Rh^:+ uM< t< u@E t tQ5Lj#4=JtF=JyK#t=Ju |Mu#t =JM|M@ LM9|u,AM< u AM< t"tLMQ#~VL#tPLFVL#uPj5Lhljd=Lu(u#}uh^#+^UWVS+uuuu]^huqu[ruulumu3osh^hwK 4KE,h<-Phhjh'ju l9PQueh4h54EPj hh#E}}EhuuhJVhJ&BhJj6$\$54EPj hHhL5#EjQuhN&hLK:&j%&j-&+ &u L% %u uy%s%%~uu0%%j}%z%54EPj hh !EhQuhK*:%h;'%h"r %h^h_5o$E#=hb۹O$54h|hjhBE#$dE#$} M#u thPh B @h5 h} h5(G3$h h|u2$hphPh\hMID$h@hPh-E0GDhP2$hjS袖Lp#5JhhjjjS8 E=~ uhh j5Jh h$j{5Kh8h<jaU"EHKU"M 4L}& l&uP Z&$M& G G G4&Ƨ+EA&Ƨ+E@%Ƨ+MA%EH-%-%E-%E -%E(-%E0-%E<=>?k%M @EA BCF%EM  "%E-%E-%E -$E,-$EpM qr s$+D-$j@uh@- $j@uh- p$j@uhL- X$j@uhy- @$j@uha- ($j@uh8I- $$ih,b'#M9uEuh-2#E-#uhXo2#JP#x#h#" 4X#j-H#M J9#E *#EJPhhj貽=Jufffff=J J"uh@hDj\E= t#|=  M 85JhXh\j#5Jhhhlj \"+JM JF"+5J5GEJ*"G"]Sh`A54j5AhhhjuV_(j=AW54j5BhhhjS^_(hP_5 V_E#}h=t =5(h\_薲5(hb|hciV4E95(u6=c545 h5BW$;E#} =Lh|_h_z=h `˱hD`辱h|`Mh`F(8-th`4h(a*h8a"(8-thdahahabuhaLV}u =L9(\E#EJ= ====h_ȰM;|A0h`覰+ha蒰=J=T@whHbehbRhb?hc*hchdVhPdsPhtdٯ^h|eƯKhh貯7hh螯#h0i芯hiw5 hi\54hh5Bh B?8E#= $i54MQhhA3E# #tP.5 M#9Qk@P K-#tP-M#}9tQ@PT-#54hhjhL47E#!YE#54h h(jhL6E#XE#y54h,h4jhL6E##t.54MQj h8h@E#} XudXE#<54EPj hlhtE#%XE#54EPj hhE#WE#Rl($ jE+jjj,, E#}(5JhhjE5 5Jhhj躵:h`*&uuy54hLhT58ChA4E#VE#+;|AM9 ?@;|AU9?u54hXh\jhL4E#ZmVE#|?hKE#\#54EPj h`hdE#}UM#6/&,!#b ##|10F(l|~t6+<Ƌ+?=wn##|1*F%l|~t6+<Ƌ+?@#54Ph5h/E#xQ#k#:#|1/F(l |~tݸ6+E<Ƌ+E>#| l#| 1| Fqu l[6P#| 1| Ful6t6#|1-F(l|~t6+E?Ƌ+E=#8| Yu lI6=#M#|1-F(l|~t6+=Ƌ+>=wr#&#|1.F(l |~tݸ6+=Ƌ+>@#(54Ph45h,E#xN#k##| 1|F^#| 1| Fu l6#| 1| Fu l6u l61*#| 1W| FAu l+6 11==}=r=g=!\=#Q#t L d#r#|1.F(l|~t6+<Ƌ+>=wn#I#|1*F%l|~t6+<Ƌ+>@#|54PQ5h)E# #u  ##|1*F%l|~t6+=Ƌ+?=wr##|1.F(l|~t6+=Ƌ+?@#54PQ5h(E# J# #i#|1-F(l |~tݸ6+E<#|10F(l |~tݸ6+E@#|10F(l |~tݸ6+M=Ƌ+M?#C| O/l;#| 1| Fu l6#| 1| Ful6#| 1W| FAu l+6 #| 1| Fiu lS6H6 #|10F(l |~tݸ6+E>#|10F(l |~tݸ6+E@#| 1| Fu l61=%=='v=,k=.`=0V=1K54hh5Lh$E#=$k54hh5hP$E#^qF#SFh$-U54MQhh {E# 54hHhP5xh $E#=uC54hTh\5h|#E#E#=u.54h`hh5h|#E#`sE#H54hlhtjhLD#E#1E#O54hxhjhL#E#D# :Y=:>54hh5h"E#vD#^54hh55VV"E#054hh5V,"E#D#s54hh55V!E#54hh5V!E#C#'54hhjh}!E#W54hh jhLS!E#-@C#E#===54hh55V E#54h$h05V E#B#~5854h`hd5htn E#H=ct=bu6MBE#$=J}c91{dEj]d54MQhhV5E#u/d=JPus=?hbhhb|h crhdjheb=Jh$eNhTeFh f>hf7hg.hg&hgh hhhhPihtihK=#t KKUUxK+}+o+JKMF>D9 -賹!hh[^_ÐE=54MQhlhp E#띐54hhjhLE#v?E#[54MQhhE#/9EuEM#tQEȍ;uEu+;U<%u |%:@@;|]CjB'54EPj hh7E#}>E#h54hh5h_E#3l>>E#]54EPj hhE#E=t ==#E==54EPj hh$1E#q=E#Z H$lMQ蛫E#5u_M T#+67"54hh5(hܨE#uIQhhj7h|KEPhhjE#|])E#+fNfMA|#-tkh\oVؽ#tYhdosĽ#tEss#uVY#u5=Y=dt=hz=x=y=z#t G"}O#[^_ÐUVuv(tE @(u4+wpgtσtփtуtԃtσt=tʃt=t+t=+t,t=,t't&t='t=&t^ÐUWVS=J=Ku h|oc+=Ku[hochotchpgch@pZchlpMchp@chp3cK+8Ph4h8jlJP2SkJ [^_ÐK#t=Jt =t #u=,t+K#uE=~K U5 Lhhjk#t/=Gt&r>#|jj{#u =J#t:=Ft1M#t=Pujj- #u =Pu5Jhh jlk̂=Gt=Stv=Jum=Kud=#|[hpah(qahtqahqahq{ahqnah(raaK5 Lh h$jj=Jt"=Kt3=#}5=:,Qh|hjg:UVJ#}P} ^Ð+ɡ@;}4I9u tA;|ːUWVSEEEEE EPhhjfuhhjfuVhhjf=t|=LtYMhr]+#|0#t[^_Ð}#SPV EhuuE=Sh(uV UWVu#u5@>ua+VhVh$Sq K|ui~jWhPjcSF"t < uG"ujWh\j?SWjmK5KhlhpjS^#)+lptxhlUWVS}#u =E?+T#uWBa}=~ Wd}phWh }=ljhuj/Ku VWhjR5KhhjQjR}=K4<|uc_jShjQG"t < uC"ujShjQSjkKPhhjkQ}<|tW#t;+hjjWjNKK#uPuhupG K#=KhuhI K#t%=Ktj5$/hjx-K#t =Ktjh5kjO-EP5K#t =K[^_ÐUWVu#u5>ua+VhVh0!衾 K|ud~jWh jOF"t < uG"ujWhjoOWjiKPh(h,jJOc#.+āȁЁԁ؁܁hUWVSu#u5@>+hVhH j5$/hxjNjh5kjN=$ktwjh$khjoN=(ltjh(lhjPNjh,mhj:Njh0nhj$Njh4ohjN#u8ujPhjM=tKEP33tKjh$ujM5\Vh(h,jMtKNjWhPjMWjgtKPh`hdj\MtK+#y[^_ÐjIN>|u1~jWhDjMF"t< yG"um+} tA========hjjVjJtK#EnPVhu C tK'U$VEP1j uuV ujVh<jBLMAAAAj5VhLjLMAjj EPh #}:juh`jKtjVhjK^Phuh EH u0Ɉ @  jVhjJK EA|oUWVS}#u=?u0+&hWh船 #u j LK[^_ÐjWhjJuVWhjJ] SWhjJ#tSWhjJj K?|u}_jShjkJG"t < uC"ujShjGJSj dKPhhj"JPWhu@ KX#t;+  $(,0h jjWj %GK#t#UK#u,4 =t@ÐUhu?5lm!$hu?5GR!$hu?5G7!$hv?h4v?$#uhTvk?@L$hdvN?5d $hlv3?hv&?#ufhLhv ?nhThv>Xh`hv>Dhphv>0hxhv>=t=t=t=thv>=Hu.hvx>chPhwZ> E= Ht  Phv/>= Ht=Hu먐=Ku  Phw=5xHy$h(w=,KDh@w=5K<$h\w=h|w=ÐUWVL4Jhwe=J4|IhwL=hw?=LP4JhjF5JhhjF+J;}ttjtet`t[ tVtQ<8Whhj@FJ;=J}4|IPhw WPhw< JF;|h x}<^_ÐUVShxe<=Ju =JX=HLu   Ph h4x"< h\x<vhhx;ehtx;U$Ph hHhDx;=qt #| lI"ttPhx;=Ju =Jt hxhxn;=Kt hxhxN;=J=JuyPhx%;hy;qhy:^=Kt =q=HLu 4DJ=uhx:J=uhx:J=u6=uhxhx =thyP:J= uhy7:J= uh8y:J=uhDy:J=u hXy9=u hly=====hy9J#t=Kt=JuJP=Jt P`VPhy69 =K=Jt Pm؋5J}%=lInhy8Vhz8=Jt)VPhz8 ,VPh$z8 =JuVh0z|8hwX#|10C(l |~tݸ6+>@# #|1*K%l|~t6+?wT#|1,K'l|~t6+? @# QPh{4 #|1/C(l|~t6+<wW#|10C(l|~t6+<@#$#|1/K(l |~tݹ6+=wX#|10K(l |~tݹ6+= @# 0QPW2 FK;~G#.+=,, d#|1.C(l|~t6+Bt<D#|1.S(l|~t6+CtLTRPh\h`Qh{xhhRPhQ1FK;~ (#t+Cb[^_Ð {#|1.C(l|~t6+Bthp#|1.S(l|~t6+CUV=H-t  Ph|o0 -#uShh}T0Thh|=0=hh|)0)hh }0=t=t=t׋uFK;~#+h}/E"u@h8}/=h$}/.hL}/h`}/ <t<t<tD"u>h}e/;ht}V/,h}F/h}6/ <t<t<t=Gt'=StPh}. h}.=Ft+=Pt Ph}.h}.h}.FK;~2#+h~r.-#uRh0h,~W.Shh~A.=h h$~-.)h<h4~.=t=t=tFK;~#+h<~-A"u?hd~-- <t<t<t=Ct D P=Bt XdPQh~, FK;~#+5(-^$h,FK;~J#+5-%$h$|,FK;~#o+5- $hHC,FK;~ #6+5,- $hl ,FK;~ #+h+-#t#Ph+1Ph+!h辂#uh+FK;~* #+5D- $h\+FK;~ #O+hh,+FK;~ #+hLh*FK;~ #+hh*FK;~a #+hh,*FK;~1 #+h@h@l*FK;~  #tc+h8hT@*FK;~ #t7+-#ulPhh *FK;~ #u^Ð+UWVS=D%t#uxPh|)]h)+;5D}>=4tVWl) K;~ #+FC;5D|h8)K;~ #L+jj}W7 C#}:h܀(K;~ # CWh(K;~O #+ۋFPjW C#|?Whz(K;~ #+ۋFPjWz C#}=JuFh3($#PCK;~ #4Ch'K;~ #+ۃ=JtBh h8'J=t=u*=t!hhH' hTx'hdk'J=t =hph4>'Lh|*'8h'%h'h&h́&h܁&=t=th&h&h v&hb&sh(S&d= ===(=Y=v=t= t= t=CK;~#+ۡJ=t =5b$hH%CK;~2#+5)$hdd%CK;~#w+5 $h+%CK;~#>+ۃ= t Ph$= t( #tPh$hȂ$CK;~K#+ۃ= tPh؂s$CK;~#+ۡ #h?$Ph/$CK;~#B+ۡ #h,#PhP#CK;~#+ۡ=u7hp#CK;~I#+ۡ=uyhv#CK;~ #+ۃ=JtPh3#CK;~#tJ+ۡ= u%hȃ"CK;~ #t h܃"+[^_ÐU=J} =KtjUVu#t"uhh "^F<\u'hq"Qha"F"uŐ<~<}QhېUWVS5Xh*"=l #uPh,!hl!=Dt8hh!8h!(h!@#t=t=t=btPhk!GK;~#5+=t  = t PQh̄! GK;~#+ bb#~PQh Ph4 GK;~V#+hl #~Ph  hp b#uPhS GK;~#+=Lt  H#t=u $PQh GK;~{#+=(t,4Ph5,hGK;~%#Z+#u<Ph4UGK;~#+#uHPh\GK;~#+#uTPhP#t=u`hpPh=Pt'=Tt xPhĆ{#uPh̆^K;~#&+h1b=u6h hLBh 3h4#=t=t=uh@GK;~b#+hT,#uhx(+;}4SkF;5,|硜#uPhEK;~# +#uPhGK;~#+#uPh܇GK;~b#+#uPhGK;~'#\+5b$h,YGK;~##+#uPhTGK;~#+#uPh|GK;~x#+h#uhȈ&+;}Ԉ4dSF;5|h܈mGK;~#7+hB`#uh,(+;}4S F;5`|hGK;~#+h$ܭ#uhH(+;}T4\SF;5ܭ|h\}GK;~#G+#u#uPhd9GK;~#+h#uh(+;}4SF;5|hĉGK;~V#+#uPh̉GK;~ #tT+#uPhOGK;~ #t#u Ph+[^_hH+ l;5`4XSV Ë l;|UE#u" 5 -( #4 =t=t=t< UWVhDd=KuH X PhL?F5TP$hp#TP=Ku#thh#uh܊F=Ku Ph PhFK#ud p  =t Ph,5KPhPk5KPhtR=TIt    Ph'F=PIt   PhFh+ɡ;}@K+5hFK;~# +5hFK;~s#+#u!PhȎFK;~8#+#u!PhhFK;~ #tj+hAK;~ #tAh h@ hThhh^_Ð< t< h !h,wU ,KDh ,K#"h~hG lGdG=pGt RQPh̏ RQPhG5G$h,=Gt5G5Gh0  5G5Gh< G=uhXPhmHPlHPh 5JhHPPhܐ 5G$hfHPHPhI 5(Gh46oHPnHPhT G=GtPhpPh5Gh5GhܑG=Gt PhPh5 G5$Gh0 5LG50GhLw 5854hx^ hQ=Hu-h;b!h!PhȒ E= Ht ! !Ph = Ht=Hu!먐hԒ  ,KE#u"8u"Phܒ  ,KE#u"8u"PhX ,KE#u$"8u("Ph,   =tGt5|G5xGhTPbhxPb 8tPh =Ku +PD$h =Ku4"D"Phv 5d$5K$h̓M =xHtT"\"Ph( h $#uh8 @L$hH H#ud"PhP H#up"Phl h h h hȔ| hܔo  ,K#]hT ,KE#u|"8u"Ph  ,K E#u"8u"PhH ,K$E#u"8u"Php ,K(E#u"8u"Pht ,KE#u"8u"Ph< ,KE#u"8u"Ph ÐU$#u" ?Ph h@ ÐU5$$h"h"j$$@((hH~ $$@(=uhlhR =uhx; h. $#uh "@8$L$hĖ hԖ,$@hܖ0$@h=,$t =0$u h0ÐUWVSh|ohbȗ#|=0~ #@(#u#8u#PL$S FK;~#+G ~hؗK;~f#+hFK;~ ;#t{++(#|= ~$# @L$#u0#8u4#P(S3 FK;~ #t+G0~[^_ÐUh8ÐUWVS#~ J#~J#~ K K5Hh@#hD#j)=H}hxhh}#t hsha=Ht)hhB0hȘ3!=u=,LthFH#~2=dt5hhh,FH#uH8tPhXF#=HthHe$h|FL +Phr5hę_5dhL5`h 95xh0&5|hT5t0WhEP}S E44EPj G<uЃ}t:=Gt=St jj= "t=Pu j[4E+\ x9<u8+#t0+ۊ"t t P7SG"uC #u :}u+EEEEEẺEE؉EE>J/J# %uh&h &j:=t==:5Xh $5L =u]j5 h4$j] @ D P5 hT$n hh$:jh|$h$j}u }v=KuSh$h$j="#EEj!gVh$h$jsN#~)$=$jSWjTjN#cnh~uSh%h%j}uMԃ}#F %EEhd5JWD ====S=JhL % tc %=$%=~t=$-tPP=$%= "t Sr;MuWh(%j K"E:$EȀ}uC}E:=CP= %C A M:": ;rE:#t)=}@E ="t@E=Kt%=u} t@E}=<%@% x9U<utR/NERWSjP+ۋ#*u MME<tY+;=}@jjPVw#uG;=|E=E}~t\>PhP%hT%j>8Et4#~2MOE:>uWE+PVN #t #݊>G>"t!\CE 4#$u MM8u h45n E u EE}u9EEC }~uhd%hp%jE}=KGE#|d="#EEjgVh%h%jmN#jN#EEhj+E܍%uh%h%j}~E^Wh%Sjuh%h%j;}|}"#+};EE"UWVSE} #u =$&E $&uh(&h,&jPWJVWh@&j4";PhT&hX&j+th+`hV5rl  x9<u}t uJPh q[^_jh q=uhI+E x9<uIVI#&u"t$} t PIFG"u}8u:E}]EEE]Shp&ht&j} :"9ErM  x9<ut SIIE}# }?A M  55h|&j +;}GjjPVr#u C;|#Sh&h&jE}~EPh&h&j>Ph&h&j>8Et1#~/M]O:>uWE+PVI #t #>G>"JE;t }K]PUVE  4u#t#u?+5V*G 4#tHA 4  h4V^ÐUWVS++++ۋuF"#++++GB~++w+ju<.u}A#t҈Bːu#~ƂƂu#&[^_tF" ΐUWVS+u#u5&VE=}0&#&&WPShԟVE[^_=|+ t@=|~t ~ t~ EFEFEFEEFEFEEFEFEE+EP-G؍EPGEEPGE}~6%+u#dÙ#uÙ#t+EEƍ50#PShVDUWVSEu#u5&VuDWVh&j&}v&h&^'V('NuVuShWEDjWhh'jjWj PWLf }uЂ[^_Ð|~FE+ y@=|EFEFEFEEj]Sh'jPFEFEFEEjuVh'j%VXEn+S?E؋%+u#dÙ#uÙ#t+Wh0'h4'j#t  +;4~;t~ G |MEPhH'hL'jjE+4VhX'h\'jO=Ȃ}@VuShWB>UWVSu#u5|'V@B=}N+C< ]ÓiõGDƍ:[^_Ð=|+ t@=|EFEFEFEEEPCEFEFEEEPCFEFEEEPcCȍG=(,UWVSEڪ%h:iӱ:+ȋ+ KEiе+ȍq ȍɍA+P+ @+ʍ[ӍUVQPh5V@[^_U4WVSEDž(Dž$Dž0Dž DžK,+E4#u '4u4h'jjE 0h'j}~ED@DPh'h'jXDž $P5d4h\GE#Dž0=hW43?}h?hH5h-h%h h4h` hhh>2WDž '!W W@ LD VDž (VDž (VDž (VhPh` @,KV@@ zVW>kVDž )YVDž )IVU?H#}+Pw UDž )UDž )UDž )UDž )UDž )uU PZUWAQh= $Ƈ~4U)8\9tWQh= $Ƈ UDž )TUjPh+j@`LhPEdjPh+j }t u<jPh+jjhh,jDž \T= l$lhkPh^ $=lDž T SƁDž Shh;SƆSƆ5lhhx-jSDž -}SS=Ph, ;BSDž0hVh] Dž S;~Dž WhP: R4hh: RhQh\ Rhh:jh*h*jR ;#thP$hA\ Dž Dž09Ru<,4Ph,h9R =|4h$=c4hd}t׃}t=<4h̠4hܡ4h(t4h 4hDDž0Dž 4hd^4hN4h@>4hd1Dž0=h4h 4hģh=tKt++;]}$u }S4h'jC;|u }}O#|M U#t8uJO#}M Uuh'h'j} }E 0 #t>u'Dž0Dž =hPV\ <\u F <%F "u'Dž0Dž =hJO<0|A<9="#|44% 15'Dž '<*u+"#|!49 #t#3Ot띐<&TPPV< #})Dž0Dž =hN#9 |`L#eDž +;]u Dž(h.6##u' P5 <{|:}D: B Dž0Dž =hxMDž0Dž =hVMDž0=h|MO#~) : t u:O #~ :< t< t< t< uB < t< t(Rh'j~(PP i Wh(h(jK(h((h,(j1#Shd(jC;]?u =tKt?+;]}8u }S4ht(jSh(jC;|щ}}}oE=}w`$Dž0Dž =hLSh@(hD(jeDž0=hxKDž 5}BXE+Ƀ=TIt}Bt}@uDž0}}At}Bu8t:QPE#}Euhآh2 Dž  Dž (}jVT \uDž0Dž =ht4hhy2 >&JF"t<[J~]JF<@| <[} FuPw#tJDž0`LEuhh 2 <#t3+#t"+Pm2 <4G <#uQM2jhPS EP1<#+;}E5] <V=tV <PYG;~ɉ]}EuSU$uX+;}]uD<4DPXG;|e5X5L E=(8t P?( 8H=hnHP>0Dž (#H9 u AO9 t +ۊ;}< tAC;|< u)A9 u A9 t Dž(#t">t5XV5L诧 E E}}'Dž0Dž =hG}~J;u}+SW`6 ShWQ6 F;u|ڋDž (}\G @ tu #.G9=~J5j职E<5}F"  #Fjh(h(j%hH<=8<= <#F@<nF}A}@}Z} }}t}f}[} }t}[u+E}Zt}[u+`Dž (}EEWa-PJ-؃`tL#t|7*tE}t3FP[-E#tWh u#- } EFKEBE}t+}8t Ps(Vf#V.`u3N#}+}#+#}+}t$;~+ƍp#}S#DN#}+;|E5Dž0=ht"4hh, Dž }u3D`}te#}s#|Qj  x94PWV#u+N#|&j x94PWU#t#}e\;}Qj  x94PWU#u+F;}&j x94PWU#t;u+*F$  x94uVW*O}t #t W]+Vh8A4h(.Dž0=h4hLDž0=h4hpQhxQh5)+$Vh1* }>{h)fT+$hiERhUDž0=h 4hܧ+F F V*+4  P*+ȍ4 P*PhV$h,+ >-u F Vc#Dž0=h:4h4HDž0=h4h"Dž0=h4hȨh( }@}}hPVJ P*((؃}}+(E+Ӎz|#t#u'hP J Ɔ1ȋNj#tu x94SQP#u0#t ' ˉ% A O#u  A F "fA F "u?8t Pv)V`#tLV(#|}@Dž0=h>Dž0=h>%&#Dž PhVi}%$h >#u)Dž 5"tP&  F @"u8tP5)P%Dž}[V %@PC%VPS%8t P)V^#tcW^#tVV&W&}u;}}#ÙDž0=h<}ZyE=$ }z<5)}~8tP#t P$V#@P$#u8Dž0=h<Dž 4hVP#= )}~8t P}~VN##t V]#t&}uP}~JW(##t=W]#u0Dž0=ha;4hhVDž "؃}u\}~W$E}~ V$K}~ V$E0&}tӃ}~ VS$E+G|Ӌ }d;\L8+;]AN 8D8 "MC;F P "u#u$)Dž 5"tP"  F @"uk}95()}~8t PV6[#cV"(PVh0)j(EDž  EPhD)hH)j^hh\)h`)jE(E=|'Dž0=h}+ۋ ;}_ы}]܋+;}7Ӌ+؁}#B F A;|ы(E9U|>}8}85|)}~8t PM}t>uYDž hP+Dž$#uhQhA VNY#V !(#sDž E(9M|"h A /E=}} E"uE }u`uVE E  ];(iE F C;(|I+M(+;}E F C;(|uV E Dž #u )Dž)9Dž0=h5}3E=\$xDž #}rDž0=hj5=u4hv=u4hܤ\=u4hD4h,3PhL'Dž )}4+}~X8t P/)VV#VI#}+3;4Dž )"j4]̋؋ x9<ut P+"td  x9<ut PW:t4F"u0Dž0=h34hTMA#@M̊">3}+}GU#|Dž0=hY34hl}>3=%3Dž 5"%$x F %$Ax F "ue}2=q2Dž 5"+ A#otP`=0|o=9h F|%  F "Pc=A|=F~Dž0=ho14h++}N1}~S#u)PR##}+;0"#؋ x9<ut P؋#u=)"td  x9<ut P:t4G"u0Dž0=hI04hȥ\ #u.A @ "& +}/}~=#u)PQ#;<#}+Ɖ}}/#g/;Q/"Q  x9<ut PcDž$+ҊF"tL؋ x9<ut P(:tF"u͋$Dž$ #t@ F "8ADž0=hY.4hlE=]$}$.#h~ )Dž)}~ Qs=} Dž)}-hPh7  ;Ƌ  x9<ut P"tF؋  x9<ut Ps:t F"u " H ;b "Ћ‹  x9<ut P"t6؋  x9<ut P:tF"ű  @ "t "phV}",Dž 5Dž$M@"EȊt<$u.Dž$t$Q Q u F A"uAVh! J++Ƀ}~5) "F "uk}|$WPh+=Ljp#=ItM( H H#} #| K=9}6u)N < t< uN < t< tF jDž #*Dž0=h)4h E= i$ #)E.}~"tUhPhj3 H(#}E8gI(#}^#2)E.}~"tUDž$+A"JU8V+F"u(}(5)}~8t P VnJ#u+Dž0=h(4hDV(#} Dž(P+(E#}EDž 5EM#M@ F I#+Dž #'QG$'E}~"tUԋ}uEԃ}~"t:E""E=<Zt ="u)"]}>'='t=(}]=[t=`t={tӐH#u*Dž0=h&4hh}>5)Vh ! #uNPV 8t-jjjVP2$ #~ D> #%EDž$+}~PG#u(Dž0=h%4h)$#B#u +=ߋE+}wE= $8Dž8DžHEEDžLEDž<)l)|}Fx#u=*uWh*j }?#u$*jSh(*jԿx58*}~;t SVF#u?Dž0=ht4hȦh jh@*hD*nV (|jPh*j2jPE=~ DžLEDž0Dž(< };jSP>- jPhP*j蚾Dž0Dž =ht4hh &tjhd*hh*W"t<[u ]tjht*hx*+jPh*j<@~ <[} &F"t<[~]F<@| <[} F<_<}U}V}}! jVS >-;Dž0=h4h Dž0 #u5,Dž ,>_Dž0=hH4hX[}}Q jVR >-u+Dž0=h4h|Dž0VBUDž }TuuhhE4+}},P >-u F Vx;# .#t#Ⱦ<™RPQhhDž #}pDž0=h=u4h=u4h$=u4hL4htxh$$zDžD:Dž0hh#u= ,WE}|}}=h4hjV! }~DPPV #}=hw4hDž  #} Dž+;~񋅔#};~Dž0ƅ;<]}苝DMMM `L #}]u2j x94Qu(#Vh}^+;"t:t@B}"uƄ;UujRuW'#juuW&#u +#t&juuE`Lt&##F;]}MM ]}EE}^hhjuW `L4X&#uhVh|Dž }=}_hhjP4$Hjjjj5hhjy5$jjjjc5$#Dž0=h(,`L,`P"$+XDž04hm<-t<+uFVq6#u=h4hD0hV?DžhEDž }}=h4hhuh`,hd,j W:tWhP? ++;=X}<]jj L4Pn%#t#}FG;=X|ʉ]Vhx,h|,j膮uh,h,jojS \uDž =ht4hhq ?&G"t<[]G<@| <[} GVPq$#f`L\PSh,j諭ƅ}~xjS <\uG<&G"t<[]G<@| <[} GVPۼ$#`LhhSh,jV$\!htVk$h =ht4hh ;k}u]hE싅\Ejj4[L40P/# L 1#u_SQh,jUCEE9E~uVhh Dž jPh-j_hQ5  = tWH?ucuGWh-j身WMEP}tLt0MEPSx## ]uL40h,jc}ktj}btd}et^}ftX}htR}gtL}ltF}mt@}nt:}dt4}it.}jt(}ot"}ct}pt}qt}rt }sDž|Dž ݝ|DžP+ۿDž0Dž #u5,-54->tjV'#u =h4h}ouNDž0hVh +"<.F"uEE= w$@Wh<-4j̩+;}=tKt; <#uH-PVQWjhT-Wj{#t 8 cݔ,=tKt/$Vh@u5`-VVM/#uO=hm 4hP逺jP%#M=h< 4hOVl+Dž0E=$t0,ݝ|0,]Eݝ|4hthS j݅4܅,ݝ|݅4܍,ݝ|݅,ܥ4ݝ|݅,ݝ|ݝ| l݅4z"u Dž0=hGx݅,}eu ]E뢐840,]E lk0,݅, z*s(Dž0=h4h}hf0,EaP844 ݝ|݅,zu݅4 zv' zGsE݅| z3u1Dž0=hs4h840,݅, z*s(Dž0=h4h0,_Q0,S50,G0,;݅,݅4ћzd_݅,݅4ћvA#t+Dž0=ht4hh 0: =uA# #u9}pu3]E$h$@jG]E=܅|ݝ|#~ Sh, 5h8V |Vhm=-u DžP5lhhh-jP"t/P<.tD;~Ɔ0F"u݉P<.+#|#u }pnF#~U+;}=uĉ]؋P=u#u2;~Ƃ0@U;E|ƂhZH;P=+;~ ƀ000׳ƀH;Ƴ}ttF}ut@}vt:}xt4}yt.}zt(}{t"}|t}}t}~t}t }wV++Dž0Dž }uw}}8K94hDh (#u=huDž0hS5$γ}}!=h|4hh鏳(#t:#|;5~<=h-4h@=h4h"VDDž0}tu~ +ShЬDž0=h4hج鷲V*D$h頲VD$h録@tWh vVD$h`}}=h)4h<M'#t1E=$=h4h<۱jjjh|jWhhV:jjVD8jjV-8#}8Dž0=h5,4Wh`j뱃}xu}{t}|t }}Wh E= w$Գ}u1t}%Dž hհ}t }ujDž -}n}u j P! #=h)4h<}kDž -}P=t(Dž0=h4hׯ= ++ۋAtP=0=9  Cwh >=A| =F{Dž0=h4hԭƮ}Dž -}5 +j.S- #t,CG|鮭Dž0=h4h$}Dž0Dž }}=h4h@߭"#t"#u=h4h`靭 $$ #=ht64hIDž0=ht4h$+E;E}}u#t PF;| D05lhh-j  #u5-Dž ->t+V!E >t54ḫ 4hh Dž 5=ltH+HPVh-jm=ht hՐ -[^_ÐUVEPE#t8u)-??^ÐA|H u0Ɉ H +Ej4P #tF |܋= r@= }01  0PUV3Ph5LV ^ÐUWVS}#u=-WLE=ht5 58=}WhV? h(V-8E5E]SEPW #}S5XWh(ZJ#~ h+Wh-h-jT$Է "#}:PhD65thL$ l94hT  P+EPq+ȍ5h/5bhj轔$h 5\VhV> ^QƁD4X#ShV/E@G5/hlV5.VQPhĶVpƀ/ƀ|n58Vh̷[ShhV]=$ hW*$V) EPwE#!8ȊAA  AAA E@E=|>hhpE#u.hP@#u=-hWVO W=}</t/xv-j-^+V9K:@::+ X.t.x.=Jt =Ju|... ".HLTr3f([hN.B.6.*///@=Ju=@u`h ,KD /C#u/~C,u#u/bCTY#u/FCX=#u/-CL!#u /CP#u$/C\#u(/C`#u,/C<#u0/C@#u4/CDy#u8/fCH]#u1M#}JEMMEE#|#k5/hL3hP3EEHE#5/hh3hl3s=f=m=s=v@ |$fD$f fD$l$|$l$D$T$ UWVh0mL#u%+ LAfA+ҹ@+ʍh##u h<q>Wh9#u h<M>Wl9#u h<.>Wp9#u h=>W袶t9#u h ==W胶x9#u h@==Wd|9#u h`==WE9#u h==W&4#u h=t==4u#h4#u h=H=Wֵ #u h=$=W践L#u h>=W蘵 #u h ><ƹ=l#} h@><h90p90l90t90x90|9090K 45  1 @ t @ tKƹ =53蘼854hd>D0505ht>105p5h>055h> 055h>/h@6h>V.E=~ @LfDh8h>(.E=~ @LfDh|7h>-E=~ @LfDhL8h>-E=~ @LfD5thhSj =Jt5tEPEPSy =:EuEP\vuhS EPEPS~y ~uEP#v++;tC}]E+WhļhP跲 x4hP\.=@t#}tE+E+Ex4pP#}2hмx4#thؼx4#t#}hx4ű#t~EC 5ƅh\ƅi%C0jƅkx4hPm-}EG;=t}]=@t4@Sh>3-~4Sx0hpx0h>,σ~"5p}} E@: 5:Ɖ5:H5`Lƅh~:;[^_ÐUWV+=;u+=t4433ƀ3LTG5h>h>jd5Jh>h>jc=Jt'4I#u4P545TGXX=uL: TG#t)PQ, TG9/uhQ TG54Qίj5Lh ?jKch5LD#t5K5F5LH@P~ K L#tQP} LhQ54S @  h94  p94 l9L t9L x9L |9L  9T  4K5 h$?h(?jb @  @ KT @ t%5L.Ph>X =u#_5453V-Vĭ#~H#~3/8H#^_ÐUV=;uh5@@N#/+5K5F5LU@P苭 K#t5@@P苭 @  @  RKT  Rt h94 p94  l9D  t9D  x9D |9L  9L  4 K j5@@h9<t3h6D }t ;M=I}4=uf K~[ A tN5q #@ =u K~ A u=#jhChCjL I=D"Ph DhDjL  $9tQP; $MhP#};L +[^_àL}M9 |j5 h$Dj0LQP蹘 $=t54贠5q~=u͋ $ 9uj K4hP#}L=}1 =u5j5 h(EjG=u=K} hDEx=4#5 謓؍CPޓ#5 WLD< u;v I< u;w< t;v I9 t;w;vA;r5q蚝<$5 萓WǓ54蝛5 h8N=r$TUWVS} WhEhEjF5:hEhEjF]S谒$ShEjdFE##E=:u&=Kt WSV SW/;tB+;}:3=KtPX Pj/#|R5:|)F;|ƃ=Jt/=Kt WSON="t=Kt SWS/EDE[^_ÐUD@DED@=P|PhH+UWV}WhEhEjE#|K4D#t5#t PؑF#t PȑƋv#t P趑#uD^_UWVS+YEj}WhFhFiE#&jPj@uDb D#t @#u#;\{&uzPEPSW #} u Dž+QuY5LP耐Y3EYkPEPSGZ #TShxSh5  j5 h(FjtCLEEEPEP5  j5Lh}j =Jt }t9=Bt - -#tu+ظ t=~P[AP#~P9AP#5WA#EE#f=tqu5=X@p+4\@K=(F|I^ÐUE#u.} tF-F%F} uG=tGÐUVu#u5G>t.FF"t&<u +^U WVS] S>#t}}1΋+ɋuN};}{u+Eu v4f#tuu 4Q #u +E#tuu t ( #m}oF;u|u] EPSE@t #M[^_ÐUWVS} W>#tM} [^_Ð+;}E}v4蚆;Euuu 4t #tF;u|뵐UWVS} #u=GWX=|M} [^_Ð+;}}E}v4;Euuu4 #tF;u|벐UM E#tQPh0 Ph$0+ÐU WVSEEu 6蓅#~=}EES4hGj59]]G4_#Չ}EEuh,Gh0Gj8ShDGhHGj8uuh`Gj8}}VGuh87/juhtGj8WuW][^_ÐE@P#tE8t]PW貄C8uWpVWhGj!8;utjhGhGj8hX}.eUWVS+u#VEYuVhGj7} u+EPhGhGu ȃEPu hHjv7})}<\uF<%YVY^"}+ u W诃0;92 "#}&<4%QhHhHj6W7Qh4Hh8Hj6W ",Y@P讪t S?؉<4%jhTHhXHjS6cE@P躂#hxShHhHj6h,Vhy,P‚ LE!~5xWVe<&<jVhlHj5EPEPV`H #|=uuJ#}wkdVh+N+J@u WˁLM|LfDX=Yt WVR[^_YVLYEE`L#]}~%E@P-#Hu W7+EE@PZ#VhJ)LM#p+wUWVSu#}I@I X I< X IL| X ILf|+[^_áLv =YtjQL +#tQ~L<LL#tQ~L|L X;K vT LTTLfTfTF XL;| UWVu#jVhIjv1<\uF<%V""=09 ‹DŽ‹<4%4%#tjWhIj0W}jh Ih4Ij0=YtjV  !|~~+MF<4PVhIj~0EPVQ4 E#|P^_Ð<&EPEPVC #|EE<`L#tM; #tFjPhDIj/M}t4|M=Yt#jV!jhTIhhIj/VEPVhxIj/X L}PVQ UWVSX++@ L< L| Lf|@=|Ծ+V{,Y< +Ƀ } ,Y#t=#u htfu @C_4PW? #u h.C|UWVS] #) =JtXhhh$huhhh0UlJPAjsJP#|#5h:4$&Yo[ Lt4c *h#u h5+h+ +X;}+L4 20Z4ZL28ZG;|ۍuVh0Z54jPhMh Mh$Mj]S芼(}Wj54jjh4Mh8Mhԏ"u4h5NE#thPhԏ o ԏԏ"t ԏ NPh=ԏ=ԓt ԓNPh=TN=Lh l+L#tPh0QF|h@>L#tPhh"lhtYG=Jt=JthI=tKt  NPh=Kt$SNPh=Kt 0!OPhc=Ku=ptnK=ubK#t=u OO OPhh =KuKPhh,h4=KZ,OU_5HLE$hx5XL*$he5hL$hJhL=Ku=t=u/=HLt&hh(;h,#t=u =HLt=t=u =HLu=lL~ 8O uF> tE2j-hj hh0TJE;E KH9E}},K9;~#tME;F#j h;@; K;~#u+[^_Ð;UU E "t:t B "t:u:u+UPWVS5<@<uF5<|Eu@= u=;uPh"N?= u=;uRh5<@F5<<[^_Ë~f=),W#]= R=w0$4=|&=^=w$TJ ]t RCˆG<@<u+<t RVC=hu/<></<=ot=qt=tt=xtM8E"PЃ ~P;>ډ8A"uTUVu #}+^E#}؉Eft#t؋u Eft#t#u빐UV=4^u&50O450Vi0^ÐUVS4*t/t%t &450=%uZ 0#u4=;u hl50B50502ƙ/t£0!50=&t=*t=/t4*c/Z%Q&H[^ÐUM~ IUÐUWVS+ɋu#}މuU #}ډU #t#u2 [^_% u AuU % tt[tV#tR#tNuU %#u ft#ut;}Ƌ+t t#t#u#t#O2LUWVS4Ph0P#5t=@t=|t4PV##;[^_ÐU ÐU,4=4Et)= u=;u h@0ÐUV5;;u 5;^UVE#uHP=LP5@<\5hPhV= =@uŋ^ÐU4EEEPEPVn PE#t8thPP\ Ps##uw+P;DC}*U WVS+ɋE] +uV=9;}<>]tGV)9;|Vh,VhPVhhVh9 h*fEVhB=4u h=u͸V:#|ŋM+[^_hV|VZ ƀ|\u}&u}8&)H?~ [} H_| zx[t=pɉ X+@"t!<[uB<]uJ#tCAG}"u<]I< t< u I< t< tA< t< u A< t< tDžPPQql u G? tWhXPh\Pj?;W#t9t QVX7Vq#X=BUE=@u`#|=<`Lu 9E ÐUWVuVhlPhpPj.} WhPhPjWVxWhPhPjơ#|~>2 +DŽ `L+^_Ð ++#| `L + 뮐UWV}<\uG<%tJ<&tFVh<Vh\hVhW:5=|<%uu<&[VhOtE 8E`uuAMFh1uu#|ڋEM EM^_Ð<%l<&uEPEPW WhPhPj#}[bU WVu>\tVh8V4 DžPPVh #|Suƅ0ƅm#t*Q }5M +^_ÐQFPm#u֐UVEPuV#})ȉMP[W$V+^ÐEM }u+EԐUWVSYE5"hPhPj]ShPhPjp"@"=@PhPhPjE "hD!PhQhQj" hd+BEYjjj@u =YtL405 hR [^_ÐM4I LT1CT1Du 9PY"P4ChQjo @ =b" h9  p9+ l9L t9L x9L |9L 9L  4K @  @ "Tˀ @L"P4 h0Qjau8" #t(PQh@Qj;j" PDXjL40hXQj L40hdQL40"4,YW|%~=Y|G0}SG |U WVS+ۋE0E 8jVhlQjtF< uF< tO<{EUJU> uF> t ;AG"tHE=AG"uO"t\M]U<{uE<(uA<)u[I#}V\G{G4G1G}GAFF"u] ])}GFOE0E 8#tMC_]<}u M}tȈ}J}#"tċMI|FG"u믐+[^_ÐU$WVS}EPEEPhxQj }EEE+}t+҉U;U +M A+M܋]W<_E#tM MMMM]M AAMM#t!"t'}A< t< t4]MM ]EE}th;u tcF}tO }F0}Wh|U;u <"#}Wh|9#W,YP+U E<]#ug}~aF}tT }F0}Wh|;u :"#}Wh|̨!W,YPTE<}t4"N#} :  ,Y`L5[^_Ð<{u<}u#u yEEC[ EKE@<}uK#u}u#|(< t!< t}u}t;u u]F}< t< }t;u }E+;u AMF}tQ }F0}Wh|腧;u 7"#}Wh|iW,YP[SE<}UWVSuVhQhQj5:hQhQj}#u+[^_Ð"#} : E;|uN=tKtJVhQhQjShQhQjz~4hQhQjZE\E%E;AG0E#} jp j,YP:R } EPqG;~E+;EuuG0EWVhQjU#}Fpp }E4p%PQ,,Y4V蠥 ,Y |G;}~Eu;}OG0E#}%p }/j%PRQ,YEP}G;}~~)4)5: UWV}b~#} b=:E5:M#ubQ>Qh:P{Phw@#u h)54PEP5:hR?#|6u5L(LEjPhXRjz}#}b^_Ðu#ubu`bb+#t[Wh:O=X@tD+4\@=G|$jjjjj54\@P#H=X@;=K.Yk#!UV+=!th!)/!5^ÐUWVS} #u=`R]3?F=<~,h K;~袲#tmFhK;~ v#tA+<*+WhE<Wh3+[^_ÐW.&HM <D<PhdRhhRj5 KhxRh|RjJ=(~HO9<shFK;9薱#*XUWV<#+++΍<,B<,hP7M<B<,hPMWh5L7% <B<,5LPLVh 5L$ <B<,5LPLVh5L$ <B<,5LPbL<B<,h,P?L<B<,h8PL<B<,hDPK<B<,hPPK<B<,h\PK<B<,hhPK<B<,hxPmK<B<,hPJK<B<,hP'Kjh5LN# <B<,5LPJhh5L# <B<,5LPJj <B<,5LPFVh5L <B<,5LPF<B<,hPF<B<,hP`F<B<,hP=F<B<,hPF<B<,hPE<B<,hPE<B<,h(PE<B<,h4PE<B<,h@PkE<B<,hPPHE<B<,h`P%E<B<,hpPE<B<,hPD<B<,hPD<B<,hPD<B<,hPvD<B<,hPSD<B<,hP0D<B<,hP D<B<,hPC<B<,hPC<B<,hPC<B<,hPC<B<,hP^C<B<,h P;C<B<,h,PC<B<,h8PB<B<,hDPB<B<,hPPB<B<,h\PB<B<,hhPiB<B<,htPFB<B<,h|P#B<B<,hPB<B<,hPA<B<,hPA<B<,hPA<B<,hPtA<B<,hPQA<B<,hP.A<B<,hP A<B<,hP@<B<,hP@<B<,hP@<B<,h$P@<B<,h4P\@<B<,hDP9@<B<,hTP@<B<,hdP?<B<,hpP?<B<,hP?<B<,hP?<B<,hPg?<B<,hPD?<B<,hP!?<B<,hP><B<,hP><B<,hP><B<,hP><B<,hPr><B<,hPO><B<,hP,><B<,h(P ><B<,h8P=<B<,hDP=<B<,hPP=<B<,h\P}=<B<,hhPZ=hRht5L~ <B<,5LP=5<hRhRjjjj5<jh,G^_ÐUWVEhhRhRj;5<hRhRj|5$/hhE@E K;~p#Eh諾E@E K;~;#REhvE@E K;~#EhAE@E K;~џ#Eh E@E K;~蜟#Eh,׽E@E K;~g#~EhT袽E@E K;~2#IEhmE@E K;~#Eh8E@E K;~Ȟ#EhE@E K;~蓞#Eh0μE@E K;~^#uEhX虼E@E K;~)#@EhdE@E K;~# Eh/E@E K;~违#EhE@E K;~芝#EhŻE@E K;~U#lEh萻E@E K;~ #7Eh[E@E K;~#Eh<&E@E K;~趜#EhLE@E K;~聜#Eh`輺E@E K;~L#cEhh臺E@E K;~#.EhRE@E K;~#EhE@E K;~譛#EhE@E K;~x#Eh賹E@E K;~C#ZEhH~E@E K;~#%Eh\DE@E K;~Ԛ#E#u5h| E@E K;~蛚#EhָE@E K;~f#}Eh衸E@E K;~1#HE=$kt$kRPhTE@E K;~#E=(lt(lRPhE@E K;~藙#E=,mt ,m SPh跷E@E K;~G#^E=0nt 0n SPhgE@E K;~#E=4ot4o(SPhE@E K;~誘#E58S#u5HS>u5LShʶE@E K;~Z#tuEVh 蘶E@E K;~(#tCEh\ShhSh] E@E K;9#%+ |SPh<5L 5LV#thSV#tjhX5L 5LV|#tjhl5L 5LVT#ejhx5LS 5LV(#9jh5L' 5LV# jh5L 5LV#jh5L 5LV#jh5L 5LVx#hSVb#shSVL#]5h5LG 5LV#-5h5L 5LV#hSV+^_ÐE+u;=<}!4,V#G;=<|hxSV#=\VSUWVSEuVjhXhghgC4\#B=hF+PuhuG:+h.+h5XW * }\u<%t<&uE\E<%t<&u"hbh`u \#9Et \\#j =9SX#u h&5SPj b \P5Xh,gj諺=\}j 謻u5XS5Xu{#54hThLghPg5\#7+ۃ=Tu TgJP谠<$h!s5T]+$-hTN5qT6uj5q=S`4=t544b:#~:Vuo=DD54hghg5D7h78`#}#==1=AZ#|}{gnJP!5:O`JPZ=`~VH#u ht `ƅPu{\PuhgjK=\h! =`b=Kh|臮v5\{ED6u h[=`X8Pu\Puhhj蘷h! :=\DEDI{\j){=`==gjhXhgW1`P5XhhjV =`t[^_ÐUWVutu +#t 4+PhXh hh$h-\#}u=hWhݬ+bP5`W% #|qh5XW$ 54h`j h8hh@h\#|.]W\#| t9k+i^_U WVS+7E7X+Ƀ}t'=`.u=atXaa^ X#}XYtXu54PhPhhThjPhphhthb,\#=hh$^QhNUJiPhL$+$XtYt XQ X=kQSE\u<%t<&uC<%t<&.hbh`S \#~}zuBjhXhhhhjhXhlihpi.\#E55`hhhhj腳}t2jhhhh5p[h@[2##~7\=jhXhhhh-\#5X$XjShhjj5Xh ijShDijѲj5XhXij躲 XIjShij蝲j5Xhij膲5X#X X9S迀=uhbh`S \#`=`35bPw#DjhXh ih$i,\#p}z}t6jhihi5p[h@[:1#|9X#~ 7XjPhihiH,\#[^_Ð7tXu5DžLTGPhTGQ2 LXȃu)Q:$5LLƀ XQ)$5Xhijذ5XSx\#97XjUb#u jUE#|;b=~ j PÐUU #ujq@l‹M,t\1tW'tRtM_tE7t@t8)t3+t.*t)$t$t`t0tt !tfu:0tÐUWVS=buI} WuV ,#u;+;}4V#t C;,|+ [^_+;}4W#tC;,|ϐUV#tW5XP5Lqt #|>5"juPY #~&";~jX"; +^UWVSbEE P XuQhjj藮EL#tP\EL X#uBh\hhh4Ƥuh谤}t #u$jE}t #u(jE}t #u,jUࡄ#u0jEƅM9+1EHuQuuhSEHE}u=4j}t 5#u58juVh4hbuV5Xu`PWuuh<Sc(M X}t#u=pjuQWuhS)#u|juV5XuWuRhS$}t =#u=tj}t 5#u5xj=t#ujuV5XWuRhS tl}t =#u}t =#u=Dj5HjuV5XuWuuhS'$uVhhbSELPE䣐b+[^_+A Xƅ`=u } ot< t< uA X< t< t#tC<(t(t5`FA X"t~A XƄ5`#`W-+ƅHH5X t uF5X t t#t+)t*tHBF5X"t~F5XƄH`PSV E X< t< uA X< t< t"U:<-t<.uA X<-t<.t"uI X`P5#t=#X} o>uuu`==u} otuhP`=uLEHE}t =#u=tVH#~<  H#EjPjVw|uDj@=|w}uh0E8UXWVSEE+ۋ}#=lWiE=oh#X]EȉE؋EĉEEEE̋EEEbE+EE4\#t Vw+GiuEEKEAEh`ۖh|ΖEMMuP}ut;=l(h<4E#Eb= t}u4hDNG}uEEEEjuSVA#}}S>AV@P#VSjEPjSE#8;E#8+uEE#8=tvjjhjPa#t`jjhjuI#tHjjhju1#t0jjhju#tjjhku#uE#t SM}u}t }u{}uu} }EH=uVh(訔jhk%#_Su4s#+EEhX[hNhA#t V+h#t Vc=bT(kPWhp 4]=Hu h输E]}tjSjjSjVݺE#P9E=E9E}t 9Ejuuu9#E#P=m@P #uSb=S@bP=b#t PE@Pb#+hH}]hPh 膒 b}]}]#t Vb##} oC,k>u;Eujuu5b#P+ۋẺEEЉE}zE+b;X P#tQPbG;|.[^_ÐUWVS+EE5P]S5LEPu=PWjjjojL5#u  jPV/ uWuhLjSjEP[^_U\WVSE+EEEEEE+EEPhDkhHkjPPhXkjbEȡ#t'P}}=u E E}ru3E(bjhlkhpkj蓙E#bjhkhkjgXE= uE}o=J?h豏Yh袏5XDhkh舏X&hXoX hV+Ch7+X#ul8tP5bh  u hَX E jhx褎}~ M JM J =J}'=bu=Jh=Ku =b=Ju,=bu#=lI}hHh #X}Su8\# }qu754EPj hkhkX\# E 뭐=l~ k kE b#u l54hXQuE#N X#tIQh5X5 * ~ X9{u|9}uD9X}q++=buFPL+P%PL#t P LF| P#u#uX+ X#u b X#u6}o}Su l4lPh;Q=bW  b X+5lQh\lj{+ۋ X=l~JuQ#u2}ouhlllP5Xh蝋 X XVQhlj#} }o#EE<=u#A XE9 uhA X9 tZ 8{uNx{uHhhPP0 5 W XtPH(tE=ft<Pɵ fL}5fh P輵 XteP脵H9 $c@P訵$c c#P$c c4蔵$cWYXPh L_0tr"u ,te= K~0Pд= K#t+EEEK9E@#"\4$E؋E XEԋ,E80htTEȋ`EPEE쉅}t<4t4$4DžS}k+tSu5 OH ? 1 'tσtt˃t5@P5$cj5 c&+;$cu苵8hE c4h =]$c}H;|}t{= K~E c4= K#t + c4虲= KFK;~h>#+$c$cC;Ku#}uss}u s s}ussPuQuRuh <\EȉEE5H ]EP ћz.s,$h \ '$h0 [ X zsh@ [S|DžSeSWU=Lu E=ui+=ust54hXh0tP`#h5X5  X\#|zLTGh #u5XPh 5TG蜰j5Lh4tj)d5Lc`=ÐUE =7M HM DM @M 4M 0M ,M tM `M \M XM TM PMJ#u |M xM dM 3GQhhNCK;~U0#+ۋ Q{ 9tT}hPjjuuuuuuQ( =}~GQh m]}ȋEE}؃}H}~ hNEK9E~ /#}tuu#t uut u u#t uu#t =u=uWPQVRSuhoM }tDQh45L% j5LP#^=t =P QDeE }tuE}YGQhD!}|ZQh5 d #}uE}GQhX}}GQ[ #tQh|Qh}r5 h2LZ[^_U h9<uTG@TG #~=jhXhwhw\#|Ah5(薗#jhXhwhw\#][^_UV5w ;#th AhXA4$Vh~A VVhoA hbAh4UAhhHAh;Ah.AK;~"#n+h<@h@K;~"#4+h@K;~X"#+h@h@K;~"#+h8^@K;~!#+h`1@K;~ !#tw+h@FK;~ !#tP+h?K;~ t!#t'+h?FK;~M!#u+hX?^ÐUWVS++u#u5x>uK?7"u++ˍ4VhxhxjH[^_jVhxjHtHFt LF<:uFlXFt \F<I<:GF.xFt |F< > UWVS$x+guuTx(xx >t]t]u x xEPj54jjhxQRjEPT(jj54jjhxhxhxjEP)(EP]`#u`5 h`P=jI2gPhDyhHyjF+GP*%=b ȃ>t#h<4`50#|čEEEPI+E P耓+EEP]+ȋEEEP<E;}ÀQ+,#W=\ShxhxjREb54hxhx5Zh8Z\#}=>=E54hxhy5<[hZVb#v 4XtuQMQPh yhyQPhyh yϻb##}uXu P #thXP5 Ðb#}l=t b#54h,yh0y5ZhZk\=t# bG\#j~`=TtJP=*]u5 `#+>]teu=Tu5`#5 Q =u$QhDu9=d]QwX#u@yX@yj PhP3 == tt=Tt-\##u^>=bt90ShXyh\yj4B#b#;`#o5 PuN=Kh5 vX#ulyXlySPۍ#+&u=u =`= 5 g`+ g`#[^_ÐUWVS++E+EEEPhV54j5xWhpyhtyhxyjEP(jj54jjhyhyhyjEP(EP#,=0Xyr+lEcYEOEC4=t#t=t=t=t=t=t=t#JEE̋EEE܉E؃=4 hhhhh866$5Lhx 6JP@&=-JP &#t hl5S]}E#t SA#t W4}~EE5L6h5X5LI 5L LDT54hXhyhy#}= TL+P5XQج \#[#t }\j5Lhyj>j5Thyj=5L谔#!5TL=~O=JtFK#t=Ju 4Mu#t =J4M=J#t5T5Lhh3 }t}tEEL}#}}5TPf#=vw5T5LhPj3 E5LhP3+h:3h&3h3$(5Th(2EElhxPM#H#tyyP5T"#X}]}}ȋE؉EЍVhu0 uj6jSƙ#uL}fukT+;   ˆ ;|Y]}Vh1-]}5T2]}h1EThVWS# ]}h}#t yzP5TƋ#uW׋5T]}E؉EԍujPjWɋjPTPVW蜿#|u}t;fu|+;}.+TUTˈU;|؋#~ uPjTP越=#j]}h]}h}tvƅRPWjjVȃPu QƅPh/PPQPh Sv.=u:#!OWjjV{=|0SjjVƉ=}5T0EE]}[^_ÐUHWVS++ۍEPhU54j5|Vhzh zhzj}W(jj54jjh(zh,zh0zjEPo(W#,=0X,#+4#t=t=t=t#t=4h@hj.5T5LhN. <=t*j5LhDzj7j5ThXzj}7 LT#tPQh- LTPQ_#_#t h-h5X5L菥 5L1 LDT54hXh4zh8zM#} =4 TL+P5XQ" \#[^_UWV "#Qh,VW݂"< j4 hzj6ZP腂 " #tPɂ " #u  j PթLTGEu#u5hzEPhTGV׶ =~e5LjVhlzjK" jh|zjA5jU5"hzhzj5"##  @<jhR " #\jh˂ " #3jh袂 " # jhy #=Yt7">tVPh * Ph4*m5"hzhzj3VE# "< +^_ÐUWV+54hzhz5\ht[#udhH5hx-h%hh8hT hh)uh )vES S#tQS@PaS#t5Lj |.$=SuS@P!S#E5Lj L5Lh(h j5Lj /jjPͨ #}+Ƀ u=  Ih\V(.h>(+j ^=#54uVEPhzhz#}}t hyhu5Lȟ 5Lj}=54Vj hzhz,#}|#=L j <#~ h54EPh{h {kE#}=.hu5L 5L|= E#=Lthtij ;#~h554EPh,{h0{迪E#}=>hu5LM 5L{=a0E#5Lj I#=54EPhP{hT{Ў#j :#~ h0G+84,0(+ɉ $ Du+<hu5LO 5Lz=c2E#_^_Ð u=^,YF=w$hhTrUWVSEEEE+5t{]Sh{h{j.HH++A~5{ 5{5{DžDžH5{Dž5{Dž@5{Dž@{5{Ef]}}EE؋]E܉Eԃ} :}}n:}U}d}w}tWVh{j,Sh{h{j,#u*=,Kt!Vh"`[^_#t 5|5D|#t 4ZX#t X |WPQ54jRhd|hh|VjP(#u}tS#t l| |,Ktt #t+4hVjPjjh|h|Qj&hVj54jjh|h|h|jPp(+MM}]jjjjjh|h|h|jP<(}t Dž|El8`hDŽG5XP_wDŽ+5XP@wDŽP`Ph|h|jb*=`,=ui~=:t==u+#t ~#u ~=4Wh|h|j)<$ }Ph|~h~j)LM  M+ ,=h505L .QP5  5 u#~Ej5Mh~j5)uh~h~j)5M茚M}:@jh~h~j(jhXh~h~蕣`#} ='=h5X5  hhh=Lu=Hh@dh|ZhRhJhC5`P5(hl~j'`}P#Hh(JZ}Ph3C54hd,h =%Ph` h h h$ h  Mk Ph iV 5 Mh P= 5 Mr\P5 Mhj& \# M|/tP}# MjPhĀj[&=Z@X#!hPh赔 5 M4 MuWP8rPjr M#t5hPh V+rV~Vr M#P># Mh5M5xV 5Vhjc%j5 Mh jL% h`` #54hXh}h}S`#|;#t Pq5Xq\ȁJ=y #X }u  }\}u4+RPQS躛`#|N#tPq5X訕XPZp\#=r 0}+#T}jhXh}h}`#% 5XXPo\##tPLp \AQo#zSh}h}j6##jhXh}h~q`#}=w (~X(~XP]XPo\ȉ5`;}X<\u|vt @`;|;DŽ#tPXo5Xn\#AQn##54h,~h4~5h &#|54h8~hH~5ēht`#EH#<54hL~hP~5Ph4`#=}=0#QP5L #jhXhh貀`P5Xh,j!`#} =u=t1h5X5 k g`#N>V5 Mh<j #u%T #thPQ 5 M Mj5MhLj^ j5 Mh\jG M8u.} }n}}|@~C` M8=L=HPhlhpjH~ ~E~E~jh #ujj.#P#},Ktt~#tu#t M8u h,K ~ KE8G< G @5G5DGHGL0GP0KT@KKXK\K`,KӋD~5GD~5G΋D~5G#t 5G5GD~ 0GD~ 0KE~ @KE~ KE~ K E=~KRhhj5K5 Mhj}K4KXKKHPhhPKKHjhh$KKHPhhjK8`Phhj5Hh(h,j}~QHx|#u!H1|PhPh@PhH#uЃ}EE=Jt huLhuos#ulCPoh#tZuV}hC|/t /CXV t`Vh=`}uh #uhxL裏}~]E=Jt h8 &#u<8u hh  P迌$h|LVjh@hDj }~ Lh~ +PhXh\jE=~& K XKPhlhpjM~%Kp KQhhj}tvLooH+~HH~ H ~O HFLvv8Lhh,Ljj!#u؃ۃHLrrSPhhj=Ktt K`=+#t PPfF|UWVS\#uT]5"hh 5"h<h@j="1E%E+G0ET,] "u4%hPS "4|99P貌]=LKt""Sn"=LKth| hz ,  l9D  t9D  x9D  |9D  9D  4DG  "T< u6:`L:r5,Y5 <$Y`L,Y4 WB54Y`L,YU +[^_ÐUu)A=@|UWVS} EE/u5\5d it5p=tKt_WVh|jF5 hhj,5"hhj5Khhjj]SVjj>S]Sd }:tE:]C<.t< t"u&ShT!Vht!* [= tSaEPSVjt #]܉} űEԉE]ЍI=#"} /u 4D4CVRa+ExWVhȁj+ɉM;M܉Mu]MM}M {uEM}t}t },ux+m#t _:u#RUL+ L"tF?!|,t @B "uuuh܁j(VWhj}t@DžH>DHPDPW< j?SWd ƅ5uuhjVWhj}tvj  x94uWE#t+EjPWuވ#tg}$}jVWP賈#"9u뱐EEM9M9MM܋u]MMEE܋u]EE}uuh0jWuh@j9}N5 hPhTj#W5" ##I=<jh!Rl` #tljh!"H` #tHjh!"$` #t$jh!"` #u1jUb5 hlhpj  QVhj#uh!-jLPhjO"4C+Euh!+[^_Ð=~Eu uhĂjK} /u PeKF@ }Ph5Lc #KFL t u @ t t:uxl+ "t!|BlF "u;~jQuP蚅#tG#t'L܂}jVQPo#tK@ +} }E}5 hhj#e #e #2]Sh"QUWVS+}#u="tr<\uuG"tn+<\tZt P"\<%tA<&u#[ujjjWh #~$<$tL85Xh5Lg #}:h|7h臹5Xh5L6 #} h$NV ?5L>DP-?#h$[^_ÐUWV5 }WhjuKh(%WmC K+#uwWjWh$j3 KEjhdhhj KHK4Ch0%j5+4F @ Ph4h8j5KhLhPj= b^K#tPL>K4W=@P= K#t WP= h94 p94  l9D  t9D  x9D  |9D 9L  4 K   R   RKD   RD D =YtW5 hh% ^_ÐUV54hhjhLo#}E0 #}^UV54hhjh0Xo#}E0 7#}^UVuVhhjh|%nȤ5,Ph% JPh%2.#|E=~9E 蜐#|ۋE M^Ðu˃=4t̤뀐UWVS Ԥ;54EPj uQK;#} 5(:p#t(<0 u0N#u# (#tVyuPVh% 5(h%Qh&Ph(&PI<^u؀yuqt V:>v`s[#|ŋހ@ËM [^_Ð7#|E 0␐E=~ =k#tE벐UWVSEEEEEEE}Whdjj5НhHhLhPjEP(hVjjjjhhhlhpjWݏ(jjjjjhhhjV蹏(`d:E1HE$EEE EEP蠏#h,=ul@<:t<=u+#t 8 4#[#t54hhjhL{k#[u܋}MMMMMM]=h505L$Z L#sh&hP&`Sh|&PPRQh0'=uht')=tPh&RQh\' #g54hj hhG#0#Oj5Vhĥh̥a#5[j P@WX @"+0"tW<:t "uhhQkk S#t8t jPS|X Sp#wS8`F"\gN uh'`ShhjIWh$h(j4WuuuSVXg%5h&5 N5 jhhjjEPh5 `#} =jhhj u5 5 E#jhhjP(P,P5X #}5h&,~`(~d4`L#u5h'd`#}Dž`#}d;F4+@E=p}}E}}E}t x9<#|EԀ8P#;`L#d9 5uh'[^_ÐUWVS+] u#u54>tYV2=|I|~uB ;r tIH;r u#tV;r 9~uy.tHPPh8jFWy4[^_ÐUWV+hD5V\ d=~!#tPXPV/ `=~ G#t d tPV X=~)GPhh'5 15 V \=~G#t PV h=~ G#t  PVw l=~G#tĦЦPVN #uhܦV< hV. ^_ÐU$WVSEEEEElEfEZEQEFE:0++E"EE E54hh5Thԝc#|T8:t=u+#t 8#u 8=$x(MMMMuu}]=-#~X~=\~5l}~Eh}~Ed}~E` hX(|h'hh(E:t=u*54EPj hh ?#|#E#| = j h((%[^_ÐU WVSDžhDžHDžLDžTDžPDž0Dž,Dž`+EEDž8DžXDž4Dž\DždDž(Dž$Dž DžDžX=~ء\=~Ll=~T+!WtTI`S,_Vhԝ54j5Th0h4h8jPP((Pj54jjhPhThXjV(jjjjjh\h`hdjPу(}}dE\EX8EEEEȉẺ]TELE܋HEhlPP藃#,=4E<:t}=u+#t 4t#u 4u"4wY$*E艅8h(E艅8h)hX)hp)B6E艅8j h()(E艅85(h) Dž4 M艍84 E艅8Dž4 M艍8=c4 h)Dž4 h`*zj E䉅`EP}O Eԉ`EP}2 Dž}:t}=u554Pj hhhp;##= EEEEE+DžlEEEyEjE[TIJTI:E-KE =t=E5(PFQ54jhhhuz#|F tuO5 뵐M艍8=5$느5wt׃tE54Pj hh9#F4= = }u-}EdE\XM艍8!EdE\XE艅8EEẺEȋ]ETE܉LEHlhL}t50h)P( h)P5(}u }#X=JWT} TE8~1ht اPS5h)E=KtP5L"$+;fp+dx\|XE`E䋅PE}]TELHE}tPjjx| $(4{Z(=}}#T4h*}554hhȧḩVQ#F5#+}tE4h,*5 & j5 #=t =}t4+=~N#t, <*}tP4Q E 4hL*E#u#t}tCK; F;pG;} Dž`L,5@jjVj5V++;EpUd<\@XD]ċ`Eԋ,t0EPE}uTELEPw|t pH9Eu DžtDtPjj<@ $(PW(=}Ph*FK;肯#z+E؉E]+;}} +MčEEt@PP$ ƄD#~!PPE#+;}}*EċM;MG;|EĉM Etu0}ZjPPK#4EtE+E;ELEċEPPhj};}EE؋]EЉEP4 #;E}t4+#}E#t9 *#}$ }u0P4Q EH4h*0EĉMEH;H;#u#t$}tFK;~7#/+G;}}}Ph*LFK;{ݬ#+gEp9Ex`=~TI`S=~S4}4+[^_Ã8t)#t < @P`h* ` P뫐UWV54hThX5LhOS#}Fpju =(KuV=(L5.54hxhjhR#|t#}^_ÐULWVSu4#Phh5DhR#= h@+h+h+h+JPh,: hd+"+ @K  =Ju5L5LhbF=X M jXPP-F0 $  h@ h<,6 h Wh$jSBL $QP 0$  Phh5hP#Z = 'K=X$\,54hj hĨh̨.# =t ="Ur#=u;KYKI@9@.=t!#t  ]#t+Ph354j59h hQj}Ws(jj54jjhhhjSr(W+s#=,u4@(!h505L*> =L q##$$ȃ=,$==0== $8854Ph@5|hHN#sp#J54hdht5ēh@N#+p##th+Q>$h=,KEKK54hj j>$h?+#;o#)#phPe>$h;#t ȏ #t ď54hhȩPQ$M#o#KK#thP=$h54hh5hL#4n#"=J@K=,KE#thP:=$h #u K=KhKB#=K @K54h(h0jhK#Hm#6#t3#u4<=tDhLPhP24L54EPhXh\g.#} juhj5 hu5& #tF#tP#~FEEjPhj*u5LLEl#*54hh5hhiJ#=t=u<54hj hԪh'#= l##u+#M1=MM=t=t=tϡ#t P5#uh,ujjM+=DŽ54ShW@#|E55L 5L:ȍFQP}=@|=u j+;O=~,=u Q\Q QXPP"=QG;~=j\QhTP#54hh 5hpH#=uI54hDhLjhLG#|}i#|o$;=A=\Vt$54Ph45h~G#|mi#[^_ÐUh,?h-2+ÐUWV54hPhT5hȓG#Q=Jh#0hT-ht-跽54hj hXh`0$#=t=urh#=KKJk$($O($$=$-J :JJ=MhJ8hJ$+($$ $hLaK+xKhxK nc54hhh?#|jhL56 h-254hh5t?59VD#=ue# $$$@(54Ph5t?VC#>e#P5ȫȫ+ҋ 9;,=$$4R93t B;~ 354Ph̫Qh3C#Mu h-d#54hh5t?h9B#Z=fud#s<od#j#54h h5hPPh1j.5h1Th2B$ 7mH %Sb  SM 5QRm25V^2hR.$hjS讒L|QhP5lhf=#R=5 =w$254hj hh#^#  ~?|_ u pH qHhh5#  uoH>nH/54hj hhĭȡ 5 GQPR# ,K#  #:@#~@#@#5850GRe ȋ; t> GZL #u'=t50GQh<0j щ G,KD^~^щGm,K=t=ut K  G G GGdžDD=#oK#'^~0=HLu'=t=G}~ h`1c=lI:lI 5$GQPR #'  V,K#@#~@#@#G5450GR芻 ;GJ#=|50G5h0莰 ,K^R C;54hj hh;j~Q5h#  uHH=Gu =Fj 54hj h(h0@j^Q5h_#{  u G5G(hhd#6  lH 4 uQPj j($hlj^Q5h##thR($h hGEEQPj hhȃu pGCY#2#54hhjh 7##td54EPj hĮḫn#}N54EPj hh7#X#{tGʡpGlGdG#BExGE|G- 4 uQh h5h Qhh 5h5#W# ,K u K E KE54hj h$h,h:Q5h#7H]h#c+fMfKA|5 5;5u X p54hj hPF#|U;#7=, C5uf 5u5Xqf;=u7;V#A#(+fKfMA|=#t S@j5(hjMjjh5()#tUjjh5()#t:jjh5(x)#tjjhį5(])#eU#k+ɉ +E5u f!@=|σ5u X =G=X=Zu ̯jhhpP-# 9uOu"H#tPHH#PHxQ&$Pȃu5+;}<\u|vt @;|;P uQhHQhHZ&54hj hth|8jQ5hW#sudHhH54hhjh41# S## u ,$/ 0$"54hhjhL0#R#=u +K54hhİhȰ#} M55LJ5L"#R#) upL5LnxL5L`tL5LR55L5L!Q# t|L5L"jR $j=`q=l=t]=u=vjhhhQ#,#[^_ÐU54hDhH5hl.#==(j2h43藥hH ˾hP 趾h@ 袾5=25h8?54hhLhPA)#}h54hj hhd jP5h腾#D f54hj hܱh jP5h-#L 54hj hh$ hP5hӽ#|oT $\354hj hhX hP5hv#|X [ÐU=t h|3bÐUVS+5M5M54EPhhy'#/$M#tPk5$M5Kh hjojuh j[5ph,h0jAM"=Kp=t?=t8=t1=t*=t#=t=t=t=t=ue5 h3 @Ph3? h303uh3h 4[^Ð؀>t|uAM>u<>uAM M< t< uAM< t< t"u>NLI>uQ]#VM|M#t =LEuh$M=tK<5MhXh\j虪5 Mhphtj5Mhhjej5$MhjNUWVS+5M5M5 M$M#tP5$ME8#u=?=Knp=tC=t<=t5=t.=t'=t =t=t=t =5 hD4= Khp4h4EWX#|$M<}t<>u <|tK#}M#}=Kurp=t?=t8=t1=t*=t#=t=t=t=t=u'5 h4.= K&7W M"Ph4[^_M~ރ}~9u|#}]M >u|>u M MÍtD< t< u F< t< t"u>hijc>uV!#}Vh 5JVh$Mt;vD< t< uN;v < t< tFWE8=tK5MhгhԳjG5 Mhhj-5Mhhjj5$MhjjWh,jfUWVS++EEE5Kh@hDj触=Kt=Jy#h$5h85}t h!}~ED}t u#t S#t W~=Ktkq54hhThX.#} =S5# @P#$5W54hhdhh#} 5#@P#uhT55S54hhthxK#} 5#~/@P;E#u hp5H5u6hI#-#5DEDhh!Ejh!hj7h~JPΊj54EAjVhh#|݋EEuEE5=}h5:@P#uh5}5uhJPj54Ĵ=ȴ]jhSW#}=uڋ}5@PH#uh5=[5S@h5D#/uSWjI)wL+[^_ÐUH WVSMM M]# jP j& hH6u 5 h|7L )m~ 54h̴hд5h!E#^=uh5. pt k#a 54uVhԴhش#V#WuhjEujVhjѠhVujC9hthxh|jH%hhĶhȶjAhlhphtjX3uL+u5LLM_Lccwu5LLMLkk%Ihȵh̵hеjItL+LjTuL KHILMdLs K#tK+[LLLPLE%EEuEPhjVsL K#]54uVhh#}h5jV#=Kt1jjEu54uVh<h@_#PV8#@=KtikhlhpujDh`hdujUrZO#]54uVhh#V#uE=R54uVhhs#dVL#Tu=+5h$6#6=(H<=G/MԵ Mص54EPuVhܵhu#}hl6ku5Lj 54Vh h~#oVW#_u5 VV=^h654uVh4h8#V#54uVhhhl#u2=} h6pV#54uVhh#sV[#chhujW1p#254h̶hж5 hE#U=Fu Զ =Ku4+PuVhQ#V#ajuVh$h("E#uSE54Vh@hD`#QV9#AuShh%ƅ54uVhpht#}h6huS 54VhhV#}h6lu5 k#=Kt#ehȷ5 SjK^ƅ54uVh̷hз#}7h 7huS 54Vhh#}hD7u5 "#=KtVdh5 SjRu  @54uVhhPq#}uahh7V>#|J=KtcumdPu)$7d#[^_ÐUVSu>uh7蕎+0] PVhxjhhVSl[^ÐU54hh5h>##3EP]#}th 8M H H H H $H (H ,H 0H 4H 8H -`H\HXHTHhPhjS$kL=t=uE7#=u +G}C#u덐54hȸh̸jhL#do7#R=$X8}#t и ظhPh}t$#t hPh(H$H}t$#t hPhHHj}t$#t $,h4Ph8W HH*}t$#t @HhPPhT0H,H}t$#t \dhlPhp8H4H}t$#t xhPh@Hj^P5h"_3)h"貢54hj hhjP5h"#4#| t9  h ""h"s+i54hhjh#h754hhjhl#W3#  x9+54hj h $h,#2#"+:#tP5:5@P#:  "щ5;t A ; "W:^ÐWVS+=D;5@}x+H#t Po;tjEPjSFE#t}j}`8;WPE=@E9E4}t 9E%juuu# uء@HP uԡ@3Puܡ@\GPu@`WPu@dgPu@hwP@@@= =W}uhPh8 @ }u}#t S@#u#;[^_Ðu0;Eujuu5HQ#u#u2UWVS+5Kh`hdj蕋=K}tj#uOVhxh|jP,#u HLjhhĺj'X[^_V=Jt=t h9vj-+=pItotIX#tJ=pIPh5LN #|*j5tI$Sܣ =~ j4=tI=pI+蹇=K=J}&P=~ J =JP=Jt=JL=~JL58ph TpK#tLBNlI=LlILL PL=]#UHLPhhZU=tj@hph@ =t-ÐUWVSEEEE}Whܺhju hhj-EJE=(Kh9[<h9Gh:=h,:5Ph<h@j{\h;lh0?~s0hhX:~Sh:~8Qh:~Tj?h|:b~ t=~J#u} uEuh(h,j蚇E LL=|tjh|J}, } t}u =Lh`h$L`,d(E+} t}uh}t}tС4#ts t =(#FLQhċPjWhhRjpWTFLQh,PjWhhĻRjpP+FLQhԊPj5hȻh̻RjpW5)(4u =<#u}t} u@jjPjjhлhԻhػjjjPjjhhhjLP-} t׃}tjjPjjhhhjLQ((uE܉EE؉E}uhT:hxEEEEr5t e5tUN5P;=?5h| +}tpLP'Phhj薄#} =; =t_=,u=:t==u+#t 8#u 4=V$<@u}EE؋EE%#}L u}EE؋EE505LiL,=t=uE} t }DžH}uv54hhhhl<#  L:t/Vh:Q V55L L RPHVH5LwjV L  LjQhj观}juVhj舂j5hjq:jRhjP $l"t<:tB"t<:u"NBj?RV~ Jh:Vy554hh5BhAD#[#54hh h$#}=5P=5#R54hhDhH^#=hx:h|jh:h:tۃttуt؃}054hh@hȼ#} =&5=?%5h|aBj?RV "t<:tB"t<:u"u}L4=:*t8u PWhh1PWh$h0!tPWhth PWhh#} =1:>}H=v38Ľ0н%ܽ $@54Ph 5hd#}=g #} Q #p5L:uQ=Ju,,Ph:} u&} {uhLhPj&~5D5hdj ~<=|B: u B: tR5LkLjRhxj}@I5LA L#k5@Qhjc}VR5   5JRhȾj$}jf#r8tFE=P} J PEأJ}JLJo8pTpEԃ} tWIKyK"=D@}:$Vh54j5ЊhܾhhjpW(jj54jjh58phjV(}]u؋}܍pPPhh j{#} =O=,,=uL505  jPhjO{K+A+8=545 h,j {4#t=t#"]u؉} E}ub#5Jhphtjzj#}a+KJP+5-u؉}#`[^_Ð J8t E8pTpE J58KQEP5===J~ LF'L Rh@>o#Y TpK58ph =lIJK=JP=J{=i=Kt - #_h0;OohL;Boh;=Kt #h; o= Kh;nh<n ;#uȿPh<<nh<nh<̿=Kt \#5h<xn= Knh=^nh$=Qn ;#uPh\=4nh='nh=n==R=u9=Kt #5h=m=lCPh/5lPh(jv=Kt .#`5LP+ʋd+ LDlRh>P 5l:n=Kt #5hh>uh@hDjAv5@hXh\j'v@==K=tqx#~  Q5RPh>Sl+@;}j+4H435H{Wh>l+ \G#tPh>kF|h>k@;|#u+;EVhhj/u L=@Y4HQh5B43hA 7=@A]ۉJuhhjtEH L= 3$@EjQhjzt L"t<:t G"t<:u<:uGE LuQhj5t}uV\G#t$j?PEP jEPhjt}t!j?W}Ww jWhjs5LTP` L}t]hh?Q hEP5L j5Lh0Mhh?Q j5LhD+=thh$?Q j5LhXj(s|#t.8t)j@Ph@ jh|l<`Wt=luj@5|h@U =u =@I L=%hhT?Q hEP5L L=43h>h(h\?hh|?hh?hh?}h^Qh@ihJ5Lh@Ph1]ۍ=5 QE L}uQTP) L}JjQhjeq5JhhjKq5hWj5qx#tJ=x8t*hPh` `d `jW|#tZ8tU|=@=uj@Whp; |j@PW jSl=u-E-j5JEP5L#l#8Ph hjp<Ph5LH+ы LdDl= Kt#u =_F;uH LUJ Lv2L LL$ ALE=~K=JJR5 VnjVh<jn5JhLhPjn=Ju 3lI5Khdhhjyn=Juhxh|jUnHL}uwPhhj5nfHL#u =PLuHLPhhjmHLKHL:HL0}t}t }t}uJ#u=PLtPhhjm:K=JtsCr K#tLX#tCPh5L1 #|%jVP胆 =~j. K K#}u }}u(=4Kt+[#|ujdtPF |}t%jrA?#1T}&Lx=KUu uj踹 Uu uj谹 Uu uj訹 Uuu uj蝹 UE=,8xph0`LXdPH@80(  =t = w$`APÐUWVS} W]Shpj?k#u|;p_L= 1|0D0 PhSU E[^_ÐfU5 hhjRj#K;= ?EWuhj!jE8'=Phhji5qhhji q#~);~ Phhji=}PhhjqiQϵ#i+ɡ;}B+4ttD A;|E+;} <2tA;|M}9EluuD0uS芹#5lSh j`h=lUWV=t E;|;yg0#tl+P=t <0|0|0D0 =+^_U WVSE] #u0=tKtAuSh4jUguh@hDj>guhThXj'g=t$E;yeË D9F:ujjhA+#t|8~D8[^_Ð 8M#MDEu #e}#CRhhjc]ShhjcWhhjcuhhjc##;l+}uWjVȴ؃=tKtkSVhj`c5lhhjFcE@ $ Phhj&cE@ $Phh jcMDDz+;}J}H#}WG@G@=t < t C;]|ʉ}}lSP$h4j~bM|S5l$hLjQb#}+##u E@ =l[^_ÐU=tM; |Io^J9 #tDtlR#u+ÐUWVS+=tE;|YB1L0+[^_Ð0#t] #}u +lWSPx EP5l.$hXj`}Z#f#^+\U WVS=t%E; EDu1jhxh|j_+}} uWuO#|K E\+yh EDVhhjm_.MtVhhj:_[^_ËEEEEEE E#u hdhhj^ } }oE\#} u+ۉ}}uWH#} Wӯ G@G@== uC} u붐} FEEt#|E ;}8u hhj4^ju#8} `+;u } uhS #US#~( uFVPJ$hj] #;|GU=tE;|!+,+<tۍD ÐUWV=tE;|R+N <#ttG u&xPD Pf=~W;Euf@^_ÐU=tM; |5H7& #tP蓰#|ÐUV=tE;|8aM<<0tt0hhj[D0#|^ÐU=tM; |%9( #t@ ÐUWVSE=tE;|lR>D P g(jjV諭 #uVjWV萭 [^_ÐË4#tV+l} t]V趮CH#} V讫 F@F@ȃy u͐UWVS+ۿEEEEE EE=54hh5h$q#|u hAIP5hXB,PEWhhjY5VJ$WhFO+udP#u WhGO 5h(GlOft hLGXOft hXGDOft hdG0Oft hpGOft h|GOf@t hGNjPhGN$hGN=~PhGN8-W$h|EbN hAJNYQI+E=5. %,= h$G S$H}Wh54j5@hhhjuV(jjjjjh4h8h<jW( 4V$E#,==Z<:t<=u+#tLuhA=hB6h4B-hB%hCh$D h\DhDLh=ek50W趢tWt#pπ\u<%t<&uADž<%t<&u"PEPQVl #)%u ˀ Dž54 =u6VQhHhLEZVRQh`hdηE?=tVRQhhiEPhhjUE=u5Ue#6#}=hpBG t4Qe #}!QhBKhQV E#SV#P)$VhBj#V$hCPE#aP$htCfVR#eV$hE.y#oVb$hFI P$VWa054Pj hhFE#}=HhB8E#&\PhD54jjhhhjEP(jj54jj hhhj\P(EPE#}=h,C,#u4Dž=tE#\#++;bSE=u'P$hPCVH +G=C;|DžXu أ u pܣUU]}\RP54jQh hhjEPG(jj54jj h,h0h4j\P(EPME#|h,#=芥<:t<=u+E#t yt@}u j:4=$4H= hChCF| ++DžX++| DžX| +X| DžX++EX| 54XPj h@hD責E#d= h D54EPj hPhXqE#z | X=4LPRQjO=,UUEE]}4PhhjN q54Qhh{E# 55L(5L5Vȃ}trDžX 1 XRVQ#V$hjE EPhjd>J#u5}u E5JVhj+>DEDLE"tE8u5}t/h=!WmjWhj=E"k}+vhH.4EDEL}t!5!VّjVhjs=}u}t"}t u2}t u!E[^_Ðh肑JP#j謓PPh h$j<#+5`jSh\Vj<=,hd5qP} Sh|hj<PPhhjc<#u&q-=q"=Ptts#-=t54蹐}FjhhS覶tuhHA2=Ljj9=Lo#|}5@PE#5uuV膘EPVhj>;E8}LEL #=$jSWh(j:=,hd5qP| ShDhHj:PPhdhhj:#u+q2q&=Pt܃t #(hIVI}#thIV4#uh IhdIWI$>tV=<}VhHIW# WJPb hxIV̅#thIV躅#tjj=t54"}诏jhhh؃tuhI/=Ljj6=LY#|}hIt/5@PTE#uhIH/5uFEEEL}t#u[EPhhjs8}~=JtLX@EE@;j@VP }}Ujj5+ÐUWVS5LhpL5LhxL5LhtL5Lh|Lݫ0=H=H=H=HL+LL=~HL5TL=xtK5x=|Htj [8jh|HXG=~ G=GG=~ K=G$=~$=$$ $~ $$= $ $$QP7$#t"hPh`/ jh$贪,=~ `=,(=~ d=(X=~ K=X4=~ K=4|=~ TP=|`=~ TI=`S=~ =S8=~ ,K=8<=~ GPhhj5=<@=~ GPhhj5=@D=~ GPhhj^5=DH=~ GPh hj25=HL=~ G=LP=~ 0G=PT=~ 0K=T=~ @K= X~ K=Xϡ\=~ K=\`=~ K=`=~ K=5Kh=~ =hl=~ K=lp=~ K=p~ K=Xt#t# H#tQրtH5tx#t# H#tQ誀xH5x5d5,Z 5DLx+ۋ#t P]4#t PB4C|ĉ= =+,048[^_ÐUl;܍|,ÐU5JhLhPj2=J5Khdhhj25Jh|hj25Lhhj2L=Ju=Kt=u68JPhhJPhhj92\=uU T#uJh#t=< u tJ룐J됐ÐUV+ L#tK9tUUL#u L:u3@L8u- LVQhj1^É LF|UVuPhI'5hJ'%h0J'<PhK'^ÐttfuPhPJb'ftPhtJ?'ft  PhJ'ft $PhJ&ft,4PhJ&f "DUu5hLj05Gh\h`j05dGhlhpj/5Gh|hj/lHPhhj/nHPhhj/pHPhhjz/5Ghhj`/5GhhjF/5Ghhj,/5Ghhj/5Ghhj.5Hh hj.5Ghh j.5Gh,h0j.5Gh<h@j.54GhLhPjv.5\h\h`j\.ÐUVu uVhlj=.Ph|hj.5lGhhj.5Ghhj-mHPhhj-oHPhhj-pHPhhj-5Ghhj{-5Ghhja-5GhhjG-5Gh hj--FPhh j-5Gh,h0j,5Gh<h@j,GPhLhPj,5Hh\h`j,5Ghlhpj,5Gh|hjt,5GhhjZ,50Ghhj@,5Ghhj&,^UVu#u554@Vhj+=4@u+V5tPV??t PW0MjPhj*g^_UWVS5KuVh(jy*#t PCwVvPv#uKjh4h8j1*+,Wh\h`j*(WpE(W[^_5Vhxt u΋5+< t< uAM< t< tQuЋM~&D< t< uDJM~ D< t< t]LE?EP=E@EE@Eu E@E^<\t< t"uE(WWPhPj)GM"< uAM< t롐UVSMٍt~ف }^@F^?F t[^UuuUuuUWVh(Ku+#tL LMuP} =~WPV茖 >uh8Ku#t WPVk D>^_ÐUWVS=t =tqt[^_JPP=0h@K<$x=Jt<5:؃}"=:thLKjj$% jȋ=Qzt= u)hpKLh|Kz+:= t= t=NtQhthj&hK<#=Yt=nt=qt=yo뫐UWV}Whhjf&+5:5K5K=Ju@Whhj*&"hKjh$s^_Ð= t5 KKKK5Lj&j&5TS=~Sh5:=$CjhhjT%=Kt%=tqu=thjjjhKUEPm E#u À8t B|֐Uuhh j$=PKhK=J m54@y=4R5 hK:JP jhLhPj1$ 5 hLjhhj#JP  h0-u5PK##} hK6h| hz jh(h,j#J=#= `5hhhljU#JP =t54w=4UWVS5E E#u E}#u==KE=uhLV o VWuuh(LVo=tq1==J#t2=tqu)=t @L$jjj  K#t+=tqu"=thjjj  K#=tq=<#t7=tqu.=t%$$@(jjj L  K#t+=tqu"=thjjj   K#t=tqu =#t/=tqu&=th5L jj  K=LI#t.#t*=tqu!=thWjj  K#t/=tqu&=th 5djje  K=LI#~hJ=uL =t+dЍR#t*=tqu!=th$Pjj  KG=un#t+=tqu"=th8jjj  K#tQ=tquH=t?hLjjj h\Pjj}  K#t=tqu =u#t/=tqu&=thl5Gjj0  K#t/=tqu&=th|5Gjj K#t/=tqu&=th5Hjj K=Ju3#t/=tqu&=th5lIjj KJ=ui#tA=tqu8=t/h5G h5Gjj@ K%=t=u#t=tqu =u#t)=tqu =th5,Gjj5++=`Lu=Kt%=tqu=th\jjj5 >+1+j+^_ø(L=KX=tqK=>=Ju=,G~qi(aNyw$M$L=K=tq==Ju =,GDPjjj{U=Kf=KY=Lt=XGC}9z LK#u}t#}=G=,K#t*=tqu!=thtjjj K#t*=tqu!=thjjj K#=tq=tyh h h0jjj hTjjj HI#tB=tqu9=u.#t*=tqu!=u#t=tqu =uUWVS=\+5555TK5<h`J=u=d=t =tW`؍=xW_Wh(_\; K~h)+ۀ=(th]h(Ph_D; K~ h=thhx(hLI=~"PhhOW:_ WxhK#=+h9h&=uh h$$@("h$@L$\h$#t=Jt@L$h$$@(R=u h <hD/55[^_Ð==h뤐UHWVS=t5d]E=JuHHEu5L5t]"u5LI#"=c~dȋƙ+ȃd~d"t =$Lu=0Lu=(Lud`d}dvUE]EO+L"t #udTK;XK~*u,G9PWhQP@PWhQ9PWhQ! |˃tƃ~|SWhQQlIpuVWhQQPI5jx#}tKj=L w=Ljj5hLVhQQH 5j#}tKj|=L =Lj5hEu]#} E#C EC!PH#[;f]] uHU;}L<L@F<N@U@L@>@CH;E~"uU;|Ƌ]U;|}t..A]ShRQG #u=?t#Wj#}tKj3VjT#}tKj=L |=LtVWh jj oVGWj#}tKj=L P=LCjWh,*uWhRQF5j#}tKjU=L =Lj5h8VWhRQ_F5j#}tKj=L =Lyj5hD[$`RuVWh(RQE5j#}tKj}=L =Lj5hPUWVS=tKB#uhE# M}#tWQhRPDE"WhRP0E 5jX5jH#+;+;}fu hp} ;} t |QM PRhREPDEP5DF};|hR5DN5j#| C;WtKj[^_ÐU=Kt\E=u< tL"tH<tD<t@Pj#}.h4h'KjÐUWVS+ۃ=Ktq}#tju ;}cC=u< t"t<t<tPjH#| ;|1hhKj[^_ÐUWVSuVhhj5hhj=JVhh jpv+5jShjE}M=KuD=tqu;ShRhR=Kt h(SW 5=t '= uJ V&B #Vh<hDj5 h`hdjnjhxh|jXhRBjShj7#u;jShj S5 WShj[^_ÐUWV ,=t2jhhj3Wh,-AuVh0h4js#=lElljhDhLjAuVhl#htWhxjWF@= }Wh@}Vh4#tqhWhjW?= }Wh I@}Vh#t)hWhjW?=@^_UE=Jt P PÐU=u h'BM E=,uQPhXS % RjHPIQh, PQ +ÐUWV=u h'=uhdS.2 55VhjW5KV +^_ÐU=u h'r= uhpS Pjh  +ÐUWVS}Whhju Vhhjjj 5F# VhE=(;~"+jj 5F 5Fdf++Pj 5F O#~$j/SO##tj-h,觷[^_UWVE#~!M #~+EEEME,Wh4h8juVhHhLjjj 5F ~;t3Wx$h`  hh5F^_U,zsO],,%4xSzs<E4jhxh|j=tK.uhhj,+Phhj4r+Phhj,R+4E++Qhhje5dhhjK5 hhj1d+ Ph(h,j5TKh@hDj5L hXh\jdK*Phphtj,{*PhhjdK[*Phhj},%dK]EU,*PhhjNEOv[du)TKPhhjjj 5FQ 5TKhn5FHTK;XK~3J=u ,G9 VW`#t "uqSVhhjV#uAjhhjh5lhhj=5WVb#t)5phhj|j.K#Ƀjhh@jN #jQhTj.5 #} &  T  t        ,  kT  Rp  6        < X   o  R ( 6\          0  }h x e  Q  2  $V  BYÐU,WVSE &EPUx+@"t4D5G<=t<:t< |F"t |ED5D5D5]SQEPht#Mԍ I U u}+u##t#u }+m}t U|2+t }L#d}Z5+t,"tH<0<9 4HG"u!S5Whs#~=Ju ~# |=tKujh,gbtK5L5h~VhW #tWhl6%L5\?5d35`'VhW #tWh4I$VhWz #tWh0I$VhWJ #tWh8I$jh\@W! Wh|@^$t5X@g5p[VhW #tWhl$p"VhW #tWh#jj菭VhWf #tWh#W,ILKPKVhW #tph|>#Vh0#D<5D/S5Whp#S5Whp#S5Whp#+"x<0<74G"uQS5WhRp#gS5Wh1p#F+#t4Ph Xe F~ڃ=\Iu =J +[^_W4#-㐐=w$0XS5Who#s뱐UWVS=Jtx0F5hVh<j7E"}E}WhLhPjG=O_hx0M=J@KK&\I`I KKTP3x}Ou  L`I0%hhhjF0%0%vxK0%v^KPhhj߫5HI x1h j«0%sr}Gu KM0%L L MRPhPjQHLLLPLXLJwLmolIw=KtBX#t9Ph5L o #|!jh P =~ jTKolI;8t+=XP肱G^GKKTPK@KvKd+=K=J= H=:=M=$=($CBA@=JKTPK=JJJJJJKK~hPh  JJqK;+KK)4HKtqj5x# =J uh`i h|n hC =J th=w hd =J thH h4 =J th( h@ ~u x xhHh=|8-tPE=J thTh hh: =0%=J th)c hP =0%=J th' h =0%=J thh=0%d=J thuh4J=J thLFhdl=J thOh<=J thh =J thh=J thHhZ=J thUh*|=J th0%_hHL=J thp/h=0%u~u‹ x xhHh#t 8-=J thhb=J th]h 2jj ~u x xhJh| 8-=J th8)h\=J thh=J thhb=J th]h<2=J thh.hhT=J th7V(PhXV =J tVh=J th$hP^=J thpYh.=J th)chP~u x xhHh=|8-tPp Pb= =J thhz=J th uhHJ=J th`Ehxl~u x xhHh=|8-tMQ5@Phb#>=J thh=J thhj=J th eh :=J th@5oh` \=J th?h,=J thh=J thh z=J th@uh`J=J thtEhl~u x xhHh=|<-te^mUnXoCs:=J thh=J thhZ=J thUh*=J th@)fhhWJ~uȋ x xhHh=| 8-=J th+[^_ÐxxˡhHh=A8-6Ȁ9u+#QhLv L"< u A"u=0%~+=HI+} xYEhJh# x=xHtj=,Kua!u\@MjPhj觜HIE xQG}JHIK6HI,-hXPx} x#thhJh#?}HIBh x=}#;u#]Phxh|jЛuhhj蹛=HIj^#CKhXP x#1 x=1 x#j1H x#=\If=J T~&xhHh=9'+}jt}Jt }Xt}ZuHLLLPL=J~% x xhHh=/8-$X}JuL\IKKhPh  Sh 8#K#thXh #u=K}luZj5JhKh .#苞5lIhhj蘙=J|w}jt }J;h#~I xA#t<8-t7 xJhhXh  x1h JJqhh Pp "t<:t C"t<:u"tChSP4 <=u+C; uC; thSP =@8u*+=D~P=@#V8t6hXPvPP`hXP@@=~x=Kuo=tquf X=#~RSWPQ+@;}0+ۍ=Y4H435HCSWӍ@;|#u+;M@=h4HS ˊ"t<:t A"t<:u"u)8th,YS3PS#EP5B43hAX=~E@AأJ43h4YG;}8hPh  L1cj5JhKh z*#J講Lb=K#}ZiWhih ijkV5Lh(ijk+L L@=|hd6b [^_#54hhhhh#|H5蝷#Dݰ#t P"FV踷Dݰ#xu-he[t54heaA+D#t P辷G~#)+'UWVS++}|t.}t%uh`e a[^_@}n5LiDŽ54hhHiV#|>55Lڶ5LCPQ9@|u #} u\QXP++<t @=@|ȃ}|un=@~7j@he:`1jP]+;}։MPFE;|벁}#+;M]U+;]}sEEEEE=@tPQ2#u+jjPQa#u0C;]|EEEEMEEF;u|EEEEjP;]}ˋEMTC;|+;#t P>F;|UWVS}umhe,he%h$fhfhfhfh g^F+~ z=,Ku54hhh\ih`i)#}=b555  =ux5LVP$ L=xWs5cD;} 5WxhLfWjhTfr] Kك=TP#tR=XPtI+XP#t>j5@5LPf#uG@} XP#uԋ K +ۋ KtH=\Qt?+\Q#t4j5@5LP#uG@}\Q#ujS)54Phi5ďh# Mi=t i ijhhjP #} =Q =tG8tBM5hMQP 55 蔱#1 PQ  M#j蟱#H#tp 5H=Hu5H5L&@PW#5LP[~5 M=@P #Y+5 MP Fl[^_U WVS+=JtAhHgZeh|gZThgZDhgZ5=Kt~6#|=JtšJ=t=u#u++[^_ÐM9/tƅ/PQ PQP +jQu E=U(} MEu$gSRWQQPLSu RWQQP$:vSu RWQQP>ZSu RWQu$QPF ;Su RWQu$QP5O Su RWQQPTB#UE=u@#|=_ÐUE=@u`=?~ =[} =_|=z~ ÐU`WVSEEjhhjh j##}c=hhh,hhdhXW^uhDjhHjjkaE_h55L LMQMQPKr uM#}#}E2 NPPX#/E#9u]usDV5hhEP54hhjEPE#|aE#uhhPv#t"PPPD}~ ;]g]uEE]uE=jhh jh$j#}tuVPKo#}8hh&VkEE4Shh V EJEEB;u8EE]VPhhS詫4SY'#|F;u~#;u]#t PF;~w[^_ÐUWVSjEPhTjhXj2#hhhpihihi"U"uh(iUuhLiTu hiTjPmihu5L LEMQ}WP(o }}+}}%54Wj hhjhlj#bY##<`L"}}V'<@M#)]PީM9M|+; `L @;~M9M};>+ɉ @;E~1`L9M~*;&jP#C`L;]~`LR<`LE[^_ÐUWVS+jhhxjh|j#V55L LEPEPSm E#}SShiShjSh$jR hHjRE<`Ltujhhjhj2#JV55 @  EPEPSl #LV"E#}@4UM]E#}#} #} #}#}#t+U#} ]]#}#t+M#} +‰E<`Lt<;~}PuojUM];;MڋE`L4`LPCG;]m;}~c[^_ÐU VSjEPhjhjE#=hhjhjPuhjPhjP@tjSgi=Phj1Phu5L LEE#|UEPEPuj #4}}V؃<`LSY[^UWVSE+jEPhjhjU#}hu/hkhxk^Ouh4kKO,'uhXk/O[^_Su5L LE}uG54EPhjhj#|Su5  E8uu#QEPEPu!i #W `L# <@U#}u֋E#} E; uPF;u `LސU WVSuVhjhjjcW5t"Wtytttu+uF =$=t hk~M5Ybud[Fb8bVn&$bbu@b#tPuauga+aP8aju/+a Jjjj, #}5J8" 5t5Zajjj, #}=J5 5aa5`wPhz5Vğ 5hwVjRS=xKu =<-t h{5`PhLwhPwjS Lى5j`a`j Ph}5 1u41`$`8xPh}I+`jUM_(K_j_/;5 tJP85_5 h|H+\_:=t=u =:u.o3_5r_h~H#t PR#t P?#t P,#t P#t P#t P#t P=~5]^P^fcC^+34^$^P^^]h5(5  jhh8|h<|#5]t]54h{h{5^h$^#|=w$5 h|ZFA]uVuhott܁tԁt́tāttttt5t6tEtt gtuuQu##L=,K*hkhkhlh=Kt=Ju ,Mu#=Kt =J,Muh!@P=<*u]jhhkhk-/54hhoho蚼##tuuiuw=Jt>=Kt=Ju 0Mu#=Kt =J0M:==u =:KA{o\54hkhk5JhxH=n##='\j==z#u=i =St9t t;uu讌Mht = }u 4+Phh(lh,l蝺#h5V覱 \u<%t<&uF<%t<&u h8"hVsY #54hh@lhDl聽#d5P#u5hl= t>tVhl8j Vhh = uVV] >#=O]54hvhv5\h\|#=+55=K*=*=Jt>=Kt=Ju 8Mu#=Kt =Ju8Mh54hhdvhhv蛸#Kh55L襯 L#5kj5QPjx#}=FK#qjhyhyj@M=~ +t7tYt Xtzus=Jt>=Kt=Ju lMu#=Kt =JlM(8.uxu 7uRGSt(trtqt ouVUPhllhplj?(t Stquk=~b=X tYP#~P=t=u%#u=tqu5T#}< Kn=JtK=Kt=Ju 4Mu#=Kt =JP4MC=J6:==u =:uOtu[=Jt>=Kt=Ju @Mu#=Kt =J@Mut]uuM=JtK=J=Kt=Ju |Mu#=Kt =J|M54h=Whmhm#~=h55L  n54Whnhn##5L5t#zZu uC3u.m#NPhnD+6t 54hj hHnhLn讑#}=6=Kt=Ju TMu#=Kt =JrTMeuVVuVuXj5457Vhnhn57h<"ʲPhnhnj2=BV覿Phnhnj2H=;u@*. =!=#t=&t=.t=:t5 ho}([^+uiX#~r=}=XtI .=H9/t ituZ54hhnhn蔨#oj25=TW蠟 #-JIt8t d;54hj 5"$hn袍;#=5(R#HhhPh P}+hP}+ȍj:j6j2j.j*j&j"jjjj jj jjj=Xu/=J+ #05=Kt=Ju HMu#=Kt =JvHMi=Hh,K=d=Y5 F MLMjPhpj&j5 Mhpj&DLLs+HHK&=,K # Lx=KPmt/t +++=JtK=La=Kt=Ju LMu#=Kt =J0LM#}Vh( 54jjh8qh=Kt=Ju \Mu#=Kt =JF\M954hh8rh=Kt=Ju `Mu#=Kt =J`MsHShX54j5Yh\th`thdtjlP̺(jj54jjh|ththtjS褺(}~EEẺEċ]܋EԉEȋEEulP譺PhthtjO5,hthtj554hthtj#,=k<:t<=u+#t kS4=$<EtEgEW؉EDY= K#t054hj P׆$htjs##u j54hhuhuY#h55 c = #u sjO54hh(uh,u#P5a=?j@5V VӆE=E}EEEĉẺ]܋EȉEԋEEu}t'h505L腃 4J54hhhDuhHuEw#hh55L/ =[#D}tV5LhTujcuuWujV5Lԉ #t,54hj htht9q#=4he,p=`u54hhhduhhu;v#=h55L 54huhu59h3# +;9/@ $$93t@;9~354Whu59h3荒#\54hhuhuZr#=h55 1 -#SWV5 5LY?#5 5k5$/hLyhhy.8thpy/8tPhy{FF5<@h,/<@Nu(O#uh,/P'=Jt>=Kt=Ju dMu#=Kt =J]dMP54hhuhu#=Lthyhz^#u5D#aV]#P5Vhz5L]5Lqd#Atat 54huhu5@GhtE#}=ghzU54hhuhu#ݿ5苁=ʿ$`."  5k#~@}Au55!55#}h@zhTz==ua}au v vj5Pj }au (v0vP5h0zh@R}au 4vHvj5Pj}au Xv`vP5h8z sttu.#}su+K鿻B vw=Jt>=Kt=Ju +ƁE"+ƁG#|=1~=|=~=u lx6k#| =1q=| =U=u lD67#| =1==| =!=u l6= =J=thv-# 鎵===&8"#L=K=J=ƅƅjPg=~+=<-u=xKu =tKԴ=w=s=a=u wPB5h {,u{u08"#EL+LMxH}u 髵~54hhwhw#h{5LSh55LdZ jPj@5L$t@=@|Hhx{CL"~Phdwhhwjun54hh|whw5#j5蔣Ph${h,{5NR#]=Tu=h<{S#thPhTbt S=Thhԋ5 6t 54hh5 hwg#}==u+5#}$5h|{Z==u 2h55 s 5 [#E脦8"#=Lth{Xײ 8thԋhP_ ӏ ԋL=TtjjjhThwt=thԋhT5 P hԋhTh{5 ~P5 hTh{(hThԓ5 TP 5 hԏh\|56P5YJPf麲 =Lth{ 錱=ԏu=h | Q#thPhԏq ӓ=ԏh5TV5 q 54hVhw}#h5Vuq L=ԓtjjjhԓhwHs=hThԓhP|5 N#!hh|#uwPh|=t$#tPh|h|#uwPh|q#t=tPh|Qh|Dh<}7)54hhwhwR|#h55Lo 5MȡL8{u|}uDI*D#~2<*u'|*u I#~<*u|*t=D;=P.5蓠#̭5h}(ɰԭu+#5=Dx鵭uܡ#Ju軡#ܯu蛡#鼯Ьu裠#zĮh54hPxhTx5Phd~##54hxhx59h3,~#O54hxhx5(h'}#} =8"#  骫=54hXxh\x5(h'}#54h|xhx59h3]}#} =yA8"#g   uD54hj hxhxZ#8"#Q蛞#5Xh\y>{#5Xhdy[#5Xhpy5L  I tjP Ъtt54h|yhy5\Ah A{##e=襝#˫ k54=8"Wj hyhyY#58"54Wj hyhyX#d=8"&#L##K#~;~ K#~;~WV7=CuU+E5yVP oht~PnWh|]54j5]hyhyhyjP衝(jh]54j5x]h,zh0zh4zjWr(D54hVh@zq#5PPnE썅P]#49=(N<:t<=u +#t N,4#===G#t*54hhtzhxzp#ݧ5MM؋t kpWh]54j5 ^hzhzhzjP(jj54jjhzhzhzjW(Mz#t*54hh{h{ p#5PlP›#=4=,"L<:t<=u +#t L#R#5+#t754hhPzhTz>o#}=E=5~#t*54hhdzhhzn#54#jhhzhzn# "\uB:&uBBt PC "[u z]Wh0/h~=h~h~ҤWhŤ=鴤50PGj54hh${h({p#t8u 5Pi#|54=Wh{h{m#5Pi54Wh{h{T#}e=ԣXhP鶣54hh<{h@{}l#55Pi54hhX{h\{&l#45Phjjjht{#e#t54hPh|{S#Tɢ{V輕#EPV薏$W(Sh 54jjh{h{h{jLW萖(jhY54j5Yh|h|h |jSa(W蘖#9=(u85454h|h$|5YhYr#ɢ 4腔##u5Y)5Y!=t=5Y5Y#t(|0|Ph[^_ÐU(WVS=MtFjhЀhԀj[(Wj Phh j75|[^_Ð=LL#u=?u=jWhjSWh j#u+E؉E܉EEEEuEEEPjWj ZU|=Mt2jh0h4jj $hdhhj]jhPhTjE=|uÐUWVSu 4|Va$h|j ]ÉEPhhj#|+&||# #"+uhPhTj |guG|#u.$}||Ph|hjE|RV`$hpj%+[^_Ð$}=?},@$}|ƀ|Ph|hj4=|t#tPh|j $}||t +#=|t$}=~HPh|j A =$}|[u|Pt \~`}z|5$}h|hj#r_i=:\jhЁhԁj:||}/|++#S$}=Ʌ |HP|Sj 2 5$}Sh HP|Sj  5$}Shj*|\|/~H}C|++#=|t$}=r=$}|uk|V?~܀}+#=Ki$}|jhSz; #uVh|5$}HP|Sj 5$}Sh(jfjhS; #t=|tI$}=~=HP|Sj 5$}Sh몐=|t$}=o#<|:u|=:| ;|B|||$\u{|+#uK=|t5$}=~)HP|Sj 5$}Sh<j=$}|#u =:|K|=:,|B ;|}0||B| |+҉:||U+| |#~QR | T|ÐUT@TE|@|=|t=uDPhhj5|5|& | T|+U|||Xj# XA X|茼#~d+ |;~5XP菼|#~£| ||X@X B|#}ÐUWVSE 5=z4PVWjW4=}(44 =P5(}j78 4=}05lhhj=luK#cE#u (} 4@8[^_ÐUWVSE-E=EjhL\$}+|E=Khh؀{hth$khXch[hāTh̃Fh$jhL]h|PhChЄ6h)J=lI}#u =qQ#t =quJ=t =4=|u%h3|#X|=|u%h3|#T|(}#uhf3(}#=|uhC3|#(}84q=tKPhԂh؂j5|hhjf5|hhjL54h8h<j2j5LhXjq=~藸Phthxjq#qVhhj#~)N}WrEP+N#u5hhăjj= Wh؃jm=Jt JJjPhKWy#}ZWh5|1 5|jWhj }h~h0I6]=SO|=Ku=:u+E#= =Jt<=qu =qtWhPhh*Wh8WhTlI=ƃ=KtEJ=u  ]QP4@Phxhhhr=Kt7h0!h@W=t Ph\2=xKt hhJP#y5Kh h$jf5h8h<jL5lIhPhTj25J5lIZ#=J= 5KPhthxjj赅=Jt JJjPVWw#}rWh5|. 5|C+D+@=:u hPhX5,}h03[^_Ð=Su5J5lI^#5Jhhjjj/jj/54Khhj=J=4KtxVhȄh̄j~Afu:Vhhj{kh= Kijhhj@}u =,}t hh0s2|<+ɉ L P D H$5($;.t.u]  ԍ#t8.u£< 0 #t.u | @( |ZVRRr< @5($,P$=L,=H D $ @t$=Kt xF |F#u 9ɉ |#t4 v(tR(u(t+#u =:t +:| K|||Ph$h(jI=q~VJVjHP+, VjP, VjHP, ||#E܉Ejh<h@jEΤEPhXh\j=|@ q=|t ]MЁ H=|u}~]Mԁ H HjhphtjjHPPHPj-Vhhj}Bu =lt)j^-|e#։T|F]uЁEMԁ⅔tjhhj7 qHt=jh̅hԅj q!HE΋慴Ht;jhhj!HE qHt9jhhjs q!HEuh(h,j954h@hDj5|hThXj |}u=4#EEEE+#jhlhpj |A |#u+5|jhhj_+WShhjf8H 8E=l jḂ,KDREEDh5 :'5  '|uhhjj5 hj:+5|5 h(jkc+4LhLiNAh0+U#T+G+}t hth0\+,5lɦPhj|#~6=Jtj||=~gl=}Ӂ|=|t5jhdjPF+ h#t d@=|棄u* +4\4@=|+ۋ#tP\P81C|ۋãܭ+ۋ #tPP 1C|ۋã`#hPP# =uhXW0=uh`h0=uhhh0=Cjd#,hpPjh#hxPjyl#hP~jNp#hPShh/}h5#uAh;!P #~*#uhWq/=u.h뛐 #uhWG/=ohĉ$h/hԉ$h/hu$h/h[E#t_8tZuPuV.E#tCjMQj PW+D#tPP.G~jVy.[^_ÐUWVE$Phhj1=uPh苰= t3jhhjȔ8tPhO$=X0=hhh,PhLh0 t j 趏XjhPh\j:eXcUh蚯jhhjX!hxfh01 jhdhtj迸t j X ==<5Vh|hjX=h®"t!WtPh蝮G"uhP耮hsjVhjݷ=XL#t PL+P#t P|5P=X} Xb+^_=gb=i==h̊蹭jhhjh0nNUWVS+E|#u A,EP5=h؊2BL#t PsL+*5dXL#t PA5LP#t P)5Ph 趬<$h<詬XL#t P5LP#t P5P#jj} X[^_Ð5h`)@`=|@3 @u =t= jPhjH}jWhj3@t=@D8t0%#u*܋#t8t@H#t8t E؃}jShj詬=D5\SdjjT$T#KD= t3=~, =} PQǢDHD#<=t= u=Ju jgzwh蜏=D5\5jj#T#QD= t1=~* ԋ=}PQDHD# TQhhje=Tu X* Xjp h$jj p j X5\5hjԪ5\5@ #tP#ljhPhTj荪 Xb=,u & tIp#u@#tP#Rjhh j+f t3jjhphtjh葍 X E=4t+#t8tYAtN@L8tA)ċ#t8t.t#@P8tE5\P;5hhjQ}tq=thjhhj,jjEPhhj}}'hxh4kh^}~E=8ta}| =4u*h,iE5\P]N#t8u>t5@T8u&#t8ut @X8u}t0#t'jjЃE#}h蕞 X X€Y P,=*=$tHPhW h,W5DWejGp j0mjjЃE\=$uwh8W# HPQhHWy5\W#u X^ 붐 뮐릐J#t=et=mt=ot=stӹ v=E=': =====uw=tj 5h`Sj hpSo 5\SjjjjjЃXK tE=t_#t8t_7E5\plE5\ppJ'E5\P1#t8uڃ}h#t jjЃE}I=<#u?=#uTxtJxx=x|1++=#t=t=t=uۋ=#tō#t!?t5\Wf#=(t>#u #t&8t!5\P$#t jjЃ#u #t&8t!5\P#t jjЃ=uOȋ#u@\#u8t=, I0h|6=X  #t==t4=,~\@0PQ5#t jjЃ A$#t8tz=,~ \I0QPh jj @(#t8tPh,聆j5j=X  ~H#/=0"ƒ~#u@8QPh=, =TOR t#~1=~SPt#~(= tS؋=Jt#O#jsO=j=|wG$PtQ,=u)|N< u  tG< u7 u.8=u#< uހ u< t< t oxGƇWSPjhSho 3h H=~!}ƀH=衸7hS#=,Cjr%P< u  t< u  t|=T= R =4KE j2=+ # ha TXhSQh S=X=Th(SXTh@SXTuh SI#uhS7#u=,CT4hS#uhS#hS#thS#hS#t!h4SX hS}#thLSXhSM#tBhX hhh܎hSXWhS#thtSgX%hS#thS7XhS#RhS#DhSm#5hSW#(hSA#hSXi#0 ,A=$8hS#_h$S#)h8S#hLS#=h\S#'hlS|#h|Sf#{hSP#%hS:#O hS#hS#|hS#%hS#h^hS#hS#hS#ShS{#h(Se#zAh4SI#^j%%PUPhHhLj55Jj5lIx" #JEJH#|=~+G8#ttjSh8jj=w4jhLjjG4#t PNjh`hdjdj=Jt$S莶$Su>#>jSh|5\SjShjjG4#tPhMjhhji5\V誦jVhji=Vh h$jiUjhUWVS+="-~W~6MٍW"fƀ"@ƀ @ƀ @ƀ@ƀ?@uƀ'@eƀ @Uƀ@E3 2 N hBtPMwt=  rBt  B@@ƀ 퐐ƀ ƀ+[^_Ð's7$8hOt'  hrB=끐Ul#~hPPlp#~PhopÐUWVS+= + I;} T@ I;|jEShxh|jf#um=dtd;+hd5JWا =u,JGJ7,=t \N=t$lH l L =Kt9 D=u< t"tpx=pL5б =}(DP<$5ѱ RQ5u #u +ɉ #"7#| #[^_ÐU ÐUWVSW=W ؃~ < =Kt=KtSWhj}A#uJjG =K=Kjhhj5Aƅ++W5+󪍵5_=h|<hx:h75hhDZK#t =KtjVhj@K#t#=Kt5 hhjp@<[^_ÐUWVS=W覯؃=Kt=KtSWhj)@hWc#jEfPu9=t hL=K=Jjh nkjh8Yk~j ePjbhW#t$hW诮#thW蝮#u.E=t h,>L=Kq#~g"tPGeF"uSW@6=t=Jt WSK=Kt=JtW$Whj=j dP 8=dtP B"u/ -#t&=uj jdP7"t-=t=tÃ=Kt =J[^_ÐUtÐUWVSt@@= h,DvWV7PjhLW#uѡt[^_ÐUWVSE=Kt =KtjhD58j==lI} $lIj5JhK5 V#Vh5V謬 VW+h V+Wj=t hPV=Kt=Ktjh\h`j<KWj蘭=t hh:V=Kt=Ktjhxh|jr<+[^_Ã=Ku=tqu=t +#t; ~0A $Њ#u!"tA $Њ#t"t%tA "t u2 "t# "UWV=Ku=u =d ;/#~GN#ji;=duuhd5JW贝 =uJJ =t.#|w~XQ pA p7=t lA l=Kt=u= uN#'^'^_ÐUWV qt J=t=u =hqE E Duh< h@ jD[E E Ph` hd j"[E E 5l'Ph0 jZ+^_ÐEEPEPWVQ#uE=tUPhX h` jZjh h jZuh h jsZuh h gEUM ;u 9MUMjEPWV5q#5l&Ph j ZE E U WVS qt J=t=u =hqE 6uht hx jYuh h jY5 > Ph( h, j^Y5l%&Ph j Ph h jW5l$Ph jW+[^_EEPEPSWQ#uE=t:Ph h jRWjh0 h@ j/tV1|/uDjhhjCjVhjChĜh#ujjdhh #\މu"t<@t F"t<@u<@uvjhh jWCF"t<:t G"t<:u<:uGjuh(j"CjWhHjCj@uh@花 jVhhjBjShxjB"t<:t F"t<:u<:MjShjBFjVhjBjOV}W jOS,hq,j,jP ,h48Vh衋#tVh(菋#tVh0}#t#ujVh<h@V4 5lhhhl(hhh@,4 5lhh j>ljOV|SY jShj>=u V#tuVh`#uchߒO;tOP$hl@S|3 hSn3GP轒$hhj->jjP& jhhj>jhhj=jhh j=hWShh,j=E#=Kuh4h0ގh衒E#jhDhHjT=EE@fEH#Wp 1 S EH1hlh|j=Shhj<Ep hhj<}uVjhhj<h6Shh j<g fDž OfjSH$h۪ jhh@j9<=Ku(=thh2h0dEE}}jjj芐 q#"lh&M9Af f pIf pfu fpff  #tPf p DžQ谏fjS5q f p#l=}uIf pfuh|19QPh<u1 5lhthxj:hl~2h(f25lhThX45lQ݈qpI5lVhhjb:PhhjC: q} qs #tjPhj :jj S fDž 5 nfDžjS5qn q#jPQގ #l}u =##G#xh 1GGw 0 P5 j $h訧 jhhj9=Ku(=thhf/h015q E}}}GP( =uA  tN=,=tԋ =qu#t׃u.jhhj8huj܅E"jh@hDj7jj豅jEPhh5q胄5 5 5  5 5 5EDžjjPp PP5q$ #u2"jPS谥 jShXj7 K#t}u = #uhĞ_-h0*jjS轋 E#ojhhhlj6=Kuh-h0هE#ujhhj^6"u\jhhj<6 #u;tjSh虤 "u"tPjPSup uP+Qhu- uP+QVu K#ua;t\=uSVSh+ h + K+h+ K K#t#t#u h0肆j $h蕣 =(Y#SUWV+5qh0h4j4=qt =@t +@=q~05jh6}N5q謂q=pIjhDhHj84+,,J@^_ÐU+ÐUjhhhlj3~%jhjÐUÐUWV=qu"jhhj30,+u;}j #| M 9G;|=}^_ÐUÐUjhhjN3UEP ÐUuUV=q=uq#Nj=uGhHn5JP9t =uJJ=t0N#}J #~?Vhhjx2NjY=~N#tjA=+^ÐU$WVSEjj}W3 ujEP" jjj褆 ؍5fEjCfEh,bEjEPS #uYEPWS莆 SE#t;P赆 jus$V jVhjl1+jjV [^_ÐU WVVjEP@~ VjEP1~ EhVVjVh j0#ubV#t^Mu#|? @#u 7EjP蛅$V2 jVh,j0+^_jVhPju0U ===jh|hj00EEEsEsJPlfEJPXfEjJfEj<fEj EP#}+UWVS++IJ5Jhhj/5Jhhjl/J#| =J} ޼JPhhj;/5Jhhj!/Eh<|#u5 V({$Vhj.j@VEPY jEPh(j.=t!EPCjEPh@j.=@tNj@h@tP jtPhXCj@EPtP֜ jtPht}uƅtjtPhj.=ttP蚝jtPhj-ƅP-P#t)8t+Et#Phhj+E t#Phhj*Et!Phhj*O^UV==EEEjEP=} q=<-u=xKu =tKtJ5Lh5Vv hhVj)*=xKu =<-t VVW+^ÐUDWVjjjuVh tjDPuVY jV#}++jh8U} R~^_UVuVty4$y$hj 5\V~^ÐUWVSE"tu #-+!hП E4[^_ÐVP8E#|Nj `L;ˋ]+<@;~붐UWVSEEE=q}t+@htu t|+E #t] Pt|8F#u] u#t V|t|8 }]#uj@Sh(i SuhPYthPPt$PESt$jSt }|"EƄ|8WtE#u[^_Ðh8u hus#t,husVush(us}t2h0usPushLuos+E #t)} ]PSTshTSFsF#u]h\u+sur$ujvE+j|#}+ۋMMMMu舄< vECƄ}t}u@}FWPGjhdWCt #jjjWhD菖jhlWt #uWhtO>6E䉅PVw}tuu荅P8 +jXuMr+;u]苄#t P+rF;|j hW_s #u(+P$E( PEjhW#s #t+C}uj#|ZEEEE MMMMuu#tz>tujjVj"#jo#|Pj.jS#}jm%}tEE܉}Ezj#|P j#}}u[UWVSE=q}t+@hou o| +E #t] Po|8F#u] u#t Vo|8 }]#uj@ShL Suh0Poh0P0PLo$0PES1o$jSo }|"EƄ0|8WEoE#u#uo[^_Ðh\u hȠun#t,hؠunVunhun}t2hun0Punh un+E #t)} ]PSpnhSbnF#u]huGnjjuj:#um$ujq+j#}+ۋ}0< 0ECƄ0}t}u@}GVPYjh$VUo #jjjVhh衑0jh,V"o #}Vh4a }tuuPh +j!j~usm+;u]#t PQmF;|Vj(+C}uj6#| }_UWVSE=q}t+@hT)lu l| +E #t] Pl|8F#u] u#t Vk|8 }]#uj@Shp Suh`4Pkh4P4Pk$4PQESik$jS.l }|"EƄ4|8W}kE#u[^_Ðhhlu2k #t,h|u.kVu"khuk}t2huj4Pujhuj+E #t)} ]PSjhSjF#u]huju[j$u@jn+j#i+ۋu4< 3CƄ4}t!#u@}F4QPȑjhȡ4Qk #jjj4Ph4jhСSk #uShء)jA}tuuP +jui+;u]􋄵#t PiF;|#u4Ph7+C#uj#| uE#tS8tNjjPj#=jL#!Pjj&j,#}j#Pj#}UWVSEE=q<}t+@u l*E#hgu$g|+E #t] Pg|8F#u] u#t Vg|8 }]#uj@Sh Suh (Prgh(P(P7g$(PESg$jSg }|3EƄ(|8ufD8CPgE#uE[^_hu$hufh(ufPufh4uf#t,h<ufVufhLu~f}t2hTuhf(PuVfhpuFf+E #t)} ]PS+fhxSfF#u]hufuuehueuh(We Wuehueu j#tnuee$uJ#j D]Vh̢zE']}tuuP} Ej蘻ue+;u}#t PkeF;|+$SjD#u5$5(FuhWt+Sj#t#~ VWUj3jh++j$#]]5(< EFƄ5(}t}u@}CWP̋jhWe #u5jjjWh(jhĢVe #^Wh +F}[j($#C/2UWVSE=q}t+@hcuc| +E #t] Pb|8F#u] u#t Vb|8 }]#uj@Sh Suh0Pbh0P0Ppb$0P=ESUb$jSc }|"EƄ0|8#WibE#u[^_Ðhuh ubhubPu bh(ua#t,h0uaVuah@ua}t2hHua0Puahdua+E #t)} ]PSwahlSiaF#u]htuNajd+j#}+ۋ}0< 0ECƄ0}t}u@}GVP菈jh|Vb #jjjVhׄ0jhVXb #}Vh }tuuP +ju`+;u]#t P`F;|Vh! +C}ujr#| }cUWVSEE=q<}t+@u !E#hH_u$;_| +E #t] P _|8F#u] u#t V_|8 }]#uj@Sh Suh(P^h(P(P^$(PpES^$jSM_ }|3EƄ(|8u]^D8CP^E#uE[^_hu$ḥu;^hܣu;^?Pu*^hu^#t,hu^Vu]hu]}t2hu](Pu]h$u]+E #t)} ]PS]h,S]F#u]h4un]uu`]hHuP]uhP(W)] Wu-]hhu]hpu ]u jH #{u\$u+$Sj7#u5$5(FuhWg+Sj#t#~hWDj"j`++j$#]]5(< EFƄ5(}t}u@}CWP軃jhxW] #jjjWh(jhV] #]VhE%}tuuP Eju[+;u}#t P[F;|WhE+F}u j$#| ]YUhWVSEEEEjZE#YE} WwZ؋uViZÉE̋]SXZM̍D=SVWhVOZhPj!jVfc؃ fP;bfP)bEȍO#tN]ċEčhPWSP c#J|;>N#uȋ]ċNjMM#ˋ]UUЋ EhPVu؍Pb#;uG;EF O;MWO ʉM܍w ;uWO ʃ}=!G ;EUO G EG;E9G O Eԍw;uGO EhPVu؍Pa#t;uj~X#ECEԉCEfC PEPEC}t{E9xcEЉ] UЉ ;udEM#_]EЉE}YEEEEEEEEuv|`#x+H9uE@E]]]EEjjSX FfEf@ PK_fCjF4MEDPW E@E;E|EEPuZ`E#tyGF<uu6#1EEEEu#t\+vHW~Ƌ6P8W+#u4UЋ#t 9y#吐]EEEEE}t uV}u}t uV+MEME[^_ÐUEuX#tjU jU EUV+EEu =XEuj=WEu/X#tjUE jUuuWE#t PjV^ÐUV+EEu WEujVEuW#tjUE jUuukWE#t PjiV^Ujh-h-j~hj;V=qt%#~=J~=J~ sUWVS++=-+ɋ]#|1~|~ #|1+F&l|~t6+D=-#t~#|1~|~uG#|1/N(l |~tݹ6  -QPVWh-j##|1.F(l|~t6+E= .#tz#|1~|~uC#|1+N&l|~t6  .QPVWh .j"##|1.F(l|~t6+F=8.#t|#|1~|~uE#|1/N(l|~t6  ,.QPVWhL.j,##|10F(l |~tݸ6+G=x.#t~L#|1~|~uG#|1/N(l|~t6  X.QPVhd.Wj2##|1*F%l|~t6+H=.#t~|#|1~|~uG#|1/N(l |~tݹ6  .QPVh.Wj>#tF ##uX=GtO=Qu=Ru =Tu4}t5 hZj/h.h.j[^_UWVS++juh.jT-xjxh.h.jrj,#^=-QB=,u3h=<-u =xKt h,/Z/jjݤtIhLb=<-u =xKt h//ht+=<-u =xKt h/.y=<-u =xKt h/.T=,u)=Ku =X-~hX-=<-u =xKt h 0R.+[^_Ã=<-u =xKt h/,.=,P-=#u#u#E#]j؃ujF=,uN=KuEX-#uhإX-@X-#~ hX-h0Q;5T-!|nd=/=Jt q JPQPWA Sh/WjC=#Gh(6=<-u =xKh`/JJ+=Jt>q7P-@P-Ɓ!P-@P- $jE#uFP-=}$}O#u#u|#:P-=|=<-u =xKh0UVP-#t.P5VhD0Y 5P-V P-T-x^ÐUWVS=b=Uuws 6] #|1~|~ nuR#|1.C(l|~t6+EuT#|10C(l|~t6+DRuT#|10C(l|~t6+GuT#|10C(l|~t6+Fu %uE= -#|1~|~ #|1-C(l |~tݸ6`K3=<-u=xKu =tKwsuu P0 X0#|1~|~uC#|1-K(l|~t6  d0QPhĦ=WyGShp0Wj =<-u =xKt W9(+#ç+ƀF[^_`K@-Ƅ`KEƈE]E=<-u=xKu =tKwsuu t0  |0#|1~|~uH#|10C(l|~t60PQh=WFSh0WjjEP==<-u =xKtt h&#|1~|~ n#|1.C(l|~t6+EtN#|10C(l|~t6+ƁE#|1*C%l|~t6+DtJ#|1,C'l|~t6+ƁD#|1.C(l|~t6+GtN#|10C(l|~t6+ƁGr#|1*C%l|~t6+F$#| 1| u l6UWVS=u =+Vh0h0jrngËPh=WB Sh 1Wj4=<-u =xKt Wa#VP2;|[^_Ë]#|1~|~ eu#>2}u+ƅƅ} Lj}t#~VuPqB Ƅ5Ƅ5=<-u=xKu =tK-.uzuu#|1~|~uG#| 1| Cu l6t0ouuz#|1~|~uE#|1-C(l|~t60Ph$##|1~|~uF#|1.C(l|~t60uPhHËWPh=W?N''u0!01#tt1P5 hl=W?++;}uuM+E0}PhhL'c? hL'We?E'hWM?EhW5?F;u|uhԧW?hhӐhhÐ"t<t<t<t hL'됐#|1~|~uG#| 1z| Cdu lO6D1>UWVSm#=P-j؁d=$15(1=Jt q JPQP2 SWVjhuHJ J+=JtNqGP-@P-Ɓ.tătރP-@P-#}#|s#~=P- [^_ÐUWVS5-=GE=QSPh<1hH1jj-} h1#t P-S#u#t =P-tՉ5-#tP-+P-=t_S1O#P-=t0=St+[^_SPh1h1jjE-} 1#t P-S#u#t =P-tՉ5-#mP-+a=q?UM= 9+DS6S&AHTQÐ=Jt;P=PuyK#t=Ju =Mu^#t=Jt = "uHj 두=JuK#u=;t ;E=Lt=DMu2j붐#t=Ju =Mu#t=Jt= "tj S$S=Q=RRUWVS++#|=1-P%l=|=~=t6+ƆB#|=1,P%l=|=~=t6+ƆC#|=1(P#l=|=~=t6+ƆD#|=1,P%l=|=~=t6+ƆE#|=1,P%l=|=~=t6+ƆF#|=1,P%l=|=~=t6+ƆG#|=1(P#l=|=~=t6+ƆH#|=1,P%l=|=~=t6+Ɔ@#|=1,P%l=|=~=t6+ƆA#|=1,P%l=|=~=t6+Ɔ<#|=1(P#l=|=~=t6+Ɔ=#|=1,P%l=|=~=t6+Ɔ># =1PЋ+ƀ?+#|1.B(l|~t6Ƅ`KF|B=6PSQRT  <=>?tuvw@ABCxݜa{ޜb+#|1~|~ m ,#|10B(l |~tݸ6#j#|1/r(l|~t6+<+>+@#|1-B(l|~t6##|1+J&l|~t6+=ʋ+?+ABa[^_=| ==u l6#| 1| rul6#| 1?| J)u l6U=t ]=pt9t#t05xPR5t2+txp=t _=t a=t `ÐUWVSP-T-xX-++#|1~|~ j #|1+G&l|~t6+ƁB#|1.G(l|~t6+ƁC#|1*G%l|~t6+ƁD#|1.G(l|~t6+ƁE#|1*G%l|~t6+ƁF#|1.G(l|~t6+ƁG#|1*G%l|~t6+ƁH#|1.G(l|~t6,#M#|1-O(l |~tݹ6+<ϋ+>+@#|1-G(l|~t6##|1/O(l|~t6+=ϋ+?+A=tK#|10G(l |~tݸ6+@" 1#|1~|~uH#|10G(l |~tݸ6D1:Nj/1&Nj2Nj<2jPQj#| 1| Ou l6#| 1_| OIu l36( 2#|1~|~ #| 1| Gul6 $2#|1~|~ #| 1| Gru l[6P H2#|1~|~ A#| 1(| Gul6<<<t#|10G(l|~t6+A" l2#|1~|~uH#|10G(l|~t6C`29Nj.2%Nj2Nj2jPQjh 2#|1~|~u#|1~| Gmu lW6L 2#|1~|~ =#| 1$| Gu l6 2#|1~|~ #| 1| Gu l6<< <w+#|1.G(l|~t6Ƅ`KA|Gd=D-ude=-uPSQRT55p=-t5tP>(5t t#u5x5-+[^_ÐUWV5h2h2j5,h3h 3j=u_=,uV,=\,+G,jh 3h$3j++Ph(4h,4jn+=,u=Gu(=Erj/h#|I=Fu,=Dr#j/h#{H#th4#ap,5Jh4h4j5,h5h5j|^_#= =u jhL3hP3jC5,h|3h3j+=,5Jh3h3j5Jh3h3jJ#| =J} NfJPh3h3j5Jh3h3j=J~t=J~k=ub=rYjh# jh#=u =sɀ=u,=r#jh#}=u,=r#jh^#H=H-u5=u,=}r#jh # =~u,=|r#jh#jh3h3j!=uB=r9jh#ujhP4hT4j=uO=rFjhU#}Pht4hx4)jh4h4j~=Bu,=@r#jh#D=Cu,=Ar#jh#E=-t5=u,=r#jh#t=vu,=tr#j#hU#?x=fu,=dr#j'h # h=gu,=er#j'h#i+/5#|1~|~ #|1,F'l|~t6+B#|1,F'l|~t6+@rgVh##|1.F(l|~t6+ƁD#|1-F(l |~tݸ6+C#|10F(l |~tݸ6+ArsVh##|1.F(l|~t6+ƁE $0F#h4#sNUV=<-u =xKt55JuVh 5jJ=t= u V^ÐUVS=u =+EEE/] HMEEE#u=xKu =tKtDPh5VA Sh,5Vj=<-u =xKt VjEPץ=][^Ë]#I @#tu+P6P-R#Qtك tԃtكt<-EEE/]EEE#u=xKu =tK+ w8$@05)<5!D5T5`5p5Ph5V Sh5Vj=<-u =xKt VjEP薤=UWVSjh5h5j5E ++jEЃ#eÈpF=Kt=cu Pu#tN+ #ua|}u_jh5h5j=<-u =xKt h5E!tE}uuuh6h 6jI}uh<6hD6j(=<-u =xKt hp6Q+Vhh]jh<hj=<-u =xKt hME [^_Ð=tKu=<-u =xKtE6+MUtuuEtE6Džt6p< $ 1u:6Džt6B6Džt606Džt6/tӃ!t6Džt6&E q s[0,xEr<uKDž|6ODž|6@Dž|64Dž|7(Dž|7Džx(7<t<t<t<t؃%rE qsɋ<$ =47x< s p%@7|EE")Es< $4 L7EL7 t \7E\7 d7Ed7 p7Ep7z tӀt 7E7[ 7E7H t 7E70 7E7 7E7 7E7 7E7 7E7 7E7 8E8 8E8 8E8} 08E08j D8ED8U X8EX8A l8El8- t8Et8 9E9 t 9E9 9E9t ,9E,9 89E89t L9EL9 X9EX9 h9Eh9m x9Ex9Z 9E9E 9E91 9E9 9E9  9E9 9E9 9E9 9E9 :E: :E:E(:Dž|(:sE4:Dž|4:SED:Dž|D:3ET:Dž|T:Eh:Dž|h:|:Džt|::Džt::Džt::Džt::Džt:~:Džt:f:Džt:N:Džt:6:Džt::Džt::Džt:;Džt;;Džt;M:Džt:q<0,xErM<<<<*<A|Ix|MEE(L']tx|M8Džt8K8Džt838Džt88Džt8L'L'M9M=]q4p%p4$hhWWhL';]|Y8Džt8E9EMEp0,t@;|G8Džt8xNߋEEw$\8Džt8x8Džt8x8Džt8x8Džt8x8Džt8xh8Džt8E q<$xrp%|s< n$h;zNߋEEu$Ȫx|MEE!O%v&/L1x|MEE&z/Yx|MEE&]x|MEE&Izx|MEE&t5X;5`;uu>t 5d; 5l;uu>t 5p; 5x;uu>t5|;5;uu>t 5;5;u܋u>t 5; 5;u؋u>t 5; 5;uԋu>t5;5;uЋu>t 5;5;űu>t 5; 5;uȋu>t 5; 5;uċu>t5;5;uuuuuuuuuuuuuuuuuuuuuuuuuuQuSuWRPhth ĈE9E}u]=L'p< r< ̩#t;;PRQW ;PRQW +Wh C;]|#uhhn }}uIhMEtxx ة#r;mhUPWVS]FPh<h<jn)E))ç+ƀEv)ç+ƀEV)ç+ƀD6)uhp ))ç+ƀD+(çPh|W jh<Wj舽=<-u =xKt WWhj1`tI(=x=t#djuփE=ujփ=tE}EE=w }sZ}tQuh =W uh<Wj覼=<-u =xKW=u jh <h8<j`=Kt=cuScEPV}}=tKu=<-u =xK}w }s }u}u `<Eh<Ph(=W uht<Wj荻=<-u =xKt WE8=1$Ԭjhx<ujփ#w&ۃ=Kt=cu P9=tKu=<-u =xK}}w }s }u}u <E<#|1~|~uE#|1-K(l |~tݹ6  <QPh<=WSh<Wj=<-u =xKt W?}[VEPS #%#| 1x| dXuhph\=Z #|1~|~uS#|1/C(l|~t6+ASh詺#'#|1.C(l |~tݸ6+Ew| çml^t6K#|1-C(l|~t6+C#|10C(l|~t6+EuSh]##|1.C(l |~tݸ6+EtN#|10C(l |~tݸ6+ƁE#|1.C(l|~t6+ƁC#.1.C(l |~tݸ6+B#|10C(l |~tݸ6+Dh#|10C(l |~tݸ6+@/#|1/C(l|~t6+Bj#|1*C%l|~t6+DX#|1,C'l|~t6+@ShU##}6| ul61} #|1*C%l|~t6+E#| 1| u l6'jhTuV jVjj'l'u#|1,C'l|~t6+Ex#1{+ƀEQ#|1~|~ #|1/C(l|~t6+CuT#|10C(l|~t6+E#|10C(l|~t6+Euf#|10C(l|~t6+GuSh5##|1.C(l |~tݸ6+GtN#|10C(l |~tݸ6+ƁG#|1.C(l|~t6+EtN#|10C(l|~t6+ƁE#|1.C(l |~tݸ6+CtN#|10C(l |~tݸ6+ƁC9} w#|1/C(l|~t6+E8#| 1| l#|10C(l |~tݸ6+ƁO#|1.C(l|~t6+ƁM#|1.C(l |~tݸ6+ƁN=JJPh`5\-Vg Whl=l-WR V9<$1Ë+ƁE=,u =J~P=Jk= KKf6Mt/R5#|10C(l|~t6+GtN#|10C(l|~t6+ƁG#|1.C(l |~tݸ6+EtH#| 1| Cuu l_6T#|1,C'l|~t6+A$=#|1~|~u@#| 1| u l6<#|1~|~uS#|1/C(l|~t6+@Sh艬##|1*C%l|~t6+D| çlt6#|10C(l|~t6+B#|10C(l|~t6+DuSh=##|1*C%l|~t6+DtJ#|1,C'l|~t6+ƁD#|1.C(l|~t6+ƁB#Z1*C%l|~t6+C#|1,C'l|~t6+EX#|1,C'l|~t6+A/5Jh<h<j蘧5Lh<h<j~5Mh<h<jd5 "h<h=jJ5;h=h =j0=Lu8K#t" Ju =Mut = "u #u=;t j}#|1.C(l|~t6+Cj!#|1*C%l|~t6+E#|1,C'l|~t6+A0Sh}##}.|çlt61͋+ƀEL-@L-}%jh,=h0=jVhjj#t =,t[!#kGYjGtI=Jt=Ku jjɢ#|1*C%l|~t6+D#| 1z| cu lS6H7j#t =,tU#eAS#|10C(l|~t6+D#$1+ƀD}}j}}#|1~|~ #|1/C(l |~tݸ6+BuT#|10C(l |~tݸ6+D #|10C(l |~tݸ6+Duf#|10C(l |~tݸ6+FuSh腣##|1.C(l|~t6+DtN#|10C(l|~t6+ƁD#|1.C(l |~tݸ6+FtN#|10C(l |~tݸ6+ƁF#|1.C(l|~t6+BtN#|10C(l|~t6+ƁB&/#|10C(l|~t6+ƁLIË+ƁF0#|1,C'l|~t6+DtJ#|1,C'l|~t6+ƁD#|1.C(l|~t6+FtH#| 1| Cu l6#|10C(l |~tݸ6+@L=#|1~|~uA#|1~-|çl t6L=PhȫW jhX=Wjx=<-u =xKt WWh#|10C(l|~t6+B#|10C(l|~t6+CJuhph=Z =,-#|1*C%l|~t6+D@=#|1.C(l|~t6+ƁD#|1*C%l|~t6+ƁC#|1~|~uC#|1-C(l|~t6=PhW jh=Wj=<-u =xKt W?#|10C(l |~tݸ6+EF=#|1.C(l|~t6+ƁE#|1.C(l |~tݸ6+ƁB#|1~|~uE#|1-C(l|~t6=Ph\W jh=Wjx=<-u =xKt W#|1.C(l|~t6+ƁHJ$<;j谐#t =,tf#p"u pt)=(tpt@u ƀph #tj?PEP E5qV4$h=|-W Wv #bVPh=MVEP'#8jjjj3p<u:j臏#t =,t#" pt+=pt@uƀpjhqh=&=tKsMƁnjhph\>jN=,u =J6pjb#uP#u=Jt=J5J= K5KVh5\-Vr WhĬ=l-W] VD<$<0<$M"uQh>h > Qh<>h@>j貕=,u =JMQhqQhqF#p"w<g=,=JyjM#t=,uIQt#KMQhqP tMDtMDM xp[^_ÐUXWVS+=u =u]#u +[^_ËM #t+++E; ;" #ue#utDDVEPht>j-VEPh>jhEP4#u$j@EPh@} tttEE++Ҋ ;ud["t+SK ;L@@ ;LB4tۃt&G;} } u=|@| ttG;} tt밐UlWVS=@}E==}5L=LjjjVh>\#uSVhhLPhhShh S ]\jjjVh>#ujjjVh>#ujjjVh>#pu =tu=tj@WS S]u uh>裘 jWh>jɑjSh>j跑jh8h ?j衑jVh$?j菑juh"#,#-<%Ƅ +E8tuC\=th)\=th\=th\ =8th8\ =LhL\ nu\Yh\Bhz\+hb\ h8J\ u5\ h,P#u E8Th4P#u =Dh<P#u =6hDP#u =)hPPt#u =8h`PO#u} ƅ+Ɋ><u "t+b> AUjhP?hT?j轎=<-u =xKh?hP@ۻG;} }|G;} $uËMMMMP#jh?h?j7=<-u =xKt h?`jh@jj'U#} 9+2S"PSjj'##|S[^_<<!<]<U++++ƅ;} +}EE}UUE"}/#1<)Ƅ .?t63hlD3PD3WD3PW6t0=t>3htD3PsD3hD3P\ht0=t>3h|D3P,D3hD3Pht0=t>3hD3PD3hD3 Phat0 =8t>3hD3PD3 h8D3 Ph8t0 }3hD3PVD3uD3 PAut0 t3hD3PD3WD3PWt083hĮD3PD3hD3PhUt03hԮD3PD3hD3P~ht03hD3PQD3hD3 P:ht0 k3hD3P D3 h8D3 Ph8t0 '3h D3PD3uD3 PuIt0 hP#u ?RhP#u =jḫP#u =hܮP#u =hP#u =8hPf#u} }ƅ+ɋUE<u"t+E]<<{ ABjh@h @j蹈=<- =xK<t<uEE 9EUWVS+=u=u =+=p=tKu=<-u =xKtSƆpht5L h4SPjh@Sj=<-u =xKt SƆpFƆpFVW[#][^_+ۡ-#t%jPh@j~-8tؿjh@h@jU#uh,#tSq=|@pqrs"#ut PpCF"uUWVƅ=u=u =v+=tKu=<-u =xKtSƆpht5x h|=WjhAWj8=<-u =xKt WeƆpFƆpFVhp+Z#a^_Ð=LtSjjj=LWh@\#uOWhhXLPhhdWjhhpW MjjjWh@#ujjjWh@#ujjjWh@#tjWh@jpqr#s"_pGF"uLUV=t{-#uApqr"tpBN"t|ƆpƆpFVhpX#}+^ÐƆn=tKu=<-u =xKths5H h5V^jhAVj=<-u =xKtVUWVS+JJ=x=k=^#}+#}+;u ;>ƆpFƆpFƆpFpF΍Qou ƆpQp΍Qou ƆpQp΍Qou ƆpQp΍Qou ƆpQƆpƆpF=tKu=<-u =xKtCPSh=Wjh AWjq=<-u =xKt W螯VhptV#} +[^_ÐUE$l=;r h=;s +E=ÐUE$?;r ?;s +E?ÐUE$A;r A;s +EAÐUE$D;r D;s +E4DÐUE$PF;r LF;s +ElFÐUE$H;r H;s +EHÐUE$J;r J;s +EJÐUE$M;r M;s +E,MÐUE$TO;r PO;s +EpOÐUE$Q;r Q;s +EQÐUE$S;r S;s +ESÐUE$V;r V;s +E,VÐUE$TX;r PX;s +EpXÐUE$Z;r Z;s +EZÐUE$\;r \;s +E\ÐUE$_;r _;s +E4_ÐUE$Ta;r Pa;s +EpaÐUE$c;r c;s +EcÐUEÐUE$tl;r pl;s +ElÐUE$n;r n;s +EnÐUE$p;r p;s +EqÐUE$s;r s;s +E8sÐUE$Tu;r Pu;s +EpuÐUE$;r ;s +E$ÐUS]Phh j}Ë8;r 4;s +ET[UE$h;r d;s +EÐUE$w;r w;s +EwÐUE$y;r y;s +EyÐUE$ |;r |;s +E<|ÐUE$E8ff|f8fwfifl[f(Mf?f1f\#> (f\tf~tff@r f f@ff@r ff@r ff@r ff@r ff@r ff@r ff@r ff@r ff@r fH ÐffrfwUfEf=f=\(_q(bVK\>2N&ʁ}L~EbE]\ae{fngbhVK>d2c&~ˁ́́~݁r΁fށ[NB|6+ځȁɁ߁vk^RF;."ہ ܁{nbVK>2&~rf[NB6+E4f=`vEkEXf@Hf8f+f fP ffff`ff=f=f=Gf=r f=wGf=xr f=3Df=4r f=Cf=r f=Cf=r f=gCf=hr f=#@f=$r f=?f=r f=?f=r f=W? f=~tf=s@ (A (f=f=f^f=v I (뫐$f=s( Qf= uf= s& Qf=Q Gf=% A f="f=3 wff="i$8f=!wSAf=!w#f=; f=> .f=+!f=!f=!f=!f=!f=!f="f="f="f="f=5"wff=)$İf=j"wFf=="f=R"f=`"f=a"f=f"f=g"Lf="w&f=k"f="f="f="f="f=#I f=0L A f=7%wff=4w$lf=%f=K%w?f=8%vf=;%yf=<%{f=?%}f=B%~hf=%f=%f=%f=%f=%f=%%f=&w>f=%f=%f=%f=%f=%f=&f=@&f=B&f=j&f=m&f=o&f=Ns(J f=0 f=rf=sf=rf=N/f=%J f=wbUfEf= rKf= wE -~'v"of<^>V/Of= rf= vf= rf= vf= rf= vf=" rf=$ vf=C tf=9 tf=: tf=D tUfEf=> u  f=rP/ÐUfEf=sf -'"<z>q/iaf= rf= vf= rf= vf= rf= vf= rf= vf=" rf=$ vf=C tf=9 tf=: tf=D tfuf%ÐUfEt+f=tPÐUfMtXp@h[`\X}Q{H]@^8`1|(n f=w $@QxÐUfMtPE[=\5{.|%}~f=tf=tQÐf=rtf=tf=tf=tՐUfMt{J]n#f{^~W}N@F\>[7|.&f=|tf=tf=tf=tufËf=rtf=tf=tf=tf=t͐UfMttj[b\Z]S^J`B{:|3}*~"f=tf=tf=tf=tQÐf=rtf=tf=tf=tf=tUfMt|r#j]c~Z[R`J@C\:}2{*|#f=tf=tf=tf=tQ"Ðf=rtf=tf=tf=tf=tf=tʐUfMth\@T[M\D]<~4{-|$}f=tf=tf=tQÐf=rtf=tf=tf=tf=tUfEf=`r f={rf=sf%ff=rf=rÐUfEf=t P聭f%ffraegoxitzbrhjucpZf=r f=Wf=r f=Tf=r f=7f=r f=4fzf=Pw $ÐUfMftf3 uo~c\@T[L\D]={4|,`$}f=tf=tf=tQtÐuf=rtf=tf=tf=tf=tɐUfMtd[@T[K]C^;`4{+}#~f=tf=tf=tQËf=rtf=tf=tf=tf=tUfMt[#|@t[m\d]\`T{M|D}<~4ftftft f=w $QÐUfEf#t,\%~f=tf=tf=> tPÐUfEf=arf=v@UfEf=PSf%faYbNwAg5d)evzijklmnoprstuxfphic`~X{P}Iy@x8|0`)q f=wff=w $\ÐUfMth\TLD=4,$f=tf=tf=tQÐf=rtf=tf=tf=tf=tUfMth\#T@M[D\<]4{-|$}f=tf=tf=tQÐf=rtf=tf=tf=tf=tUfMt|r@j[b\Z]S^J`B{:|3}*~"f=tf=tf=tf=tQjÐf=rtf=tf=tf=tf=tf=tʐUfMtl#x@p[h\a]X^P_H`A{8|0}(~! f=w $ܴQÐUfMfrg\OC7,wl_SG</# |ocWL?3'sg\OC7,zsjbZSJB:3*"f`f=mw $PQGÐf=rf=Zwff=Jw$f=pwBff=w$4f=}w@Rf=qf=yf=zf={f=|ff=~f=f=f=f=f= "UfMf ,  yl`TI<0$ |pdYL@4)ti\PD9,  |skc\SKC<3+ftft⍁`f=w $Q&UfMfbsg\OC7,wl_SG</# |ocWL?3'sg\OC7,zsjbZSJB:3ftftftӍ`f=w $QÐUfMf~sfZNC6*vj^SF:.# zncVJ>3&~sfZNC6*yqibYQIB9f=f=f=ff=,w $xQÐf=.rf=!tff=0w$,UfMfJsg\OC7,wl_SG</# vnf_VNF?ffff=Fw $QÐUfMf6,  yl`TI<0$ |pdYL@4)ti\PD9,  |skc\SKC$ 2+$f`f=w $QËf=f=f=rf=w8tf=f=f=f=f= 뎐f=]f=f=f=f=Ufvf=F$f= f= f= f\f=*UfMf|peXL@5(uh\PE8, {skd[SKD;3+$\f`f=7w $QËf=rqf=> f= f0f=w륐UfMfsNE=5.%f=tf=tQ+Ðf=0rtf=1tf=^tf=_tՐUfMfZqeYNA5)ui^QE9.! ynaUI>1%~qeYNA5)xpi`XPI@80) `f=w $Q|ÐUfMfsf\TLD=4,$f=Rtf=Stf=`tQÐf=artf=xtf=}tf=~tf= zUfMfynaUI>1%~qeYNA5)xpi`XPI@80) f=?w $$QÐUfMf2% }$$gYMB5)$@ymbUI=2% }reYMB5)$|$ynaUI>1%~qeYNA5)xpi`XPI@80)f=f=f=QÐf=Hf=(wpCf=wPnf=w4f=rf=f=f=됐ff=w ff=pff=\9f=U%f=%wzf=Qwff= if=d"w*f="rf="tf=H"vf=e"~f= #f=!#f=,%w(f=%~ff=$f=4%ff=$xff=Jh$UfMfui]RE9-" $ynaUI>1%~qeYNA5)$DynaUI>1%~qeYNA5)xpi`XPI@80)f=f=f=QԾÐf=Ef=%wtNf=wTuf=w4 f=rf=f=f=됐ff=w$ff=lff=XAf=,%f=w(f=ff=$f=%w\)f=d"w,f="f="f=H"f=e"f= #f=!#f=%ff=$Dff=l$UfMfsF>6.&f\f=w $\QÐf=rtf=wtf=tf=tf=tf=tf=tf=Rtf=StUfMfyl`TI<0$ |pdYL@4)ti\PD9,  yl`TI<0$ $rg\PD9,  ${skd[SKD;3+$f`f=?w $4QËf=rf=1wsff=wOf= f=wVf=Sw&gf=A:f=Bf=Jf=Lf=Naf= f(f=Hf=f=ff=+$4UfMfB7,wl_SG</# |ocWL?3'sg\OC7,zsjbZSJB:3*"f`f=3w $Q۰Ðf=rf=wf+f=w$f=wIff= w$f=! w@Zf=(f=S&f=x$f=!f=v ff="!f=!f=d"f=e"f=%,UfMfwk`SG;0# {pcWK@3'sg[PC7+ wk`S$L=/# $sg\OC7,zsjbZSJB:3*"f`f=Gw $QÐf=rf=nf=wff=wsf=1wff=wf=w*f=Rf=Sf=xpf=f=f=Lf=0 wvf= wR(f= f= f=f=f=f=f=ff= $f="wRhf=D f="!f=&!f=" f="f="f="xf=`"w*0f=" f=+" f=H" Hf=d" f=e"f=%f=UfMfwl_SG</# |ocWL?3'sg\OC7,wl_SG</# |ocWL$5*zsjbZSJB:3*"f`f=Jw $Q Ðf=rf=f=wff=w$@f=wX"f=Sw(f=f=1f=R끐f=xf=f=\f=f(f=Cf=D wff='!$f=+"wZf="!nf="w f="pf="mf="nf="lf="if=e"w*f=H"^f=`"\f=d"Yf=%Zf=Xf=f=tZUfMfB8, xl`UH<0% |peXL@5(uh\PE8, {skd[SKD;3+$f`f=3w $ QËf=rf=wf+f=w$f=wJff= w$Tf=! w@Yf=(f=S%f=x$f="f=v gf="!f=!f=d"f=e"f=%-UfMf|"Cxl-`TUH<0%3' ,1A|peXLE@I5(xOUYauh\PE8, oy$ncXL@5(uh\PE8, xl`UH<0% wpg_WPG?70'f f=QËf=w&f`f=Tw$f=%f=f=rCf=w4rf=8f=:f=QlÐf=rf=wrf f=wKf=Q%f=%wZf=1Ff=%w ^f=;f= >{f=%Ff= %Gf=%JWf=,%w*tf=%Ff=%Gf=$%J'f=4%Rf=<%Sf=P%Vf=i%wff=$lf=%w*f=l%zf=%wf=%vf=%vf=%sf=%rf=%pUfMf|pdYL@4)ti\PD9,  yl`TI<0$ $|peXL@5($k`UH<0% wpg_WPG?70'f`f=>Q|Ëf=rf=wzf f=wVf=Q%f=%wXf=\f=%whf= Rf= /냐f=%Qf= %Tf=%V^f=,%w*f=%Qf=%Tf=$%V.f=4%]f=<%`f=P%b f=i%wff=$0f=%w*f=l%f=%f=%~f=%}f=%|f=%zf=%xUfEf=rf=f=qeYNA5)ui^QE9.! -|uld\ULD<5,$f=-f`f=w $|?Ðf=df=rf==wD;f=&f=f=f=f=f=f=>f=Af=Bf=Zf=[ f=^f=_Ef= w~f=}wLff=$f=w*Xf=)f=,f=.f= 5f= +f= .f="!f= |ff=$0UfEf=/% |pdYL@4)ti\PD9,  yl`TI<$& |peXL@5($ xl`UH<0% wpg_WPG?7f=< f=> f=~f`f=w $?f=/wVf=w:8f=rlf=mf=pff= w$ff=wif=Owff=wf=w(f=ff=]$,f="!f=!f= ff='$hUfEf=rf=Af=7*-yph`YPH@9f=Rf=Sf=` f=a f=x?Ðf= wR?f=}rf=~f=f= f= f= f= 렐f="!Yf= Hff=w$UfMfsg\OC7,wl_SG</# |ocWL?3'sg\OC7,wl_SG</# vnf_VNF?6.&f`f=w $XQ^hÐf=Brf=w$mf=Xff=;w$f=Q%f=%wZf=6f=%w Mf=,f=.qf=%6f= %8f=%:Mf=,%w*cf=%6f=%8f=$%:f=4%Bf=<%Df=P%Ff=i%wff=$f=%w*f=l%jf=%hf=%ff=%ff=%df=%bf=%_wUfEf=K@3(sh[OC8+xk_SH;/# {ocXK?3(s$^SH;/# $~vof^VOF>6/f=<f=>f`f= w $?Ðf=wPfYf=wf= w&f= f=f= `f="!f=  ff=6$UfMfsNE=5.%f=tf=tQ#Ðf=0rtf=1tf=^tf=_tՐUfEf=rfZOB6*vj_RF:/" zobVJ?2&rfZOB6*yqjaYQJ$ 70)!f`f=w $p?Ðf=Xf=rDf=f=w:f=*f=,f=-f=(f=f=f=lf=f=f= f= JfKf= 9$f=wf0f=f= wb8f=w>f=f=_f=bf=df=fff= $f="!f= f= ff={$HUfEf={ocXK?3(sh[OC8+xk_SH;/# {ocXK?3(sh[OC8+{rjb[RJB;2*"f`f=7w $?Ðf=*wdf=rf=Sw$tf=Rff=w$f=Of=ff=w$f=Mwff=!t$f= f=wH^f=~f=Nf=Of=Pf=Qf=R f=f= f= f= f= f= f= 6f="!>f= ,ff="$UfEf=sh[OC8+xk_SH;/# {ocXK?3(sh[OC8+{rjb[RJB;2*"ff=w $?Ðf= rxf=[wff=Hw$f= w$8f= "ff=w$f="!{f= jff=w$UfEf=|odWK?4'tg[OD7+wk_TG;/$ {odWK?4'tg[OD7+zrjcZRJC:2*#f`f=Aw $?f=rf=w$f=xkff=ow$f= f=wMWf=wf=f=념f=Nf=Pf=af=#w*f=zf=f= -1f= rf= sf= " f="!rf= f= ff= $UfEf= ? +     z m a U J = 1 %              } q e Z M A 5 !* " # $ % & ' ( ) * + , - . / 0u 1j 2] 3Q 4E 5: 6- 7! 8 9 :;<=>@ABCDEFzGmHaIUJJK=L1M%NO PQRSTUVWXYZ[}\q]e^Z_M`Aa5b*cdefghijklmnopqurjs]tQuEv:w-x!yz {|}~zmaUJ=1% }qeZMA5*uj]QE:-! zmaUJ=1% }qeZMA5*xqh`XQH@81( $4ÐUfMf-# $4qf[OC8+xk_SH;/# {ocXK?$P)tg[OD7+wk_TG;/$ ~vof^VOFf=Vf=f=f=f=f=QB4Ëf=<waf=wB2f= w"hf=rff=w8ff=w$ff=w\f=^wff=r$ f=T%|f=%wZf=%w*f=_f=!f=%f= %f=%f=%f=4%w*f=%f=$%f=,%f=<%f=P%f=Q%f=l%wff=$f=%f=%w f=%f=%Qf=%f=%f=%-UfMf |ocWL?3'$sh[OC8+xk_SH;/#$sh[O$p9+wk_TG;/$ ~vof^VOF>6/&f`f=w $QR,Ðf=:f=Rf=w`yf=r f=f=f=f=f=f=f=of=wZsf=^f=w "f=f=1f= f= f= ff=aff=f= #hf=Jwff=qf="wRf=!f= f=Kjf=Lkf=Mnf=Npf=Or]f=H"w*f="f="f=)"-f=a"f=d"f=e" f=W%Lf=%w(f=!#ff=$ f=<%w,f=$%f=,%f=4%f=P%f=Q%f=T%uf=%w ff=Z$pf|f=B$UfMfrfZOB6*vj_RF:/" zobVJ?2&rfZOB6*vj_RF:/" }vme]VME=6-%f`f=@w $0Q#Ðf=rf=^wyff=Ow$4f=T%ef=%w\f=%w,Ff=_@f= f=%zf= %f=%f=%Tf=4%w*f=%f=$%f=,%$f=<%f=P%f=Q%f=l%wff=$tf=%~f=%w Jf=%Df=%.f=%1f=%4f=%jUfMf ${odWK?4'$wk_TG;/$ {odWK?4'tg[OD7+wk_TG;/$ ~vof^VOF>6/&f`f=w $QÐf=,"f=f=rf=wXrf=w(Yf=f=f=k뎐f="f=#f=>if=w*f=f= f=9f=9f=f=f=w>f=wfOf=$f/f=1f'f=f=U%lf=%f=)"wZf= w* f=f=f= 2af=" f="f="r=f=e"w*f=H"f=a"|f=d" f=# f= #f=!#f=,%w(f=%Vff=$f=4%ff=$Dff=J$UfMfsg\OC7,wl_SG</# |ocWL?3'sg\OC7,wl_SG</# vnf_VNF?6.&f`f=w $QÐf=tf=fw|f=r]f=@wLjf=wf=0f=f= f=xf=yff=j$Lf=$%wlf=H"wHf="qf=gf=hf=if="f="ff=$f=w\%f=%w,nf=,%f=4%f=<%tf=%f=}f=f~f= ~$fof=kf$HUfMf& }r$[PE9-" $ynaUI>1%~qeYNA5)$PynaUI>1%~qeYNA5)xpi`XPI@80)f=f=f= Q Ðf=Gf='wpNf=wPwf=w4f=rf=f=f=됐ff=wff=pff=\Ef=U%f=%w<f="f="f=!ff=$f=,%w(f=%ff=$(f=4%ff=$ff=J$UfMfsg\OC7,wl_SG</# |ocWL?3'sg\OC7,$ m_SH;/# ~vng^VNG>6.'f`f=w $ QËf=wP*f=w0f=rf=f|f=w$ fkf=w$( f= w/Hf= 3f= fLf=of=W%w~f=%w\ff=B$ f=<%w*hf=$%9f=,% f=P%Ef=Q%Hf=T%Jf=l%wff=$ f=%jf=%w vf=%[f=%Zf=%Zf=%Wf=%VmUfEf=6+.#f=tf=tf=uϸf=" rtf=< tf=!tf=!uf=!tf=!tf=!?uj_Sf=!ftf=!rtf=#tf=%tf=%f=%tf=%tf=% f=%rtf=%tf=:&tf=;&S~ v of^VO Ff=%f=<&ztf=@&tf=B&tff= $D ÐUfEf=r f=$%p%m%% %%o%n%%{%s%k%d%[$S%K%D%;"3+f= tf= tf=tff=w $x f= rtf=tf=tff=w$ UfEf=  Dx Tl ` aU cH d< e0 g% I Y l n O o r s t u z "| p e X L @ 5 i( k   x012456u7h8\9P+E8f=QRff=Ew $ f^f=w$43U~ti(\)PD9,< >f= $||pdYL@4)ti\Pf=<"f=C"f=H"f=`"X-f=4"uf= $f= $f=$$iwl aTH <1$ f=:&tf=;&tf=<&tf=@&tf=B&  f=`&rtf=c&tf=e&tf=f&tf=j&tf=k&aof= $`f=*#6f= $7@5(f=a"2f=d"f=e"f="f="f="fmf=6$|f=l&f='7f='-ff= Q$XUHff=& $$f= [f=]f=tff=$ff=$f=u׸f=&f= f= kZf=Zf=ubf=wrf=gf=w,]f=f=yf=f=f=f=f=8f=f=Rf=owff=$f=w4 f=qf=zf=|f=~Wf=2f=Bf=8f=)f=r f=ff= r6f= w0f= fOvPR#$f=!rLf=!wFf=!wfpf=$<f=!f.f=$|f="r.f="w(f=+"rCff=(`$f=#r.f=$w(f=)#(ff=,$f=%rf=R%wff=R$f=S%r f=y%f=z%Vf=%Lff=j$4UWV+M+ҡ,sb#~f0,+yri,f=0E=|f=0fv?f f 0H,#t#u#tf0+#M 0#@,#~?s,2s,s,,#A^_UWVSf]fs'Vh4h8,VhLhPfrVhdhhj^Ɓ|G=W$ۋ% |Wۋ% |Qۋ% |Qۋ% |Qۋ% |f È|V=|Whj]E 8[^_UUM=ԍu6.&f=( tf=) tPԍÐEPQ##|ʋEǐUVSE5#u?jhhj]E @@[^ÐU‹M~€u #tRփMQP#|u;|Phhj\F+ҋM ;}uB;|널U+ÐUu uj褩 ÐUu uj蜩 Uu uj蔩 Uuu uj艩 UWVj$j5V j$jhljWM #|ƒ=tKtjWh jV+^_ÐUWVS]#t ;jh8 hT jV Vh h jVzjh h jqV7賤Mjh\W#|P芤jh4 h@ j(V+Vhh h jV[^_Ð#u؋} WSw#B7#wVh h 뫐U WVSEjhT hX jUEP5V#t/V*MShl h j[U5qh h j6Uuh h jU=Ku = Kt3jjuV KfEKfEVhgTu葢 f  f  !E#tjPE=tjPE=tjPE=~ P襢q=~P萢=q+[^_UWVS+E+j]Sh j Tˉ4"tbU#<\u{"u C<"+/#tAF4+Cu܈CA"t1|48tFDŽ4NVh h jjS4P4[^_ÐCA룐<"usU Vj5Vhq #Ph h$ j6jhD hT j%hhJ5lh` hp jR@@#u hxIjh| h j{Ru輠Ju訠jEPuw #t5Vh h j,Rum+^jVh0 j RjjʟEPN#N##ljh h jQ#ucjh h jQjhu u͟uŸu75lh h0 jQQjh< h` j;QjM U=t*#|!jPhH ÐUuu jjju5UE@PÐUVjjuV5 V:2^U@#t%=uÐ+UV@%f=t wk @ fztVj~* @ tVj\* <tVj7* 냐Vj"* Vjl * #tVjP#$) Vh`j+ @  @%=u^þftj)@tVje) jH HIQHQP@ fxtVj$) tVjqh) H `,H @,#t+ fy}yuVPj* H @,@Bt&Vj( @b@ H $  AVj^( #tVjPB( #tVjP!$( #tVjjP!P' @p,Ӟ+^ÐUS Ɓ dc [ÐU WVSE9EuE9E u+[^_á@M yu:H R,#t-x8u'hfRj*) H @,@ y u)@t#hfj' @`@Mf HfMuu}x` } H A9E] #A; AT#tNUB9UuE};t #u:y0t4f;tVjq0h& ATVjPS& E9EudC};}ZC;~S;}jWS jWSc ;u}-;}jWS HjWS7 3|:}|4 H A9E}%] #|A;}juuSu yXtjjuuE yptjjuuE}|'|}|}| [^_Ð}9u0E;E(;E#hfjWupP ;u;ujWuu u$E9EjPWuH fxMfUWVS @}uIX@DE+Ip@FEH pN#u [^_Ð] }}ujSWjV0E[^_ÐhfjQ$ jSWjV[^_UVuVuu Vuu  ^UWVSME ;@;}+zLZb+zNZ`RhU}u$9}}9]} [^_Ð;}[^_Ð9}})9]}$hfjP$P4# T;}$f;}WjVѐWjV;}ZTZt#~fWjS" N#+[^_UWVS}u ;@Xh;}jVW jVW3 E@fxP}jVj @IP}u%;]} ;}[^_Ð;EE[^_Ð;]}';}#hfjVpHP" L;E}'hfjp0! jVj6 !;}jVW# jVW_ +[^_Ð[^_ÐU$WVSPl#uu [^_ H @D4fx|@@8+E#;}@tE ȋǙ++ɉM}~ ǙEljEܡ@@REE};}  IM}uDuE}u}uӁϋ H ;Q,t@}u7}te9+ًMEˋ]u4Àt)}t&M +σu H I9M } M Du@ @IJG;} C @Id}u;[^_;}0hfjE +EP^P I@@t#hfj @`}~$fWj@p M}E};} }uDuEBE}u}u؁ϋ H ;Y,t@}u7}ts9+ًMEˋ]uBt)}t5M +σu H I9M } M Du%0P hfjrl G;} #+[^_Ð[^_ÐUWVS A`#uu [^_Ð#]+} y(tQǙ=#t @ljE;E}-E=#t +ۋE=+]@BTƉE+zHE @R^}u;[^_Ë} ;})hfjE+PPd H#~ fPjq(H N#~ ;~fVjp` K;+[^_[^_ÐU WVS|EMEH E@EEEPuF Pu #f= @ f ;~@;~ f;@ff}f= f f f;~ f;~f;~fff=~ +Efl f=t Phh #hj|@#q,uq0 F P<F PE # @ @fA |jjju&ff%  @AWW @A(ffDSE# @ @fAЉME#uf@f=ufAjjR5| @AH #{$  H @5~uf~}~u ~t ~tH jj5M5| @A#p@5 |~u f~jQ誕#@p8Mы+t +j|PX# |YQ#~ljFJ#~jQ @A #tG|A$ #tСl#tjj5M5|{ @A#uG5@REMEH E|E@fl E+[^_Ð5tt+E% ЈEtB5tt+E@% Ȉ Eu @QU#u @H؉ @Q#uQ5uu t +% ЈQ~|u t +% ЈQAFA[^_ÐUVfxt fk= t'nx`uOx0uIxHuCu:6xu0xu*xPuxtuxXtxTtx`ux0tx<u+^ÐU U+ ATAtAVj CD4V =| t΋I#tf SfJI#uG;}|¡@f@ fC[^_ÐU WVSEX@MEEpDHM+;uɇ#t&=| u誇M#fl +;1#t P݇=| tE#t PC;~ϋEp讇EpD蠇=| tE@#t P脇uy[^_G;2+[^_UuUVSD]Àu=@@,I@p,#}VPf[^ÐF@FX[^Ðˋ=5@v,J5@v,#} VQ NANAf=~Lˀt8Ë @I,J @q,#} VZNANA[^Ð[^UE Pu5F ÐU rtnPhTlP +ÐU0WVSIEE}uh 詆E}tE8uEl}t Eh&e#>Vu܄D=~f{VSS覄Ƅ/U RƄ/VلjS>#} =l tZ#}Ih0S规S>ȍ URV jS#}g=l uf;jhL(#t ff}t EuhbhPS肆 S藅#f-uf5xE}uEEEEE؍E=h##u fj&#u fYjD #u f/h ʂ#f5  55f}uP O[^_ÐDD M}xs |E܃}u9u E#u'f M;1QA#}t EjuPO Ɓ E܉ǁǁE E}uu #uEEflQ fǁƁƁƁƁƁj4jQb  nrvzf~fuWV }5N%EM#tG;s$FEM#u;s+QjV΀ ftG HBUM#t,f7ރ;sP#} ff0‹UM#u;s+ȋQjPk = PhhTu =t1ff#t  fAff#t  fhg蒀hn胀#tS#~ fA#tV#~ f EM#t,;sq#} E܉΋EM#u;s+ыPjQY uWu: fffuf%fLyt+ɡ A+P5Q~ A(+P5 Q~ lA(+R5P~ =njE+xM#t  B |ԋ 4 fxuyufy|f@EBE#t#tQP"}#u   E}rǀ`+hM#t<#~#tQP|#t$u4#t%4P|#u Ћ !Cr A\AhAxǁǁ+[^_ÐU+ɋEfffffhjP| ÐU tPhTlPU} +ÐU nPhTlP*} +ÐUEPju  #|EÐUWV} ϋE#tu=+^_Ð$u#xtEN@EG#t"uË^_ÐUUB =ncjEPp0i #t 8 uxtQjEPp`= #t08u+xu%ҐjEP@ #t8 t+Ð,=bst=nst=pttjj%h$hRH =tÐUjj!hhuH =uAÐUWVjhhDhuH =u+^_Ë4} #t%#t#tVQyVyD^_ÐUV=  hhVPhh ?Thh5(XhEh^\hnh`hhdhh ̂hhh%赂P5@V赂h4LV虂 h5V苂^ÐUu uu' ÐUMǀÐU WVS+}EEE EEEE}|_%tMEhLMNjӋ=^n$<ƅ\%]:uG#t=vJ+#t#u=Xu>Asu\Pulw M9tH;AG뻐$=dt=ot=st=xtEE8uNEo }tQTQl}t#tAH9E} At#tE#t0E;APu(RhvM#t=t= tEMEoQ^vDMEEEML=1EML␐ML֐MLʐML뾐M L벐M$L릐M(L뚐M,L뎐GHσfF$ _uF#txt%#u![^_ÐEEPUE[^_uW9ѐUWVS}#t;=\"t/u] <$u pf@:f rQfP<MM}tM9tHu <p@p:xf vH ff tH fHPH ff vf@ftfpf9} Vf>EfFE; }tE䀸Hu 8uEpfvf t0x҉U;uu;t%WVSuf5vf=tϡp5H f=rF`(pH(ƀpfx:f@#~_0 u W;| ];]u@ EωUF;uzM`T rI}u"u=`Du9Mu?Dt5}t 2029Mu}t J0JM9Mup;E|EHfB`[^_Ð[^_ÐUWVS}pBf>9E}~@@Du %0= /EMUM;}PQuuVE#+ۋU;rE< \+^xt0 @@trQʀt'"uahfj @H˿u"0΁0 MB;U|[^_UWVS=hU %+M4ȸE# H I,M0΁0 MB pMW h#t/u4+4>˿u"0΁0 MB;U|[^_U WVS vp@D<rH;5@@!EЁu ut+E E]K#~ DtK#H @DESQtPQ臰EȁϋH R,;t)hfRQ E ϡH H,E ytȁ0~u`PE@E4Fp;|SvPMQPxt@t)@u#hfjV @H vH PD сu $ut+ M M#t4+;u}afPjQ F;u}ܐH 5#t* @uhfjuRP ŐuϋP,;thfRV4 H p,}~' vH @D4UMC}ك=lt9E #u#t%hfVQ E ϡH H,H Eft vRD u'4 vH @D Fp;|[^_Ë Eytȁ0~u`P~v H IDu 4X vH @D Fp;|ыztztj j ftfv[^_ÐUWVSMAE ;}{HpJ4AJ A H IA;E|Qf:t_;|;^H @p ru fpf95F;|#uQxt ! rhfQp< +fvft5H O yDuy jWtPvPyf=vft+xt AD#ur+Prhf r+QP H f8H fpPjrPW5pS[^_Ð[^_ÐU tJf~;hfjQ f ffH `,ÐUWVSUB@E}J<B:EBEBER E@4HE@ HEH +E;E}DEff=>t }E;~f>9;}fEEE9E|U‹@@d[^_ÐUMffAE$E]C O#~"}tf>t fEfO#ރ}uExt u]}uExtu[^_Ð+[^_ÐU WVSMAD} 4Et;r #t;s;rXu*:Ґut+E <}A9Ev [^_Ð+ƋEY]Ë} x9E}Ef{}+HEq E F9E~ } Ef~;Us A0;Ur+[^_ÐUWVSMAEADE EE%0EE%ωEEFEFEFFFPf=~Vh=V=E}EsEPuuc EEFEFu@K#}+f^N P}tTFD f=~'t"SWV E=FD } F0} s} uLE E Ù+ʍ<F;~;}uu=tMC;|fVfME ^P}Wi=t#E4@ EPWPfVf=ufVfEEFEF^>㐐EV,Et%0 EE9MtSNy;}fyN y;~fyFDM =| t M E% N fYCF;uqF&;uajVȊFu@EN;uKf>f^"t V'}ubuu$![^_ÐEFG+뼊FE볐E== = N }uu[^_ÐE[^_UfNщUFDEFEFEE] fFHFPEFFEE}Ey}u0f=~uE=ofNE>=EE%Uuu#t+#u+E +‰Et G;"t;}~;}E;E+;}9MMPjuQ E=#~MGC;}~fNE>MV}  }E9Ef=~,E܋ EtuWu E=Ny9E}EfyN y9E~EfyE܋ M} uF0EN,EtM%0E̋E EĉEȋMU=| t;E%ωEEċȁ M Ú% N UfQEE7EfFuV=u E=>FEECMfNE}tUEHEE#hEfFN EԈF"t VmEЈF"tV[^_ÐE[^_U@WVSMy@t uE@E @y 5|H PUP]C[ÉEċE@ E̋E@IA pExt@ t1EE#|$;E}][]#|;} f pfYE@(u a(E@(tI(Exu@ AAA A p@][]ĉ]9}|9u} 9u|uu;u~u됐u)uȋuvu;~UB+URUUR UURDU܋P$EčEԋQEčBUQ BUQDEH xt EfA:fA<+E;E:}uEf8>}uEff=t#}+}uEf8t E;~ƉEE܋EEf=Dt4O#| DtI#}#}O; DtA;~;XEtWVM;|tI;}UfE؃EEEEEEEE9E pI Ma +[^_ÐU WVS}G(tG t [^_GEGE+GGGE7fO$;|G&;ffE P]SEfGf7EG"t SEG"tS[^_Ð+[^_ÐUWVSE@t8+E#}+}?+};}~};E#|;~f;}f>EEE9E|EH E@<EEE@:EEE@@E}6[^_ÐUWVSuO#~" A@9u Q$O#䋞#tS$#t P$u赧[^_ÐU4WVS| #tE|  Euff;N$| fF&f;@FE؋E E}}.+M؉MM9M~MM؋+}E+ljEE.M+ȉMM9M}MM]K+}H+ȉMEf~8~@u +E܋NMN MFE}ND}ND H ;u2@@8#t& @@8 @P|#u0 H ;uRMfyfYMfyfY@H @ @P| 뺐MQPR"# 륐MfYEHMfYM]}}+}} E+ÉE H+ȉM}~bFEFEFFFEEfF}~fWM]}EfFEfËFEFN }tEУ| jURuM+QVЃ~t V;5H t}tV[^_Ð+[^_ÐS[^у:tQ[S[ö^у:tQ[ Internet Kermit Service ready at %s%s C-Kermit ready at %s%s %s Access denied. %s %sC-Kermit- ., {{./.readme}{README.TXT}{READ.ME}}/dev/tty0...$@?%02ld:%02ld:%02ldLINESCOLUMNSFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! USERLOGNAMEJOBACCTPRINTERDISPLAYUNIXLOCATIONPipe errorFork errorwfdopen failure/dev/null%s is not a terminal device /dev/ttyLocked by process %d %d%s %sCan't unset O_NDELAYioctl(TCSETA)Warning, problem releasing lock Warning - Can't set O_NDELAYttclos() timeout: %s ?WARNING - close failed: %s errno = %d Removing stale lock %s (pid %d terminated) %dLK.%03d.%03d.%03d%s/%s%s/%s%s/LTMP.%05dUUCP not installed or Kermit misconfigured %10d Warning - Lockfile %s seized by pid %d Warning - Can't remove lockfile: %s Warning - Can't remove secondary lockfile: %s bccccbccccccccccccccccccccccccdfffffffffffffg gg0k0kkkLk\klkkkl%d^%c... Canceled... Can't send BREAK%f.A{Gzt?/dev/ttysuspend?Sorry, device is not open %s%s %s /usr/adm/wtmp%s: %s %sxferlog open failure %s: %mxferlog: %s open okTerminal input not allowedrfile[%d] %s: open failed (%m)file[%d] %s: open read okwafile[%d] %s: %s failed (%m)file[%d] %s: %s ok%.24s %d %s %ld %s %c %s %c %c %s %s %d %s %c/dev/null(lookup failed)/dev/null/dev/nullzchko: Malloc error 46 .file[] %s: delete failed (%m)file[] %s: delete ok/dev/null.%sNONAME.././HOMEw/dev/nullSHELLr*.~*~.~%d~.~*~.~%d~/file[] %s: rename to %s failed (%m)file[] %s: renamed to %s okfile[] %s: copy to %s failed (%m)file[] %s: copy to %s ok%o%o%04d%02d%02d %02d:%02d:%02d%oU1%o%04omail %s < %scat %s | %scat %s >> %s%s %s < %s%s %s**fgen can't malloc string space ./LOGNAME?Privilege cancellation failure sh/bin/sh/bin/shSHELL?Local resource failure: malloc login: user %sftpanonymouslogin: anonymous login not allowed: %slogin: anonymous login forbidden by ftpusers file: %sanonymouslogin: anonymous getpwnam(ftp) failed: %slogin: invalid shell %s for %s %slogin: %s login forbidden by ftpusers file: %slogin: getpwnam(%s) failed: %srlogin: anonymous guests must specify a passwordiks_%04x/Anonymous login. login: anonymous %s %sUser %s logged in. login: %s %sUSER=%sLOGNAME=%sHOME=%s%cBAD BAD MMMMMMNONAME!%s?Sorry, receive filter + filename too long, %d max. /dev/nullXYXXwYWOZFILE%02ld?Sorry, send filter + filename too long, %d max. Recovery attempted in TEXT mode: %sD7CALIBRATION?Internal error expanding ADD list .Client Command Status Description REMOTE LOGIN required GET %-14s%s SEND %-14s%s MAIL %-14s%s REMOTE ASSIGN %-14s%s REMOTE CD %-14s%s REMOTE COPY %-14s%s REMOTE DELETE %-14s%s REMOTE DIRECTORY %-14s%s REMOTE EXIT %-14s%s REMOTE HOST %-14s%s REMOTE PRINT %-14s%s REMOTE QUERY %-14s%s REMOTE MKDIR %-14s%s REMOTE RMDIR %-14s%s REMOTE RENAME %-14s%s REMOTE SET %-14s%s REMOTE SPACE %-14s%s REMOTE TYPE %-14s%s REMOTE WHO %-14s%s FINISH %-14s%s BYE %-14s%s $Њ܋0LЍ،(@REMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) type%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s %10ld %s %s%s%s %sSummary: %ld director%s, %ld file%s, %ld byte%s%s./*Listing files: %s%s%s*/*DIRECTORY %sDIRECTORY %10s: %s%s %10s: %s%s directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETEthhhhhhh0LeH$Lt@hhhhhhhhhhhhQ[؜hhhŝhhhh=[؜hhhŝhhhh=L3N3Connection lost@@?@ Ox%dMx%dreceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermit%c-xx-%02d-%c-%02d-%02d-{Gzt?A%s: no name givenDirectory %s not implemented in this version of C-Kermit%s %s: %s%s: removed%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] [(empty string)] [(null pointer)] free: %d, winlo: %d %4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] free: %d, winlo: %d %ld%ld%dI196I6/204%ldN+%ldN?X   < < < < b <  DT Access deniedCommand or pipe failureRefused: %s+-,<-,,-,,-,-.t000W0 040 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 00<00W076667 7667$76/7<=(=\=(=(==(=(==(==XH`HȢQ%s -s %c%s%c %s%s %s IKSD IDLE TIMEOUT: %d sec SERVER IDLE TIMEOUT: %d sec A Kermit server is not available ?No connection ?Sorry, no external protocol defined for %s %s%s%s %s%s%s ?Memory allocation failure ?Name too long - %s %s %s%s%s %scmnum: illegal radix - %d ?Name too long ?Wildcards not allowed - %s /dev/tty?Write permission denied - %s ?Default name too long IKSD IDLE TIMEOUT: %d sec ?Timed out Command or field too long Expanded name too long ?cmifi: malloc error ...?Wildcard matches more than one directory ./?No %s match - %s ?Too many %s match - %s ?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s %s Default name too long %cExpanded name too long .. .%c?No %s match - %s %c?Too many %s match - %s %s?Partial name too long %c%c%s?Directory name too long %s ?Completed name too long ?Not a directory - %s %s?Expanded name too long : %s %s%s?No %s match - %s ?Too many %s match - %s , one of the following: %s%sL                   ?Default too long Command or field too long ?Default too long Value too long ?Default too long %s ?Default too long %c Please complete this field %s %s%s U U U U       0  ?Timed out IKSD IDLE TIMEOUT: %d sec ?Timed out Command or field too long %s %c%c%s Text string %s %s%s?Unexpected return code from gtword() - %d   $ $ $ $  $   `    ?Keyword table missing ?Default too long IKSD IDLE TIMEOUT: %d sec Command or field too long ?Default too long Evaluated keyword too long %c?Not a switch - %s %c?Ambiguous - %s %c?No keywords match - %s %s ?Default too long %cEvaluated keyword too long %s%c%c%c?No keywords match - "%s" %c?No keywords match - %s %s:%s ?Evaluated keyword too long %c No keywords match One of the following: %s, one of the following: or the name of a macro ("do ?" for a list) or the token %c or one of the tokens: %s %s%s %d - Unexpected return code from gtword ' ,# l. l. l. # 9# 9# 9# 9# ,' ,' ( (- ,'  00:00:00 00:00:00%04d%02d%s 00:00:00%04d%s 00:00:00 00:00:00 00:00:00 00:00:00 00:00:00%02d%02d%s%s%02d%s%s%02d %02d:%02d:%02d?Evaluated date too long Invalid date or time - "%s" Oops, command recall error Command or field too long ?Not confirmed - %s %c?Not confirmed - %s Press the Return or Enter key to confirm the command %s%sC gD gD gD gD C gD C C AD C C ED ?cmfdb - unexpected function code: %d ?%s: "%s" E @F |F F  G XG G ?Saved word too long %c?Field too long error 1 %c?Field too long error 1 ?Field too long error 2 %c?Too long #3 ?Too long #4 %c%c%c %s%c%c%c %s%s%c%c %s%s%c%c?Command too long, maximum length: %d. %c %c%c%c%c%c)b )b )b )b )b )b )b )b )b )b b b b b b b b b b b (b b b b b b b b b b b 7b b b b b b b b b  b b b b b b b b b b b b (b  %s %s %s %s allALL?A single character, please, or carriage to list them all. %s The following command-line options are available: -%c %s %s Argument: %s -%c %s%s Argument: (none) j j j |j j j j j j j j i i i i j j 3j Dj Tj $j kj Your escape character is Ctrl-%c (ASCII %d, %s) %s, Copyright (C) 1985, 2000, Trustees of Columbia University in the City of New York. %s, Copyright (C) 1985, 2000,Sorry, help not available for "%s" ?No such function - "%s" Sorry, help not available for "%s" k k k y l 0l Xl l l  m \m m m n y o %y to o %y %y (p 

for help on a particular function. For function settings use HELP SET FUNCTION and SHOW SCRIPTS. \f%sindex(s1,s2,n1) s1 = string to look for. s2 = string to look in. n1 = optional 1-based starting position, default = 1. Returns integer: 1-based position of %smost occurrence of s1 in s2, ignoring the %smost (n1-1) characters in s2; returns 0 if s1 not found in s2. \f%ssearch(s1,s2,n1) s1 = pattern to look for. s2 = string to look in. n1 = optional 1-based offset, default = 1. Returns integer: 1-based position of %smost match for s1 in s2, ignoring the %smost (n1-1) characters in s2; returns 0 if no match. See HELP WILDCARDS for info about patterns. \flength(s1) s1 = string. Returns integer: Length of string s1. \fliteral(s1) s1 = string. Returns string: s1 literally without evaluation. \flower(s1) s1 = string. Returns string: s1 with uppercase letters converted to lowercase. \fmaximum(n1,n2) n1 = integer. n2 = integer. Returns integer: The greater of n1 and n2. \fminimum(n1,n2) n1 = integer. n2 = integer. Returns integer: The lesser of n1 and n2. \fmodulus(n1,n2) n1 = integer. n2 = integer. Returns integer: The remainder after dividing n1 by n2. \fevaluate(e) e = arithmetic expression. Returns integer: The result of evaluating the expression. \fsubstring(s1,n1,n2) s1 = string. n1 = integer, 1-based starting position, default = 1. n2 = integer, length, default = length(s1) - n1 + 1. Returns string: Substring of s1 starting at n1, length n2. \fupper(s1) s1 = string. Returns string: s1 with lowercase letters converted to uppercase. \freverse(s1) s1 = string. Returns string: s1 with its characters in reverse order. \frepeat(s1,n1) s1 = string. n1 = integer. Returns string: s1 repeated n1 times. \fexecute(m1,a1,a2,a3,...) m1 = macro name. a1 = argument 1. a2 = argument 2, etc Returns string: The return value of the macro (HELP RETURN for further info). \f%cpad(s1,n1,c1) s1 = string. n1 = integer. c1 = character, default = space. Returns string: s1 %s-padded with character c1 to length n1. \fdefinition(m1) m1 = macro name. Returns string: Literal definition of macro m1. \fcontents(v1) v1 = variable name such as \%%a. Returns string: Literal definition of variable v1, evaluated one level only. \fnextfile() Returns string: Name of next file from list created by most recent \f[r]files() or \f[r]dir()invocation, or an empty string if there are no more files in the list. \ffiles(f1[,&a]) - File list. f1 = file specification, possibly containing wildcards. &a = optional name of array to assign file list to. Returns integer: The number of regular files that match f1. Use with \fnextfile(). \fcharacter(n1) n1 = integer. Returns character: The character whose numeric code is n1. \fright(s1,n1) s1 = string. n1 = integer, default = length(s1). Returns string: The rightmost n1 characters of string s1. \fleft(s1,n1) s1 = string. n1 = integer, default = length(s1). Returns string: The leftmost n1 characters of string s1. \fcode(c1) c1 = character. Returns integer: The numeric code of character c1. \freplace(s1,s2,s3) s1 = original string. s2 = match string. s3 = replacement string. Returns string: s1 with all occurrences of s2 replaced by s3. \fdate(f1) f1 = filename. Returns string: Modification date of file f1, format: yyyymmdd hh:mm:ss. \fsize(f1) f1 = filename. Returns integer: Size of file f1. \fverify(s1,s2,n1) s1 = string to look in. s2 = string of characters to look for. n1 = starting position in s1.Returns integer: 1-based position of first character in s1 that is not also in s2, or 0 if all characters in s2 are also in s1. \fipaddress(s1,n1) s1 = string. n1 = 1-based integer starting position, default = 1. Returns string: First IP address in s1, scanning from left starting at position n1. \fhexify(s1) s1 = string. Returns string: The hexadecimal representation of s1. Also see \fn2hex(). \funhexify(h1) h1 = Hexadecimal string. Returns string: The result of unhexifying s1, or nothing if s1 is not a hex string. \f%s(s1,s2,n1) s1 = string to look in. s2 = string of characters to look for. n1 = 1-based integer starting position, default = 1. Returns string: s1 up to the first occurrence of any character%salso in s2, scanning from the left starting at position n1. \f%s(s1,s2) s1 = string to look in. s2 = string of characters to look for, default = blanks and tabs. Returns string: s1 with all characters that are also in s2 trimmed from the %s. .\fcapitalize(s1) s1 = string. Returns string: s1 with its first letter converted to uppercase and the remaining letters to lowercase. Synonym: \fcaps(s1) \ftod2secs(s1) s1 = time-of-day string, hh:mm:ss, 24-hour format. Returns number: Seconds since midnight. \fpathname(f1) f1 = filename, possibly wild. Returns string: Full pathname of f1. \fchecksum(s1) s1 = string. Returns integer: 16-bit checksum of string s1. \fcrc16(s1) s1 = string. Returns integer: 16-bit cyclic redundancy check of string s1. \fbasename(f1) f1 = filename, possibly wild. Returns string: Filename f1 stripped of all device and directory information. \fcommand(s1) s1 = string Returns string: Output of system command s1, if any, with final line terminator stripped. \frawcommand(s1) s1 = string Returns string: Output of system command s1, if any. \fstripx(s1,c1) s1 = string to look in. c1 = character to look for, default = ".". Returns string: s1 up to the rightmost occurrence of character c1. \flop(s1,c1) s1 = string to look in. c1 = character to look for, default = ".". Returns string: The part of s1 after the leftmost occurrence of character c1. \fstripn(s1,n1) s1 = string to look in. n1 = integer, default = 0. Returns string: s1 with n1 characters removed from the right. \fstripb(s1[,c1[,c2]]) s1 = original string. c1 = optional first character c2 = optional final character. Returns string: s1 with the indicated enclosing characters removed. If c1 and c2 not specified, any matching brackets, braces, parentheses, or quotes are assumed. If c1 is given but not c2, the appropriate c2 is assumed. if both c1 and c2 are given, they are used as-is. \fn2hex(n1) - Number to hex n1 = integer. Returns string: The hexadecimal representation of n1. \fn2octal(n1) - Number to octal n1 = integer. Returns string: The octal representation of n1. \fdirectories(f1) - Directory list. f1 = directory specification, possibly containing wildcards. &a = optional name of array to assign directory list to. Returns integer: The number of directories that match f1; use with \fnextfile(). \frfiles(f1[,&a]) - Recursive file list. f1 = file specification, possibly containing wildcards. &a = optional name of array to assign file list to. Returns integer: The number of files whose names match f1 in the current or given directory tree; use with \fnextfile(). \frdirectories(f1) - Recursive directory list. f1 = directory specification, possibly containing wildcards. &a = optional name of array to assign directory list to. Returns integer: The number of directories that match f1 in the current or given directory tree. Use with \fnextfile(). \fdirname(f) - Directory part of a filename. f = a file specification. Returns directory name: The full name of the directory that the file is in, or if the file is a directory, its full name. \frandom(n) - Random number. n = a positive integer. Returns integer: A random number between 0 and n-1. \fword(s1,n1,s2,s3) - Extract word from string. s1 = String n1 = word number (1-based) s2 = optional break set. s3 = optional include set. Default break set is all characters except ASCII letters and digits. ASCII (C0) control characters are always treated as break characters. Returns string: Word number n, if there is one, otherwise an empty string. \fsplit(s1,&a,s2,s3) - Assign string words to an array. s1 = String &a = array designator s2 = optional break set. s3 = optional include set. Break and include sets are as in \fword(). All arguments are optional. If \&a[] not declared, it is created. Returns integer: Number of words assigned. \fcvtdate([date-time]) - Date/time conversion. Converts date and/or time to standard format. If no date/time given, returns current date/time. [date-time], if given, is free-format date and/or time. HELP DATE for info about date-time formats. Returns string: Standard-format date and time: yyyymmdd_hh:mm:ss \fdoy([date-time]) - Day of Year. Converts date and/or time to day-of-year (DOY) format. If no date/time given, returns current date. [date-time], if given, is free-format date and/or time. HELP DATE for info about date-time formats. Returns numeric string: DOY: yyyyddd, where ddd is 1-based day number in year. \fdialconvert(phone-number) - Convert phone number. Converts the given phone number for dialing according to the prevailing dialing rules -- country code, area code, etc. Returns string: The dial string that would be used if the same phone number had been given to the DIAL command. \fdoy2date([doy[-time]]) - Day of Year to Date. Converts yyyymmm to yyyymmdd If time included, it is converted to 24-hour format.Returns standard date or date-time string yyyymmdd hh:mm:ss \fmjd([[date][-time]]) - Modified Julian Date (MJD). Converts date and/or time to MJD, the number of days since 17 Nov 1858. HELP DATE for info about date-time formats. Returns: integer. \fmjd2date(mjd) - Modified Julian Date (MJD) to Date. Converts MJD to standard-format date. Returns: yyyymmdd. \fday([[date][-time]]) - Day of Week. Returns day of week of given date as Mon, Tue, etc. HELP DATE for info about date-time formats. \fnday([[date][-time]]) - Numeric Day of Week. Returns numeric day of week of given date, 0=Sun, 1=Mon, ..., 6=Sat. HELP DATE for info about date-time formats. \ftime([[date][-time]]) - Time. Returns time portion of given date and/or time in hh:mm:ss format. If no argument given, returns current time. HELP DATE for info about date-time formats. \fntime([[date][-time]]) - Numeric Time. Returns time portion of given date and/or time as seconds since midnight. If no argument given, returns current time. HELP DATE for info about date-time formats. \fn2time(seconds) - Numeric Time to Time. Returns the given number of seconds in hh:mm:ss format. \fpermissions(file) - Permissions of File. Returns permissions of given file as they would be shown by "ls -l". \farraylook(pattern,&a) - Lookup pattern in array. pattern = String or pattern &a = array designator, can include range specifier. Returns number: The index of the first matching array element or -1 if none. More info: HELP WILDCARD for pattern syntax. HELP ARRAY for arrays. \ftablelook(keyword,&a,[c]) - Lookup keyword in keyword table. pattern = String keyword = keyword to look up (can be abbreviated). &a = array designator, can include range specifier. This array must be in alphabetical order. c = Optional field delimiter, colon(:) by default. Returns number: 1 or greater, index of array element that uniquely matches given keyword; or -2 if keyword was ambiguous, or -1 if keyword empty or not found. Also see: HELP FUNC ARRAYLOOK for a similar function. HELP ARRAY for arrays. \fabsolute(n1) n1 = integer. Returns integer: The absolute (unsigned) value of n1. \ffpabsolute(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The absolute (unsigned) value of f1 to d decimal places. \ffpadd(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: The sum of f1 and f2 to d decimal places. \ffpsubtract(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: f1 minus f2 to d decimal places. \ffpmultiply(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: The product of f1 and f2 to d decimal places. \ffpdivide(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: f1 divided by f2 to d decimal places. \ffpmaximum(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: The maximum of f1 and f2 to d decimal places. \ffpminimum(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: The minimum of f1 and f2 to d decimal places. \ffpmodulus(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: The modulus of f1 and f2 to d decimal places. \ffpraise(f1,f2,d) f1,f2 = floating-point numbers or integers. d = integer. Returns floating-point number: f1 raised to the power f2, to d decimal places. \ffpcosine(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The cosine of angle f1 (in radians) to d decimal places. \ffpsine(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The sine of angle f1 (in radians) to d decimal places. \ffptangent(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The tangent of angle f1 (in radians) to d decimal places. \ffpexp(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: e (the base of natural logarithms) raised to the f1 power, to d decimal places. \ffpint(f1,d) f1 = floating-point number or integer. d = integer. Returns integer: The integer part of f1. \ffplog10(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The logarithm, base 10, of f1 to d decimal places. \ffplogn(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The natural logarithm of f1 to d decimal places. \ffpround(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: f1 rounded to d decimal places. \ffpsqrt(f1,d) f1 = floating-point number or integer. d = integer. Returns floating-point number: The square root of f1 to d decimal places. \f_eof(n1) n1 = channel number. Returns number: 1 if channel n1 at end of file, 0 otherwise. \f_pos(n1) n1 = channel number. Returns number: Read/write pointer of channel n1 as byte number. \f_line(n1) n1 = channel number. Returns number: Read/write pointer of channel n1 as line number. \f_handle(n1) n1 = channel number. Returns number: File %s of open file on channel n1. \f_status(n1) n1 = channel number. Returns number: Sum of open modes of channel n1: 1 = read; 2 = write; 4 = append, or: 0 if not open. \f_getchar(n1) n1 = channel number. Reads a character from channel n1 and returns it. \f_getline(n1) n1 = channel number. Reads a line from channel n1 and returns it. \f_getblock(n1,n2) n1 = channel number, n2 = size Reads a block of n2 characters from channel n1 and returns it. \f_putchar(n1,c) n1 = channel number, c = character Writes a character to channel n1. Returns number: 1 if successful, otherwise a negative error code. \f_putline(n1,s1) n1 = channel number, s1 = string Writes the string s1 to channel n1 and adds a line terminator. Returns number: How many characters written if successful; Otherwise a negative error code. \f_putblock(n1,s1) n1 = channel number, s1 = string Writes the string s1 to channel n1. Returns number: How many characters written if successful; Otherwise a negative error code. \f_errmsg([n1]) n1 = numeric error code, \v(f_error) by default. Returns the associated error message string. \faaconvert(name,&a[,&b]) name = name of associative array, &a and &b = names of regular arrays. Converts the given associative array into two regular arrays, &a and &b, containing the indices and values, respectively: Returns number: How many elements were converted. \fpattern(s) s = string Returns string: s with any variables, etc, evaluated in the normal manner. For use with INPUT, MINPUT, and REINPUT to declare that a search target is a regular expression rather than a literal string. \fhex2n(s) s = hexadecimal number Returns decimal equivalent. \fhex2ip(s) s = 8-digit hexadecimal number Returns the equivalent decimal dotted IP address. \fip2hex(s) s = decimal dotted IP address Returns the equivalent 8-digit hexadecimal number. \foct2n(s) s = octal number Returns decimal equivalent. \fradix(s,n1,n2) s = number in radix n1 Returns the number's representation in radix n2. Sorry, help not available for "%s"   ؃   8 X x   ؄  ͒   `      @ `      ͒ ͒ ͒ ͒ ͒ ͒ ͒ ͒ ͒ ͒ ͒ ͒   @ @   ۇ  ͒ ( H h   Ȉ   ( ͒ ͒ ͒    ĉ  $ D d  ͒ ͒ ͒ ͒ ͒ ͒  <  ̋  D t  Ќ  H h ͒ , , ͒  č ͒ ͒ 4 t   Ԏ ԏ 4  T t T 4    T  t      < \ |    Ԑ   < H l      not working yet - %s  0 D     Г  ʔ ʔ ʔ    4 ʔ G X ʔ h x W l  ?Wildcards not allowed ?Not a directory - %s ?Internal error - malloc ?Too many directories - %d max "%s" - too long, %d max "%s" - too long, %d max "%s" - too long, %d max Please respond Yes or No%s push%s available CHECK: push not available pipes%s available CHECK: pipes not available %s%s available CHECK: %s not available E= No record. No connection. Status: %s Opened: %s User: %s PID: %s Type: %s To: %s From: %s Device: %s Origin: %s %s Elapsed time: %s Elapsed time: %s Encrypted: %s Log: %s  E E  E E E E E t  E E E E d  %s %s T=SERIAL H=%s D=%s LOGLINE BUFFER OVERFLOW %s %s T=%s N=%s H=%s LOGNET BUFFER OVERFLOWWARNING: modem info for "%s" not filled in yet This space available (use SET MODEM NAME)?No keywords match: "%s" ?value required Unexpected SET MODEM parameter          \      h  H   ̮                          ǯ ?Dial-command must contain "%cs" for phone number. Modem's command to %sable %s?Unexpected SET DIAL STRING parameter ?Sorry, area code must be numeric (please omit the parentheses) (no slashes, please) ?Sorry, country code must be numeric (please omit the plus sign) 11011800888877866100033?Unexpected SET DIAL parameter p p  ! Թ 8 P h }  p   IJ   t  l     x    T W 8 D ,  + H l T T T   T  T  ܺ ȴ ݴ    +   ,  + D T   T $ 9 \ ` T T   l    Sorry, command disabled %s Modem carrier-watch: off on auto unknown Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s Modem compression: %s Modem speed-matching: %s (interface speed %s) Modem flow-control: none xon/xoff rts/cts auto Modem hangup-method: %s Modem speaker: %s Modem volume: %s Modem kermit-spoof: %s Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Speaker on: %c Speaker off: %c Volume low: %c Volume medium: %c Volume high: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: %c Ignore-dialtone: %c Predial-init: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. %ld - illegal value, must be 0 or positive Internal time conversion error, sorry. %05ld Press key to be defined: ?Error reading key ?key code must be between 0 and %d Sorry, %d is the CONNECT-mode escape character ?Key definition too long {%s}?Sorry - maximum length is %d ?Sorry, REDIRECT capability required for external protocols. ?Directory names not allowed Sorry, printing disabled ?Memory allocation failure ?Access denied - %s ...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. tcp/ip?No keywords match: "%s" ?Sorry, access to external commands is disabled ?Sorry, access to external commands is disabled ?Network type not supported ?Warning: receive buffers larger than 52248 bytes may not be understood by all hosts. Performance may suffer. ?internal error, sorry ?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small %d?This switch does not take arguments ?Unexpected value - %d ?Sorry, command disabled. Sorry, too long ?Not yet implemented ?Sorry, command disabled. %% fields are not used in this command. ?A positive number, please ?The choices are 7 and 8 ?Sorry, command disabled. ?No keywords or switches match: "%s" ?Character must be in ASCII control range {%s} ?Specify a positive number, or 0 for no server NAKs Transmission rate for %s in bits per second?value required ?Sorry, command disabled. ?Sorry, you must SET LINE first ?Speed cannot be set for network connections ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, 134.5 bps %s, %ld bps Cancel character must be in ASCII control range Number must be 2 or greater ?Sorry, only Kermit protocol is available Sorry, access to pipes is disabled Shell expansion is disabled ?SET WINDOW does not apply to %s protocol Adjusting receive packet-length to %d for %d window slots ?Internal error - malloc failure XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE or RTS/CTS to transmit these characters unprefixed. TELNET IAC = 255, CR = 13, not affected. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. Sorry, not on a TELNET connection. (not implemented yet, nothing happens) ?Illegal value for prefix character ?Number, expression, or time of day required ?Alarm time is in the past. Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. Sorry, too long ?Sorry, command disabled. PATHEDITOR?A single file please PATH?Sorry, command disabled. ?A single file please ?Sorry, command disabled. ?A single character, please. ?A non-alphanumeric character, please. ?Sorry, command disabled. Not implemented - %s ( | L   d   @   x x      _ _ _ _ _ , _ @  _ _    _ _ _ _ _ _ _ _ _  _ _ _ _ - _ _ _ _ _ _ _ _ _ _   , , , K , P , X , , ,  l , , , , , , , , , , ,                 #   , < 4 C T    L   d   L o t $        P             A  P    x d        (     G 8  { U       ,            \!      # x# D$ S%  % \! %   (&  ' w' l' ( ) ) G)    T) `) ) # ) * A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d SET SEND DOUBLE characters: %d (none) SET RECEIVE IGNORE characters: %d (none) %0.250f%0.250f%0.6f{%s} .kermrc=++--?Sorry, IKSD cannot CONNECT. Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. ?Can't start command: %s ?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... ?Input error ?Can't transmit character ?Connection lost ?Output error Connection closed. Session Limit exceeded - closing connection. ?Communications error %04XCan't TRANSMIT buffer Connection closed. Session Limit exceeded - closing connection. ?Timeout QB QB B B (D (D lC lC 1C 1C XD XD ?Can't open input file %s ?Can't open output file %s %s (%s) => %s (%s) ^C... ?File output error: %s ?Anonymous log creation not allowed CX.LOGCX.LOGCX.LOG ?Unknown log designator - %d ?Sorry, %s is a directory name ?%s - %s ?%s - %s ?%s - %s ?%s - %s %02d?%s - %s Transfer Bell: %s Transfer Interruption: %s Transfer Cancellation: %s Transfer Character-set: Transparent %s Transfer CRC-calculation: %s Transfer Display: %s %s %s %s %s Transfer Locking-shift: forced%s,%s%s Transfer Mode: %s Transfer Pipes: %s Transfer Protocol: %s Transfer Slow-start: %s Connection type: %s Current flow-control: %s Defaults by connection type: %-14s: %s %-14s: (%d) Communications Parameters: Host: %s%s %s: %s%s, speed: unknown75/1200134.5%ld Mode: , mode: localremote, modem: %s, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Meridian Technologies' SuperLAT, pipe, psuedoterminal, Named Pipes, telnet protocol (SECURE), rlogin protocol, rlogin protocol (SECURE) Parity: %s%s, stop-bits: (default), stop-bits: %d (8%c%d) (7%c%d) (8N%d) D, duplex: %s, flow: %s, handshake: %d none Carrier-watch: %s, timeout: %d sec, timeout: none, close-on-disconnect: %s Lockfile: %s Secondary lockfile: %s Terminal bytesize: %d, escape character: %d (^%c) %20s %12s %12s %12s %12s %20s %12s %12s %12s %12s %20s %12s %12s %12s %12s %20s %12s %12s %12s %12s b b f b f f f f f f f f f f f f f f f f f f f b b f f f f f f b f f f b f b b b f f f f f f b b f b SET TELNET parameters: echo: %s NVT newline-mode: %s %s %s %s kermit: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %s u, n/a me, %s; me, n/a; BINARY newline-mode: %s %s %s %s binary-mode: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %s; me, %s binary-transfer-mode: %s bug binary-me-means-u-too: %s bug binary-u-means-me-too: %s bug sb-implies-will-do: %s terminal-type: %s TERMnone (%s will be used) none environment: %s account: %s display: %s job : %s printer: %s user : %s system : %s location: %s Network directory: %s Network directories: %2d. %s Supported networks: TCP/IP TCP/IP [%16s] [%16s] Active network connection: Host: %s [%s] Host: none, via: tcp/ip SunLink X.25 Stratus VOS X.25 IBM AIX X.25 HP-UX X.25 DECnet LAT DECnet CTERM DECnet Named Pipes NetBIOS SuperLAT pipe psuedoterminal Reverse DNS lookup: %s DNS Service Records lookup: %s Keepalive: %s Linger: %s%d x 10 milliseconds no timeout DontRoute: %s Send buffer: (default size) Send buffer: %d bytes Receive buffer: (default size) Receive buffer: %d bytes LOGIN (rlogin) protocol TELNET protocol Echoing is currently %s Raw TCP socket (none) \\%c\{%d} Dial status: %d Dial directory: %s Dial directories: %2d. %s Dial method: auto defaultpulse tone Dial sort: %s Dial hangup: %s Dial display: %s Dial retries: %-6d Dial interval: %d Dial retries: (auto) Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s Dial confirmation: %s Dial convert-directory: %s Dial ignore-dialtone: %s Dial pacing: %d Dial prefix: %s Dial suffix: %s Dial country-code: %-12sDial connect: %s %s Dial area-code: %-12sDial restrict: international long-distance local none ? Dial lc-area-codes: (none)%s Dial lc-prefix: %s Dial lc-suffix: %s Dial ld-prefix: %s Dial ld-suffix: %s Dial force-long-distance %s Dial intl-prefix: %s Dial intl-suffix: %s Dial toll-free-area-code: (none)%s Dial pulse-countries: (none)%s Dial tone-countries: (none)%s Dial toll-free-prefix: %s Dial pbx-exchange: (none)%s Dial pbx-inside-prefix: %s Dial pbx-outside-prefix: %s Dial macro: %s Transfer mode: %s File patterns: %s (but disabled by TRANSFER-MODE MANUAL) (SHOW PATTERNS for list) Default file type: %s File type: %s File names: %s Send pathnames: %s Receive pathnames: %s Match dot files: %s Wildcard-expansion: %s File collision: %s File destination: %s File incomplete: %s File bytesize: %d File character-set: %s File UCS bom: %s File UCS byte-order: %s-endian Computer byteorder: %s-endian File end-of-line: %s %s %s %d File download-directory: %s Send move-to: %s Send rename-to: %s Receive move-to: %s Receive rename-to: %s Initialization file: %s Kermit doc files: %s Disk output buffer: %d (writes are %s, %s) Longest filename: %d Longest pathname: %d Last file sent: %s Last file received: %s Also see: SHOW PROTOCOL, SHOW XFER, SHOW PATTERNS, SHOW STREAMING, SHOW CHARACTER-SETS Protocol: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Cancellation: %s %d %d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Pause: %11d%9d Attributes: %s Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' 8th-Bit Prefix: ('%c' but not used) Packet Length:%11d %8d Repeat Prefix: '%c' Repeat Prefix: ('%c' but not used) Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced%s,%s%s Auto-upload command (binary): %s Auto-upload command (text): %s Auto-server command: %s Packet timeouts: dynamic %d:%d Packet timeouts: fixed%-31sSend backup: %s Transfer mode: %s Transfer slow-start: %s, crc: %s Transfer pipes: %s Transfer character-set: transparent %s Send filter: %s Receive filter: %s Also see: SHOW FILE, SHOW XFER, SHOW PATTERNS, SHOW STREAMING, SHOW CHARACTER-SETS Executed by external commands: SEND command (binary): %s SEND command (text): %s RECEIVE command (binary): %s RECEIVE command (text): %s Autoreceive command (binary): %s Autoreceive command (text): %s Language-specific translation rules: %s File Character-Set: %s (%s), 7-bit8-bitmultibyte Transfer Character-Set: Transparent: %s (%s) SEND character-set-selection: %s RECEIVE character-set-selection: %s (Use SHOW ASSOCIATIONS to list automatic character-set selections.) For incoming files: Transfer Character-Set File Character-Set %-25s%s For outbound files: File Character-Set Transfer Character-Set %-25s%s Show what? (Type "show ?" for a list of possiblities.) No file transfers yet. status : SUCCESS FAILURE (interrupted) FAILURE (i/o error) FAILURE crc-16 of file(s) : %ld crc-16 of file(s) : (disabled) reason : %s remote system type : %s files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) control characters : %ld prefixed, %ld unprefixed 8th bit prefixing : yes [%c] no locking shifts : %s window slots used : (streaming) window slots used : %d of %d reliable: : %s%s clearchannel: : %s%s packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %s (%0.3f sec) transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps (%d%%) effective data rate : %ld cps peak data rate : %ld cps Use STATISTICS /VERBOSE for greater detail. ??Connection %s %s is not open. ?INPUT initialization error doinput string %2dConnection closed. Session Limit exceeded - closing connection. Internet Kermit Service in SERVER mode. Please use REMOTE commands. Fatal error - disconnected. @@?malloc error 6 %04d%03d %s%04d%03d%04d%02d%02d %s%04d%02d%02d%04d%02d%02d ?\fexec() too deeply nested %d%d%s*%d%d%d%d%ld%d%lu%u0%lx%d0\&%c[%d]%d%d%ld%ld%d%02d:%02d:%02d-1%d%d-2-1%d%s<*>%dbp[%d]=%sfarg[%d]=%f%%0.%df%%0.%df%d%ld%ld%d%d%d%d.%d.%d.%d%02x%02x%02x%02x?%s ڹ ڹ ڹ ڹ 3 3 3 3 ڹ 3 3 3 ڹ 3 3 3 ڹ 3 ڹ 3 ڹ ڹ 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 ڹ 3 ڹ 3 3 ڹ ڹ ڹ 3 3 3 3 3 3 ڹ ڹ 3 3 3 ڹ 3 3 3 3 3 3 3 ڹ ڹ 3 3 ڹ ڹ 3 ڹ 3 3 3 3 ڹ ڹ 3 3 3 3 ڹ ڹ 3 3 ڹ ڹ ڹ ڹ ڹ ڹ ڹ ڹ ڹ ڹ ڹ ڹ 3 3 ڹ ڹ ڹ ڹ ڹ 3 3 3 3 3 3 3 3 3 3 3 3 3 ڹ   T  ` ` ` T T T T T T T T T T T T T  T  Y T T     |              { @  | @ @ @ @ @ @ @ @ @ @ @ @    4          @ @ Z  D [ [ [ P P [ [ [  ,   | L        8 ( ( ( (      ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (  x x x x    x   x x x     |     #  d     , H d l u       " "  " "   %ld%d%d%dunknownUNIX%ld%d%ld%ld%dunknown%ld%d%ld%ld%d%ldpromptmacrofileunknown%d%d%ldtextbinaryimagelabeledmacbinaryunknown %dTERM%dremoteserialtcp/ip_telnettcp/ippipepsuedoterminalunknown%dTMPDIRTEMPTMP%d%d%d%d%d%d%s%d%ld%dEDITORBROWSER.0%d%d%s%s%d%ld%d%d%d%ld 8%c%d 7%c%d 8N%d%d%d%d%d%d%d%d3.14159265358979323846264338327952.7182818284590452353602874713527%d%d%d%d%d%d%ld%d?%s 7 m         \  L   d   3              /  0       $    \             <   \ \ \ \ \ \ \ \ L `  t \    t                    p  q            3 H \                                            p          , @ S h |            4 E   l        \ M h       4 X    4           ! ! ! !  I  \ p !   k!     ! ! ! ! ! ! <" L" l" " "  ,  8 E T d t   "  !  " "  " " *" ?definition is circular or too deep \&a%sK_INFO_DIRECTORYK_INFO_DIR%s%sckermit2.txt%s%s%skermit/%s%skermit/%s/%ld75/1200.5\&@[%d]\&_[%d]\&@[%d]=--+/r?%s - %s r%s ?Memory allocation failure [getnct] %3d. %sWARNING: Last line of %s lacks terminator ?Line too long, maximum length: %d. %2d. File : %s (line %d) _forx_xif_while_switx %2d. Macro : %s 00. ERROR : Command source unknown %2d. Prompt: (top level) ************************* SEND-class command failed. Packets sent: %d Retransmissions: %d Timeouts: %d Transfer canceled by receiver. Receiver's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: . Did you start a Kermit receiver on the far end? . Try changing the remote Kermit's FLOW-CONTROL setting. . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET PREFIXING ALL. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET CLEAR-CHANNEL OFF. . Try it again with SET PARITY SPACE. . %sive a ROBUST command and try again. Also: . Be sure the source file has read permission. . Be sure the target directory has write permission. (Use SET HINTS OFF to suppress hints.) ************************* ************************* RECEIVE- or GET-class command failed. Packets received: %d Damaged packets: %d Timeouts: %d Packet length: %d Transfer canceled by sender. Sender's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: . Did you start a Kermit sender on the far end? . Choose a different FLOW-CONTROL setting and try again. . Try smaller packets (SET RECEIVE PACKET-LENGH). . Try a smaller window size (SET WINDOW). . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET PARITY SPACE. Also: . Be sure the target directory has write permission. . Try telling sender to SET PREFIXING ALL. . Try giving a ROBUST command to the sender. (Use SET HINTS OFF to suppress hints.) ************************* Command file terminated by error. Command error: macro terminated. ?Error in TAKE command file: %s ?Invalid - "%s" Command stack: ?Invalid: %s %sCommand stack: Y X X Y X Y Y Y (Y \fcontents(%s)\fdefinition(%s)?Failure to allocate storage for local variables?Failure to allocate storage for local variables?Connection %s %s is not open. ?OUTPUT initialization error ?OUTPUT execution error %s, for%s Copyright (C) 1985, 2000, Trustees of Columbia University in the City of New York. Type ? or HELP for help. >>> %s: "%s" >>> %s: (undef) ?addmmac malloc error: %s !addmmac internal error! ?addmac malloc error 2 addmac macro error 7: %s ?Macro table overflow ?addmac malloc error 3: %s ?addmac malloc error 5: %s _xif_for_swi_whi[%d] -F: "%s" [%d] -M: "%s" ?Debugging log wasn't open ?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open ?Connection log wasn't open ?Unexpected log designator - %d w x y ,y w y y w Ty  Key code \%d => String: \{27}[\{%d} String: \{27}[%c String: \{27}\{%d} String: \{27}%c String: Character: \%u%c \%u (self, no translation) \{%d}%c Versions: %s Numeric: %ld Built for: %s Running on: %s %s %s %s Patches: %s %s for%s %s %s for%s %s %s %s %s %s %s %s %s %s %s %s %s Terminal character-set: transparent %s (remote) %s (local) (via %s) } } } } } } } }  Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s TERM %19s: %-13s %13s: %-15s %19s: %-13s %13s: %-15s %19s: %-13s %13s: %-15s %19s: %-13s %13s: %-15s %19s: %-13d %13s: %-15d %19s: %-13s %13s: %-15s CONNECT-mode escape character: %d (Ctrl-%c, %s): %s %19s: %-13s Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: %s Set file type: %s Set file patterns: %s Maximum patterns allowed: %d File binary-patterns: File text-patterns: (none) Output pacing: %d (milliseconds) Output special-escapes: %s Input autodownload: %s Input cancellation: %s Input case: %s Input buffer-length: %d Input echo: %s Input silence: %d (seconds) Input timeout: %s Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) ?Bad array: %s Array not declared: %s Dimension = %d %3d. %s Declared arrays: \&%c[%d] No arrays declared Sorry, command disabled. Press key: ?Error reading key %s - not found Macros: %d Function: Status: GET %s SEND %s MAIL %s PRINT %s REMOTE ASSIGN %s REMOTE CD/CWD %s REMOTE COPY %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE QUERY %s REMOTE MKDIR %s REMOTE RMDIR %s REMOTE RENAME %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s EXIT %s ENABLE %s Server timeout: %d Server idle-timeout: %d Server keepalive %s Server cd-message %s Server cd-message %s Server display: %s Server login: (none) "%s", "%s", "%s" Server get-path: (none) %d. %s %s Sorry, command disabled. * The following functions are available: HELP FUNCTION gives the calling conventions of the given function. \v(%s) = \{%d} \{%d} %s %s Global variables: \%%%c No variables defined Macro arguments at level %d (\v(argc) = %d): \%%%d = %s \&_[%d] = %s Top-level arguments (\v(argc) = %d): \%%%d = %s \&_[%d] = %s Type SHOW DIAL to see DIAL-related items. Type SHOW MODEM to see modem-related items. Command quoting: %s Take echo: %s Take error: %s Macro echo: %s Macro error: %s Quiet: %s Function diagnostics: %s Function error: %s Script echo: %s Command buffer length: %d Atom buffer length: %d File type: %s File character-set: %s Terminal character-set (remote): %s Terminal character-set (local): %s Terminal bytesize: %d Terminal echo: %s Transmit EOF: (none) ^%c%c Transmit Fill: %d Transmit Fill: (none) Transmit Linefeed: %s Transmit Prompt: %d (%s) Transmit Prompt: (none) Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d (millisecond%s) Transmit Timeout: %d (second%s) Sorry, command disabled. %s Sorry, command disabled. Escape character: Ctrl-%c (ASCII %d, %s): %s Sorry, command disabled. , speed: unknown75/1200%ld, carrier: %s, timeout: %d sec, timeout: none Type SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Unknown-Char-Set: %s Exit warning %s Exit on-disconnect: %s Current exit status: %d Sorry, command disabled. Printer: %s%s Command autodownload: %s Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s Command interruption: %s Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Hints: %s Quiet: %s Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Suspend: %s Alarm at %s %s (no alarm set) send-list is empty %s, mode: %s, alias: %s EDITOR editor: %s options: %s file: %s BROWSER browser: %s options: %s url: %s Triggers: (none) Triggers: "%s" Most recent trigger encountered: "%s" (none) Sorry, command disabled. Debug log: %s Packet log: %s Session log: %s Transaction log: %s (%s) (separator='%c') Transaction log: (none) Connection log: %s Reliable: %s Clearchannel: %s Streaming: %s Streaming will be done if requested. Streaming will not be requested and will not be done. Streaming will be requested and will be done if the other Kermit agrees. Last transfer: %sstreaming%s, %ld cps. Sorry, command disabled. ftp-client: %s ftp options: %s Sorry, command disabled. --nointerrupts --bannerfile=%s --cdfile:%s --cdmessage:%d --helpfile:%d --syslog:%d --wtmplog:%d --wtmpfile=%s --anonymous:%d --privid:%d --permission:%04o --initfile:%s --userfile:%s --root:%s --xferlog=%d --xferfile=%s --timeout=%d --database=%d --dbfile=%s (db directory=[%s]) IKSD conf=%s CDPATH current directory: %s previous directory: %s cd path: %s cd message: %s server cd-message: %s cd message file: %s Nothing to show...    , 8    $   l   C   `      D p ى     ؞   M      ğ    ̠     ?  y  D T d  \ a     إ   Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s Protection: %s %s = %c%c%c%c%c%c%cinvalid digit '%c' in number Invalid character '%c' in input                               ?Divide by zero extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript missing or not numeric ?Array dimension or subscript not positive or zero ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)Macros nested too deeply ?TAKE files and DO commands nested too deeply [%d] +M: "%s" CDPATH%s %s %sDEBUGTLOGINPBUFSIZ=%dINBUFSIZE=%dOBUFSIZE=%dXFRCANPIPESENDCK_SPEEDCK_FASTCK_APCCK_AUTODLCK_MKDIRWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dCKMAXOPEN=%dZ_MAXCHAN=%dckmaxfiles=%dz_maxchan=%dFOPEN_MAX=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dUIDBUFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMAXWLD=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXDIRENTRENAMECK_TMPDIRPARSENSETIMEHCK_TTYFDNETCONNTCPSOCKETCK_DNS_SRVCKGHNLHOSTSOL_SOCKETHADDRLISTRLOGCODENETCMDNETPTYCK_ENVIRONMENTTNCODETTLEBUFIKS_OPTIONIKSDBIKSDCONFCK_LOGINCONGSPDHDBUUCPSELECTNOSETBUFPATTERNSCKEXECNOKVERBSATTSVSVR3SVR4SOLARISi386__STDC__CK_ANSICCK_ANSILIBS_SC_JOB_CONTROL_POSIX_JOB_CONTROLSIG_VUSE_MEMCPYUSE_LSTATSTERMIOXCK_CURSESCK_NEWTERMCK_WREFRESHCK_PCT_BARCK_DTRCDCK_RTSCTSHWPARITYCK_TTGWSIZCK_NAWSDCMDBUFCK_RECALLBROWSERCK_TIMERSTTSPDLISTCK_PERMSCKTUNINGCKREALPATHSTREAMINGUNPREFIXZEROCKREGEXZXREWINDCKSYSLOGFNFLOATGFTIMERCKFLOAT=%s%s Major optional features included: Network support (type SHOW NET for further info) Telnet Kermit Option Hardware flow control External XYZMODEM protocol support Latin-1 (West European) character-set translation Latin-2 (East European) character-set translation Cyrillic (Russian, Ukrainian, etc) character-set translation Greek character-set translation Hebrew character-set translation Japanese character-set translation Unicode character-set translation Pseudoterminal control REDIRECT command RESEND command Fullscreen file transfer display Control-character unprefixing Streaming Autodownload Major optional features not included: No Kerberos(TM) authentication No SRP(TM) (Secure Remote Password) protocol No Secure Sockets Layer (SSL) protocol No Transport Layer Security (TLS) protocol No encryption No X Windows forwarding None Host info: Machine: %s Model: %s OS: %s OS Release: %s OS Version: %s Target: %s Compiled %s %s, options: byte order: %s endiansizeofs: int=%ldlong=%ldshort=%ldchar=%ldchar*=%ldfloat=%lddouble=%ldprecision=%drounding=%d?Variable name required ?Read file not open ?Oops, no READ buffer! ?Timed out, assuming "No" Please respond Yes or No ?Timed out ?Timed out ?Variable name required ?Variable %s not defined or not numeric ?Variable name required ?Name too long: "%s" ?Argument vector array is read-only ?%s failed Error - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sError - No international dialing prefix defined %s%s%s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s %-16s %-20s ; %5s %-6s %s OK rOpening: %s... ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. Type HELP DIAL for further information. WARNING: Old-style dialing directory detected: %s Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s Sorry, dialing is disabled. Please SET HOST first, and then SET MODEM TYPE Sorry, you must SET MODEM TYPE first Sorry, you must SET %s or SET HOST first /dev/null Sorry, you must SET SPEED first ?Lookup what? %s Lookup: "%s" - not found%s Lookup: fatal error - dialing skipped %s => %s ?Bad phone number WARNING - memory allocation failure: redial number Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s %3d. %-12s %-20s => %-20s (%d) And %d more... Lookup: "%s" - not found %s %d network entr%s found for "%s"%s %3d. %-12s => %-9s %s %s WARNING - No modem signals detected. Is your modem is turned on? If not, use Ctrl-C to interrupt dialing, turn on your modem, then %s.WARNING - SET FLOW RTS/CTS is in effect but modem's CTS signal is off. Disabling flow control temporarily %s... Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s TESTING... Number: "%s" => "%s" Number: "%s" Will redial in %d second%s- press any key to redial immediately. Ctrl-C to cancel... %c%c?Not a regular file: "%s" ?Can't open file: "%s" %s%s%s %s: %d line%s %s: %d match%s %s /MESSAGE:{%s}?This switch does not take an argument ?This switch requires an argument ?This option can not be set $! 4! A! P! `! p! }! ! X$ ! ! "  " " ! ! ! ! ! $ $" -" 8" D" $ P" ?This switch does not take an argument ?This switch requires an argument ?Array name required ?Array name required ?Array name required ?Bad array name - "%s" ?Bad array name - "%s" ?Date-time required ?Pattern required ?Sorry, not implemented yet - "%s" "%s" - %s ?Array declaration failure ?Empty directory - "%s" ?%s %s match - "%s" * Warning: Failure to allocate memory for sorting. * Will proceed without sorting... Directory of %s Files: %d %2d-%s-%4d %02d:%02d:%02d%10s%-10s %s %s%-10s %s %s%10s%10ld %s %s%10ld %s %s -> %s?Memory allocation error - try /NOSORT %s %s %ld director%s, %ld file%s, %ld byte%s (%0.2fGB) (%0.2fMB) .A@@{Gz?0( =( L( \( l( y( ( ( + (  ) ) $) 0) ( ( + + ' - <) H) ( ( D, T) , - . , , . . . . CK_DIR%s %s?Sorry, not valid for guests ?Sorry, not valid for guests ?Sorry, DISABLE ENABLE can not be undone = l> > > > > = = > > > ? ? ?? T> 1? #? `> > ?? M? p? ? ? ? ? ?This switch does not take an argument ?This switch requires an argument ?Sorry, this option can not be set @A DA 4A TB TB TB TB (A /A TB TB TB TB TB DA @A TB TB TB KA TA ?Does not match switch or filename: "%s" ?This switch does not take an argument ?This switch requires an argument ?Date-time required ?Pattern required ?Not implemented yet - "%s" ?Not a deletable file: %s ?A file specification is required ?Sorry, DELETE unavailable to guests Deleting %s...%s %s (SKIPPED) Delete %s? %s (SELECTED) %s (OK) %s (FAILED) %s (FAILED: directory) %s (FAILED: not regular file) %d file%s %sdeleted, %d byte%s %sfreed%s ?Can't delete: %s %D @D D E E E E D D (F F F F F @D 0D eF eF ]D pD |D ?ELSE doesn't follow IF (?Variable name required )?Closing parenthesis required _switx { %s }?Unbalanced braces ?SWITCH macro definition gone! ?Variable name required (_forx %d%d)%d)?Closing parenthesis required { %s }?Unbalanced braces ?FOR macro definition gone! ?Incomplete FOR command Before requesting technical support from Columbia U., please consult: . The book "Using C-Kermit" (type HELP for more info). . The %sckermit2.txt and %sckcbwr.txt files. . The %sckubwr.txt and %sckuins.txt files. . Your own organization's support staff, if any. . The comp.protocols.kermit.misc newsgroup. . The Kermit support website, http://www.columbia.edu/kermit/support.html. . The Kermit FAQ, http://www.columbia.edu/kermit/faq.html. . The C-Kermit FAQ, http://www.columbia.edu/kermit/ckfaq.html. If you still need help or have a bug to report after consulting these sources, send e-mail to: kermit-support@columbia.edu Or contact us by post: Kermit, Columbia University, 612 W 115 Street, New York NY 10025, USA Or by fax at +1 (212) 663-8202. Telephone support is available too: +1 (900) 555-5595, USA only, $2.50 per minute +1 (212) 854-5126, from anywhere, $25.00 USD per call, MC/Visa Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. ?Number, expression, or time of day required ?Wildcards not valid here Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. ?File does not exit: %s ?Can't get modification time: %s ?Multiple files not allowed - please specify a single file. ?Name for destination file required ?Sorry, /APPEND and /SWAP conflict ?Wildcards not allowed ?Sorry, changing existing files is disabled %s => %s ?Not a regular file - "%s" ?Not found or not accessible - "%s" ?Permission denied ?Source and destination are the same file ?Input/Output error ?Error opening output file - "%s" ?Can't copy %s to %s (OK) r?Phase error: %d ?Swap error ?Encoding error %s ?Decoding error ?Swap error ?WARNING: source file contains odd number of bytes %c%cd d d d d a  ?Multiple files not allowed - please specify a single file. ?New name for file required %s => %s ?Can't rename %s to %s (OK) ?Can't return from level %d _xif_for_swi_whi<<< %s: "%s" <<< %s: (null) ?Mode required ?Read file already open ?Input filename required ?Please specify a single file ?Positive number required ?Can't allocate read buffer ?Read from pipe disabled ?Read file already open ?Command name required ?Can't allocate read buffer ?Write to pipe disabled ?Write file already open ?Command name required Can't open process for writing: %s ?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedo r r p =q %s %s r r ?Sorry, %s works only with Kermit protocol ?This switch does not take an argument ?This switch requires an argument ?Sorry, system command access is disabled ?Sorry, no GET /COMMAND when RECEIVE FILTER selected ?Pattern required ?Pattern too long - 256 max %s ?Sorry, as-name not allowed with MGET ?Filter must contain a replacement variable for filename. ?Sorry, this command works only with Kermit protocol ?Unexpected switch value - %d ?Unexpected function code: %d ?A remote file specification is required ?Command required ?Sorry, system command access is disabled ?Sorry, no GET /COMMAND while RECEIVE FILTER selected ?A Kermit Server is unavailable to process this command Sorry, you must specify a name when receiving a file with XMODEM protocol ?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?Can't get current directory %s%s?Can't create %s ?Can't access %s v v _| y y y y y v T| y y v ,y pv  } v v y y 0~ D l | | v ?Bad label syntax - '%s' ?Sorry, %s only works in a command file or macro _xif_for_swi_whi?Label '%s' not found ?Label '%s' not found ?Stack problem in GOTO %s ?File or directory name required ?Text required ?IF: strings too long ?Text required ?IF: strings too long ?Quantity required ?Quantity required ?Quantity required ?Failure to get file date ?String required ?Pattern required ?File or directory name required ?Boolean expression too long H ߙ   \ Ę       H    ߙ 5  ; H z  H ( h   H (   ߙ  Ȗ 0 0 0 F ܔ     ( (  4 H  D  { %s }?XIF macro gone! { \flit(if ( not ?Internal error parsing WHILE condition ?WHILE macro definition gone! ?Can't allocate storage for WHILE commandr?TAKE files and/or DO commands nested too deeply [%d] +F: "%s" ?Value required %s?Not a number: %s ?Sorry, %d is the maximum ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d ?This switch does not take arguments ?Not numeric: %s ?Unexpected function code: %d ?Array name required Second array to sort according to %s?Bad array name: %s ?Array not declared: %s ?range %d:%d exceeds array dimension %d ?Bad range: %d:%d ?Bad array name: %s ?Array not declared: %s ?Array %s smaller than %s %s:%d?This switch does not take an argument ?This switch requires an argument ?Please specify a number between 0 and %d ?This option can not be set | м   L L ټ ټ м   L L L L L L L L  ,   ?This switch does not take an argument ?This switch requires an argument ?Please specify a number between 0 and %d ?Date-time required ?Pattern required ?Not implemented yet - "%s" %s.~[1-9]*~*.~[1-9]*~?File deletion by guests not permitted. Purging %s, keeping %d...%s %s (SKIPPED) Delete %s? %s (%s) %s (FAILED) Matches = %d: Not enough to purge. %s (SKIPPED) %s (%s) %s (KEPT) %s.~*~ (KEPT) Files purged: %d%s 0 M \ x l @       [ [ [ [ d     ?Remote file parameter required ?The choices are 7 and 8 ?This command not valid for guests ?Wildcards not allowed in directory name ?This command not valid for guests ?Bad size - %d MEMORY ALLOCATION ERROR - FATAL ?unexpected file parameter      <   D   k  4   T Q        Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. ?Sorry, command disabled. ?The choices are 7 and 8 ?UTF8 may not be used as a local character set. ?UTF8 may not be used as a local character set. P           @     (       \              D           l     ?Sorry, command disabled. Parameter for inbound packetsParameter for outbound packets?Remote receive parameter required ?Illegal value for prefix character Sorry, the legal values are 0-31 ?Sorry, this command does not apply to %s protocol. Use SET SEND PACKET-LENGTH for XYZMODEM Sorry, 10 is the minimum Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Remember to SET BLOCK 2 or 3 for long packets. ?Out of range - %d ?Out of range - %d ?Internal error - malloc failure ?Please specify a number or the word NONE ?Please enter a character code in range 0-255 ?Filter must contain a replacement variable for filename. ?Please use SET FILE COLLISION to choose the desired action X T T T T T T T T  T T  @  T  T T  T T T T  ?Too many characters, %d maximum  s t     (  Press the X or E key to cancel. ?"%s" has no effect in remote mode ?Not confirmed ?%s missing ?Access denied - %s ?Sorry, access to external commands is disabled. ?"%s" has no effect in remote mode Hint: try again with an output redirector. ?"%s" has no effect in remote mode Hint: try again with an output redirector. ?%s missing ?Access denied - %s ?No connection ?Internal error: malloc ?Internal error: malloc ?Internal error: malloc ?Canceled ?Internal error: malloc ?Internal error: malloc ?Parameter name required ?Name of remote file(s) required ?Remote Kermit command required ?Disposition Attribute is Off ?Name of local file(s) required ?Option string too long ?Remote filename required ?Name of remote file required ?Name of remote file or directory required ?Name of remote file required ?Name of remote file required ?Name required ?Not implemented - %s  H g  L d  k  0 0 0 4  0  0 T       7 ?File specification required Sorry, command not available ?Not available 8 x       8    x    B L     D D  D D / K_NET_DIRECTORYrOpening %s... Warning: %d matches found, %d max ?memory allocation error - lunet:3 Ambiguous - "%s" different names in network directory Closing connection ?Sorry, making connections is disabled ?Sorry, access to external commands is disabled ?This switch does not take arguments ?This switch requires an argument ?Sorry, too long - max = %d ?Sorry, too long - max = %d loginkloginekloginSorry, too long ?%s ?Fatal network directory lookup error - %s ?Internal parsing error ?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Sorry, write access to UUCP lockfile directory denied. ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Sorry, access to device denied: %s ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Sorry, device is in use: %s Sorry, can't open connection: %sSorry, can't open connection: %s Sorry, can't open connection: %s %d entr%s found for "%s"%s %3d. %-12s => %-9s %s %s Error - network type "%s" not supported ::login:telnetUsername required for rlogin :************************* Hint: The RLOGIN port is privileged in UNIX. (Use SET HINTS OFF to suppress future hints.) ************************* Can't connect to %s Can't open connection to %s  ,         <          T    L c" )" )" )" )" 1" c" )" )" )" )" )" )" )" <" L" D" T" , / / / / / / / / / / / / / ' ' @2 2 2 2 @2 W2 02 2 2 2 2 @2 @2 2 5 5 5 5 5 5 6 5 5 5 5 5 5 }5  ?File operation required ?Variable name and file name required ?This switch does not take an argument ?Variable name required ?Syntax error in variable name Can't create "%s" ?Filename required ?Wildcards not allowed here ?Write access denied - "%s" ?OPEN failed - %s: %s ?Channel number required ?REWIND failed - Channel %d: %s ?Channel number or ALL required ?CLOSE failed - Channel %d: %s ?CLOSE failed - Channel %d: %s ?Channel number required ?This switch does not take an argument ?This switch requires an argument ?Number required ?Buffer overflow ?Channel %d WRITE error: %s ?Syntax error in variable name ?READ error: %s %s ?Channel number required ?This switch does not take an argument ?COUNT error: %s %ld %s%s ?Channel number or EOF required ?Relative SEEK failed: %s ?SEEK /BYTE failed - Channel %d: %s ?Relative SEEK failed: %s ?SEEK /LINE failed - Channel %d: %s System open file limit: %4d Maximum for FILE OPEN: %4d Files currently open: %4d %2d. %sRWAB (%s) [EOF] %ld ?Channel number required ?FLUSH failed - Channel %d: %s ?Channel number required Channel %d:%s%s Channel %d:%sNot open Channel %d:%sOpen File: %s Modes: /READ /WRITE /APPEND /BINARY /COMMAND [EOF] Size: %ld At byte: %ld At line: %ld I I I I I I I I I J 0J N O |I O 8N [ \ ,V  ] ,V  Q 0Q Q |Q R R set key \%d \{%d}%cset key \%d \{%d}?Sorry, %s is a directory name Not implemented - %s Login cancelled ?Internal error: malloc anonymousftpEnter e-mail address as Password: Enter %s's Password: Enter Password: anonymousftp Login cancelled ?Internal error: malloc Modem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s Dataset Ready (DSR): %s Clear To Send (CTS): %s Ring Indicator (RI): %s Data Terminal Ready (DTR): %s Request To Send (RTS): %s CK_NOPUSHHOSTmore? ?IKS idle timeout - Goodbye. Y or space-bar for yes, N for no ^C...^C... suspend disabled %sJob control not supported %s?T-Log string too long%s %ld %s %ld?String too long[%s]?String too long[%s] %ld?String too long%s: %ld?String too long%s %s?String too long%s %s: %ld?Invalid format for tlog() - %ldh    E ~  [ 00000000""%ld""%s"%0.3fsec %ldcps"%s"%s"  Ċ  Ċ k    t  ؊ t     t     ؊ k                                           Ċ  Ċ k      ؊      t      k           Ċ  Ċ k      ؊      t      k   Size: %ld, Type: %c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld %s %s (%s) (%ld byte%s): OK (%0.3f sec, %ld cps) : DISCARDED : INTERRUPTED : SKIPPED : ERROR: %s : REFUSED : INCOMPLETE %c SUMMARY: %ld file%s, %ld byte%s, %0.3f sec, %ld cps. ERROR: %s WARNING: %s %s: %ld 1  ,  ؘ ߙ  ܖ  , x  Ֆ 0  , X x    כ כ Closing %s...OK .%03ld %s[%s]=%c %s[%s]=^%c %s[%s]=~^%c %s[%s]=0x%lX %s=%c %s=^%c %s=~^%c %s=0x%lX %s%s=0x%lX [%s] =%ld%s=%ld %s[%s] %s[%s]=%ld ?Invalid format for debug() - %d ` t ܤ @   h ק HEXDUMP: %s (%d bytes) HEXDUMP: (%d bytes) %s%02x%s TERMWarning: terminal type unknown: "%s" SCREEN command will use ANSI sequences. Fullscreen file transfer display disabled. [%d;%dH?LABELEDIMAGEBINARY UNDEFINEDBINARY / partial / resend / resendTEXT (no translation) (%s => %s) (%s => %s)TERMwFullscreen display not supported for terminal type: %s %ldSTREAMING%d of %d%cRefused, %sSUCCESS. Files: %ld, Bytes: %ld, %ld CPS%c%c?T      C k 0    X ȿ  '  ȿ     O  /var/log/iksd.db%s%s%s%08lx00000000%08lx00000000000000000000INIT7F000001%08lx:%010ld %s%08lx.%lx%s%sr%s "%s" - %s%s ::+--invalid command-line option, type "%s -h" for helplocal action=%c ! \ x        < X t       @ \ H H H H H H H t H H H H H H H H       $ K d | H   H     8 P H h H H  H H H H H H H      ( L s      ( H L h    H    + K %s %s   4 x  \ U      <     4  -./dev/tty0:?Fatal network directory lookup error - %s ::telnet%d entr%s found for "%s"%s %3d. %s %-12s => %s :Error - network type "%s" not supported y  y y | y y y y y y   y y y y y y y y     x  @ y H  y C      y  y y 0 y y y y y y y X       g0  d y cl  I y ( P C   TYPE /WIDTH:%d?This switch does not take an argument ?Sorry, this option can not be set ?Sorry, FTP command disabled %s %s?Sorry, PING command disabled ping %s?This switch does not take arguments ?This switch requires an argument ?Sorry, system command access is disabled ?Sorry, no SEND /COMMAND or CSEND when SEND FILTER selected ?Pattern required ?Pattern too long - 256 max %s ?Date-time required ?Sorry, sending files as mail is disabled ?address required ?Sorry, sending files for printing is disabled ?name required ?name of protocol required ?Filter must contain a replacement variable for filename. ?Filename required ?Wildcards not allowed ?Bad array: %s ?No such array: %s ?Unexpected switch value - %d ?Sorry, %s works only with Kermit protocol ?Sorry, no /RECOVER or /START if SEND FILTER selected ?%s - "%s" ?Unexpected function code: %d ?Sorry, a command to send from is required ?Sorry, /DELETE conflicts with /MOVE or /RENAME ?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?/RENAME for file group must contain variables such as \v(filename) ?Sorry, /BINARY required ?Sorry, wildcards not permitted with /START ?Sorry, this command needs 32-bit integers ?Sorry, SEND /START works only with Kermit protocol Sorry, /RECOVER is possible only with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON Sorry, you can only send one file at a time with XMODEM protocol ?MSEND list too long Sorry, /MAIL and /PRINT are conflicting options Sorry, %s available only with Kermit protocol ?E-mail address required ?%s too long CALIBRATION?Failure to open %s ?Filename required but not given ?Read access denied - "%s" ?Invalid switch combination ?As-name for file group must contain variables such as \v(filename) ?/STARTING-AT may not be used with multiple files. ?Bad array range - [%d:%d] ?A Kermit Server is unavailable to process this command. ?Start a RECEIVE command to complement this command. ?File deletion not allowed for guests. DP(D,4h$|D@?No switches match - "%s" ?This switch does not take arguments ?This switch requires an argument ?String required ?Unexpected switch value - %d ?Unexpected function code: %d ?Unexpected function code: %d ?Too many patterns - %d is the maximum ?Sorry, REMOVE SEND-LIST not implemented yet. ?Sorry, ADD SEND-LIST does not work with external protocols ?A file specification is required WARNING - \v(filespec) buffer overflow ?As-name for file group must contain variables such as \v(filename) Sorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list node?The HTTP command may not be used from the IKS ?No connection ?The HTTP command is not for serial connections ?The HTTP command only for TCP/IP connections l>>>>>N>?Array name required ?Segment notation not allowed in array declarations ?Memory allocation error Initial value for \&%c[%d]=?Declare failed &%c[%d]Array initialization error: %s %s ?Array name required ?New size required ?Bad array reference - "%s" ?Array not declared - "%s" ?New size required ?Array segments not allowed for this operation ?Sorry, \&@[] is read-only ?Bad array reference - "%s" ?Array not declared - "%s" ?Bad array reference - "%s" ?Sorry, \&@[] is read-only ?Array name required ?Bad array reference - "%s" ?Partial arrays can not be destroyed ?Sorry, \&@[] is read-only ?Failed - destroy "\&%c[]" ?Array name required ?Bad array reference - "%s" ?Array %s is not declared ?Sorry, \&@[] is read-only Sorry, BYE only works with Kermit protocol ?A Kermit Server is unavailable to process this command %c?Sorry, COPY is disabled ?Sorry, changing directories is disabled ?You must say which file or log ?Connection was not open ?Variable name required %s ?Sorry, DEFINE/ASSIGN disabled ?Sorry, DELETE is disabled ?Sorry, DIRECTORY is disabled ?Name of server function required ?Please specify remote, local, or both ?No macros defined ?Macro name required ?Not a command or macro name: "%s" ?Not a command or macro name. ..tmp:%03d%s %s%c_%s%c\%c_%s%c\?Sorry, printing is disabled ?A file specification is required ?Wildcards not allowed %s %s Sorry, E-PACKET only works with Kermit protocol Sorry, FINISH only works with Kermit protocol ?A Kermit Server is unavailable to process this command ?Sorry, reception of files is disabled ?Invalid - %s The ckermit2.txt file can be found in %s. Type "man kermit" at the shell prompt to view the Kermit man page. ?Label name required ?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. ?Memory allocation failure ?Memory allocation failure ?INPUT timed out ?MINPUT timed out ?REINPUT failed ?Label name required ?Type of log required ?Already logged in ?No connection. ?Sorry, CRECEIVE works only with Kermit protocol Sorry, REMOTE commands only work with Kermit protocol ?You must specify a command for the remote server ?Sorry, renaming of files is disabled ?Sorry, sending files is disabled ?A file specification is required ?Sorry, wildcards not permitted in this command ?Sorry, this command needs 32-bit integers ?Sorry, sending files is disabled ?Sorry, no PSEND while SEND FILTER selected Sorry, PSEND works only with Kermit protocol Sorry, you can only send one file at a time with XMODEM protocol Sorry, SERVER only works with Kermit protocol ?You must specify an option to save ?More fields required ?You must specify a parameter to set ?More fields required ?Sorry, host command access is disabled ?Command required Local command to run, with its standard input/output redirected to %s ?REDIRECT disabled ?SET LINE or SET HOST required first ?Sorry, SPACE command disabled ?Sorry, SPACE command disabled %s %s%s _xif_for_whi_swi%d?Sorry, IKSD can not be suspended ?Sorry, access to system is disabled ?Take files nested too deeply ?A file name is required ?Wildcards not allowed in command file name ?Can't execute a directory - "%s" ?This switch does not take an argument ?This switch requires an argument ?Sorry, system command access is disabled ?Only a single file may be transmitted ?Sorry, a command to send from is required ?Sorry, TYPE command disabled ?This switch does not take an argument ?This switch requires an argument ?This switch requires an argument ?Too long - 63 max ?Name of an existing file required ?A single file please ?Name of an existing file ?A single file please ?Directory name not allowed %s, for%s Numeric: %ld THIS IS A TEST VERSION, NOT FOR PRODUCTION USE. Patches: %s ?Sorry, WHO command disabled ?Sorry, WHO command disabled CK_WHO%s %s?Write to what? %s%s%s%s?Write error ?File or log not open ?Sorry, directory creation is disabled ?Directory name required ?Sorry, directory removal is disabled ff%02x%02x TELNET SENT %sff%02x kermit %s EDITOR?Editor not defined - use SET EDITOR to define Can't create "%s" ?A single file please ?Sorry, editing not allowed %s %s%s %s?Sorry, browsing not allowed BROWSER?Browser not defined - use SET BROWSER to define %s %s%s %s File most recently... Sent: %s Stored as: %s Received: %s Stored as: %s If the full path is not shown, then the file is probably in your current directory or your download directory (if any - SHOW FILE to find out). ?Sorry, command recall can't be used now. %s%c?Sorry - "%s" not found %s man %s?Sorry, access to system commands is disabled. ?Sorry, DELETE is disabled ?Row and Column must be 1 or greater text/HTML?This switch does not take an argument ?This switch requires an argument ?Array name required ?Array name required ?Bad array name - "%s" ?Bad array name - "%s" ?This switch does not take an argument ?Sorry, not implemented yet - "%s" TRACE %s Sorry, "%s" not configured in this version of Kermit. "K"KJ"KkJMJPPPPPQPPPȊ99P؊;@KQ@|tSorry, you must SET LINE or SET HOST first Sorry, you must SET SPEED first Sorry, network type not supported Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated Sorry, can't open %sConnecting via command "%s"Connecting to host %sConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) Type the escape character followed by C to get back, or followed by ? to see other options. . ESCAPE CHARACTER IS DISABLED (Session logged to %s, %s) Debugging Display...) Sorry, can't condition console terminal Sorry, can't reopen %sSorry, Can't condition communication line ?Carrier required but not detected. *********************************** Hint: To CONNECT to a serial device that is not presenting the Carrier Detect signal, first tell C-Kermit to: SET CARRIER-WATCH OFF *********************************** ---------------------------------------------------- Can't send character Communications disconnect Communications disconnect Connection closed by peer Connection closed due to telnet policy Remote Logout set proto %s, %s, set proto %s(Back at %s) ---------------------------------------------------- Pipe: "%s" Pty: "%s" %s: %sSpeed %ld Terminal echo: %s Terminal bytesize: %d Command bytesize: %d Parity: %s Autodownload: %s Session log: %s Elapsed time: %sError resuming CONNECT session luuuuuuuuuuuuuuuu+%s(%s)Unknown %s %s T=DIAL H=%s D=%s N=%s O=%s LOGDIAL BUFFER OVERFLOW%s WARNING - speed change to %ld failed. Speed changed to %ld. <XxK_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_DIAL_METHODK_TF_AREACODE111011800888877866358199610119990000K_AREACODEK_PBX_OCPK_PBX_ICPK_PBX_XCH%s Failure: %s: Timed out while trying to initialize modem. %s interval expired. Timeout. Interrupted. "%c" Error initializing modem. unknown DIAL command + phone number too long! %c%sSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... No response from modem, retrying%s... No response from modem, retrying%s... No response from modem, retrying%s... WARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - Trouble enabling compression APM1;KMC%d APM0 ATS111=0 ATS111=%d S112=%d ATM1L%d%cATM0%cWARNING - I don't know how to enable autoanswer for this modem. ATS2=%dS7=%d ATS7=%d%c Dialing: %s... WARNING - no carrier INVAB: Timed outCB: Local DCE BusyET: BusyNS: Number not storedNT: No answerRT: Ring tonePV: Parameter value errorPS: Parameter syntax errorMS: Message syntax errorCU: Command unknownFC: Forbidden callINC: Incoming callDLC: Delayed callANERPROGRAM ERROR - No response handler for modem type %d WARNING: Carrier seems to have dropped... %sall complete: %s. %sall complete: "%s". %sall complete. lS@\ S7S lS Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. %s%sSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) ************************* HINT: interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. (Use SET HINTS OFF to suppress future hints.) ************************* %s timeout: %d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). OK OK ERROR ERROR at at AT AT Local phone is ringing! No Carrier. Modem Command Error. Dial Locked. No Dialtone. Busy. Dial Locked. No Answer. Ringing... Answered by voice. Wait... CONNECT 1200/75 - Not supported by C-Kermit Ringing... Dialing... No Prompttone. RELIABLE LAPM COMPRESSED 8D'Q+'{L''  !!"p""#g###H$$$)%d%%%%=&&'H''(@(l((( )<)h)))(*[****+1+T+++ ,-,+t,+++ ,-,P,t,,,,,,,,,CONNECT Can't change speed to %ld Speed changed to %ld FAST/KERM Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped 889 9 9 9 9 9 9 9 9 99 9 98h88x8 9 998EOTBREAK\b\BSorry, can't open %sExecuting SCRIPT to host %s. Executing SCRIPT through %s, speed %ld. Sorry, Can't condition communication line Script successful. Sorry, script failed tcpkermitlogin Warning: login service on port %d instead of port 513 Edit SERVICES file if RLOGIN fails to connect. Cannot find port for service: %s TCP socket error Binding socket to port %d ... ?Unable to bind to socket (errno = %d) Listening ... Waiting to Accept a TCP/IP connection on port %d ... tcptelnet Reverse DNS Lookup... (OK) :%s connected on port %s Failed. (OK) :%d%s connected on port %d kermittelnethttplogintcptcplogin DNS SRV Lookup... tcp%dtcpkermittelnethttploginCan't find port for service %s login Warning: login service on port %d instead of port 513 Edit SERVICES file if RLOGIN fails to connect. DNS Lookup... Can't get address for %s Trying %s... TCP socket error Bind failed with errno %d for port %d. rlogin bind No reserved ports available. Trying %s... Failed Reverse DNS Lookup... (OK) : %s connected on port %s Failed. (OK) 128.127.50.1USERTERM/%ld/19200Rlogin protocol error - 0x%x received instead of 0x00 TELNET SENT %s%a, %d %b %Y %H:%M:%S GMT?Array declaration failure HTTP/1.0%s:%sGET %s %s User-Agent: Authorization: Basic HTTP200Failure: Server reports %sLast-ModifiedDateHTTP/1.0%s:%sHEAD %s %s User-Agent: Authorization: Basic HTTP200Failure: Server reports %sHTTP/1.0%s:%sINDEX %s User-Agent: Authorization: Basic HTTP200Failure: Server reports %s%sHTTP/1.0%s:%sPUT %s %s Date: User-Agent: Authorization: Basic Content-type: Content-length: %d HTTP200Failure: Server reports %s%sHTTP/1.0%s:%sPUT %s %s Date: User-Agent: Authorization: Basic HTTP200Failure: Server reports %s%sHTTP/1.0%s:%sPOST %s %s Date: User-Agent: Authorization: Basic Content-type: Content-length: %d HTTP200Failure: Server reports %s%s_%s._%s.%s?Telnet waiting for response to WILL %s ?Telnet waiting for response to DO %s ?Telnet waiting for response to WONT %s ?Telnet waiting for response to DONT %s ?Telnet waiting for response to SB %s ?Telnet waiting for DO %s subnegotiation Negotiations.. ?Telnet Protocol Timeout - connection closed ?Connection closed by peer. ?Telnet Option negotiation error. ?Connection closed by peer. (OK) ǟSSTELNET negotiation loop %s %sTELNET SENT %s %sTELNET SENT SB %s FOLLOWS IAC SETELNET SENT SB %s SEND IAC SETELNET SENT SB %s IS %s IAC SETELNET SENT SB %s %s%02x USERVAR VAR VALUE ESC IAC %c IAC SETELNET SENT SB %s %02x IAC SE\l |XXXOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOTELNET SENT SB KERMIT SOP %02X IAC SETELNET SENT SB kermit %s IAC SE%s %s TELNET RCVD SB %s %s %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%02X %s%c" SE IAC DONT IAC SEYl >8hD+<d N|LlTELNET RCVD UNKNOWN (%d)TELNET RCVD %sTELNET RCVD %s %s%cUSERLINES=%dCOLUMNS=%dPeer refuses TELNET DO %s negotiations - terminating connection%s Peer refuses TELNET WILL %s negotiations - terminating connection%s TELNET DO %s (implied by receipt of SB - protocol error ignored)TELNET WILL %s (implied by receipt of SB - protocol error ignored)TERMTERM=%sLINES=%dCOLUMNS=%d#@ t   USER%s:%s%s:%s%s:0.0USERJOBACCTPRINTERSYSTEMTYPEDISPLAYUSERJOBACCTPRINTERSYSTEMTYPEDISPLAYUSERUSERJOBJOBACCTACCTPRINTERPRINTERSYSTEMTYPESYSTEMTYPEDISPLAYDISPLAYTERMTELNET SENT SB %s IS %s IAC SE%s:%s%s:%s%s:0.0TELNET SENT SB %s IS %s IAC SETELNET SENT SB %s %s IAC SETELNET SENT SB NAWS %d %d IAC SEl/w/ 7/ 7// 7 7 7/ 7 7 7// 7 7/ 7/$0&9&9&9&900<0&9G0T0&9&9`0l0&9&9w00&9&9&900&9&9&9&9&9&9&9&9&90&901&9&9&9&9&9&91&9&9&9&9&9&9&91&9&911&91&9&9&9&9&9&9111112&9&9&9&9&9&9&922222&9&9&9&9&9&9&9&93&9&9 33&9&9$303&9&9<3G3&9&9T3`3l3&9&9w3&9&9333&9&93&9&933&9&933&9&933<Z=<Z=Z=Z=Z== ===Z=Z=Z=$=Z=Z=Z=Z=Z=+=Z=Z=Z=Z=4=Z=<=AA'A4AWAA@AAdALAWAAAAAAAAAAAAAAAAAAAAAAAAAAWAdAA'A4AWAdAAAAAAAAAAAAAAAAAAAAAAAAAAWAdA@AdALAAlAtAAdAdA{AAsCCCCCCC\CCdCCCCCCCCC|CCCCCCClCTD_DlDxDDDDDDDDDDDDEEE,E8E@EGEPEXE`EgEEpExEEEEG.H.H.HG.H.HGGGG.H.H.HG.H.H.H.H.HG.HH.H.HG.HHHWHLLLdHLLpH|HLLLLHLLHLLLHLLLHLLLLLLLLHHLHLLHLHLHLI ILLLLI$IL0I777777777777;9;8 8<=<[=7777777777777l8777777w88=9h=9:7877777<77@9=77d9<779[=779<777<779{<777{<7798778777:8778777<:977977977779999`:777799'9h=7777:=:7:777=777=7=7=:::=77777777777:77777:77777:77:77;7;7;;7;;79;79;7D;D;77D;7<7777O;777\;77777777h;t;77777777[=<<=C~CdCJC0CC/dev/tty/dev//dev/ptym/clone/dev/ptc/dev/pty/dev/ttyp%x/dev/ptyXX/dev/ttyFork failure?Initialization failure y/usr/share/lib/terminfo is unaccessibleSUNW_OST_OSLIBI don't know anything about your "%s" terminalSUNW_OST_OSLIBcorrupted terminfo entrySUNW_OST_OSLIBterminfo entry too longSUNW_OST_OSLIBTERMINFO pathname for device exceeds 512 charactersSUNW_OST_OSLIBmalloc returned NULLSUNW_OST_OSLIBterminfo file for "%s" terminal is not readableSUNW_OST_OSLIBSorry, SUNW_OST_OSLIB. v ztz vtzdwyxtztzLy,ytzh>P>L><>8>==T==<<|<L<H<<;|;4;::h: :99H9988l8$8777L7766666H66558544`4433D3322t2(211l1h1100<080Web http://www.columbia.edu/kermit/ or http://www.kermit-project.org/.fax +1 (212) 663 8202 or +1 (212) 662 6442, email kermit@columbia.edu,612 West 115th Street, New York NY 10025-7799, USA; phone +1 (212) 854 3703,For further information, contact the Kermit Project, Columbia University, of use set forth above are breached.New York reserve the right to revoke this permission if any of the termsC-Kermit software. The Trustees of Columbia University in the City ofremoved, altered, or obscured and shall be included in all copies of theThe above copyright notice, permissions notice, and disclaimer may not be ATTORNEYS' FEES) ARISING OUT OF YOUR USE OF THIS SOFTWARE. AND ALL CLAIMS, DEMANDS, LOSS, DAMAGE OR EXPENSE (INCLUDING THE CITY OF NEW YORK, ITS EMPLOYEES AND AGENTS FROM AND AGAINST ANY INDEMNIFY AND HOLD HARMLESS THE TRUSTEES OF COLUMBIA UNIVERSITY IN HEREAFTER ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. YOU SHALL IN CONNECTION WITH THE USE OF THE SOFTWARE, EVEN IF IT HAS BEEN OR IS OR CONSEQUENTIAL DAMAGES, WITH RESPECT TO ANY CLAIM ARISING OUT OF OR BE LIABLE FOR ANY DAMAGES, INCLUDING SPECIAL, INDIRECT, INCIDENTAL, THE TRUSTEES OF COLUMBIA UNIVERSITY IN THE CITY OF NEW YORK SHALL NOT WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. EXPRESS OR IMPLIED, INCLUDING WITHOUT LIMITATION THE IMPLIED COLUMBIA UNIVERSITY IN THE CITY OF NEW YORK OF ANY KIND, EITHER FITNESS FOR ANY PURPOSE, AND WITHOUT WARRANTY BY THE TRUSTEES OF TRUSTEES OF COLUMBIA UNIVERSITY IN THE CITY OF NEW YORK AS TO ITS THIS SOFTWARE IS PROVIDED AS IS, WITHOUT REPRESENTATION FROM THE DISCLAIMER: prior written permission.products derived from or including the C-Kermit software without specificThe name of Columbia University may not be used to endorse or promote Kermit Project, Columbia University; contact kermit@columbia.edu. or clients except as in Clause (A), requires a license from the by any commercial enterprise to its actual or potential customers or with any product not covered by Clause (A), or its distribution(B) Inclusion of C-Kermit software in whole or in part, in any form, in simply a matter of keeping a consistent and supportable code base). Kermit Project, which will not be unreasonably withheld (this is C-Kermit source code may not be changed without the consent of the an Open Source operating system with accompanying utilities. The computer, as long as the primary character of the distribution is Web site, or preinstalled software on a new GENERAL-PURPOSE distributions include, but are not limited to, CD-ROM, FTP site, operating systems) are included in the same distribution. Such approved licenses, even if non-Open-Source applications (but not SYSTEMS that have OSI (Open Source Initiative, www.opensource.org) included WITHOUT EXPLICIT LICENSE in distributions of OPERATING(A) The C-Kermit software, in source and/or binary form, may be Conditions for REDISTRIBUTION are as follows: accessed by customers or clients, WITHOUT EXPLICIT LICENSE.INTERNAL DISTRIBUTION and use, including installation on servers that arehis or her OWN USE, and by any company or other organization for its ownProject or implicitly licensed by Clause (A) below) by any individual forColumbia University (or from any source explicitly licensed by the KermitThe C-Kermit software may be obtained directly from the Kermit Project at PERMISSIONS: All rights reserved. The Trustees of Columbia University in the City of New York.Copyright (C) 1985, 2000,> Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. D@/etc/iksd.conf FZZFFFFFFOtherZMODEMYMODEM-gYMODEMXMODEM-CRCXMODEMKermitZZZZZZ@#@# &Y~   ##~HU1,,IIIIIIIIIIIautokeepdtr/ctsxxx2xxx1stringetx/ackdtr/cdrts/ctsxon/xoffnone JxJpJhJ`JXJTJLJ@JOtO/pOhO/dO\O\XOPO/LO@O\?456789:;<=  !"#$%&'()*+,-./0123DELSHYmakelist smakelist elementmakelist last elementMAKESTR MALLOC FAILURE ckmatch stringckmatch patternckmatch skipXXXfileselectfileselect fdatefileselect safileselect sbfileselect snafileselect snbfileselect filesizefileselect minsiz skippingfileselect maxsiz skipping*.~[0-9]*~fileselect skipping backupfileselect xlist emptyfileselect xlistfileselect skippingfileselect selecting-10chknumevenoddmarkspacenoneinvalidjUNIX Communications support, 7.0.231, 31 Dec 1999k Solaris 2.4