p;`  P]܀Ѐt.textЀ .datatt P t@.bssĀ].commentMIppL IpZt@@(Pp@{@@tp@,\,\,pk,@,@A0axppIL(Zpw Ox@{_pYp<\$YCMYAA@A@@@@AO"AQZ,p:(@w YAA@A@@@@AO"A@{ Yp{Z@{L IpppIL(Zpw@{FpYp<\$YC4YAA@A@@@@AO"AQZ,p:(@wY@{ Yp{DŽ@{L IILYp(Zpw@{=Z@+Ppw@{0Z,V@dpZ@?/PZ@?o~P{YpY@{L IpppI(p @{{Z,dy{L IpIppppppppppD @@AA@O@PpL IppI(tpt@+Ppwtp(xpx@+Ppwxp(p@+Ppwp(p@+Ppwp(p@+Ppwp(p@+Ppwp(|p|@+Ppw|pZpppAA@A@@@@AO`A<O'pAA@A@@@@AO`ATppAA@A@@@@AO`A< O'pAA@A@@@@AO`A LppAA@A@@@@AO`A<OGpAA@A@@@@AO`A<p(Lp<@@@p@HppAA@A@@@@AO`A<O'pAA@A@@@@AO`AhppAA@A@@@@AO`A<O'pAA@A@@@@AO`AtppAA@A@@@@AO`A<O'pAA@A@@@@AO`AppAA@A@@@@AO`A<O'pAA@A@@@@AO`AppAA@A@@@@AO`A< O'pAA@A@@@@AO`A ppAA@A@@@@AO`A<$O'pAA@A@@@@AO`A$ ppAA@A@@@@AOAAt,h)pAA@A@@@@AOAAx,h)pAA@A@@@@AOAA|,h)pAA@A@@@@AOAA,h)pAA@A@@@@AOAA,h)pAA@A@@@@AOAA,h)pAA@A@@@@AOAA,h)L IpppI,\,p(< pwOx,썀(h p'h p,-,\|(@C ,\Rx{L IpppIL( pw(pw$(p=pp ,j!p!p!p!p{pphp咀pI,(pO`$Y,{O$Y,+pO$O,O$,(pw$ @@p@p,\Yp<YK$ (p$ ,\Έ<@O$ O$,d,\`i(p+8p'|pox@!p,\,p(p{U{MO,t@p+@!p ,\,p(pwO$,pYpz3@@p@p(pw2+8pO$,B_,,(p(p%!p!p!p!p!p(kpmO$hpDhk,@dp(dpKFlppdOx,<@O ,dklph,L II(h p,-,\|(@C ,\RxL IppI,\I,\Y<\O',dk@@!p+@!p ,\,p{{L IpI(pwO$,썀O%,썀,L IIL(8!pbO0%8!,F@YpY,<|CO',dk@@!p+@!p ,\,p{,\"p,dk@@!p+@!p ,\,p{L IpppI,\ 8!pL IpppIO<%O ,FO ,<<\O',dk@@!p+@!p ,\,p{Ԅp{L IpI(pwO$,썀O%,썀,L IHLZtppAA@A@@@@AO`AtpZ@<@C$@<@_$@@$@%@(Zpw@@dpYp<YGY@@AA@O@fPpYp{poYp<_YGY@@AA@O@fPpYp{fp<Z$&( p`ppppp@@@AA@O@@AAHHAOAQpPp{o@@@AA@O@@AAHHAOAQpPppp<w"pppp$pYp<YGY@@AA@O@PpYp{poYp<_YGY@@AA@O@PpYp{@@@AA@O@@AAHHAOAQpPp? 6@@AA@O@AAHHAOAQpPpppppp p p"p"p<<t ( pw{"pppp<t$ppppp*p(p,p,p4p2p0pppp4p2p0pp{L H IppHLpp,V@Yp,V@dpd@Y@p@AA(p@@,R,\ᇀOOBO ,(d pw(h pw+A!pw{(pw,(@ pl(Pp6( pw-(xp$,\P@AA+Aw,(Pp&( p,\|(@C,(8!pw ,\"p,\ᇀOO: O ,(@w{{ل@{L IpI_,y@&p(&pw@{*!,y@&p(&pw@{@{L IpIL(xpO(tp (Zpw{(ZpZ@Pp@{@pYpt@Y@+Pp"x@@<@YCZ@Y@tAYAQPpYp{քZ@Y@PpY@{L IppG(xpO(tp (Zpw{(ZpZ@Pp@{^pHZ,V@GH@t@+Pp.x@G@@AA<xG$>(|pC|pxYpY@YHp@AAAA@@Yp(YpG$>phpx@Y@<@hK$>h@Y@@AA@Z@PAApAp(pw O)p(tph@Y@@AA@t@Pp(|pO3@+Pp),V<|@C O)p{G|GGpphdp(dpC$N>d@@AA@Z@Pp(pw O)p(|pO?@+Pp5,V<|@C O)p{d@@AA@Z@PG|GGp<$=lp(p,p p$p,n(@?- p-$p,M(@-(p-,p{ p$p(, $,(@Clp{lp{,f@lp(pw (lpC{](p (lpO{Pd@Y@@AA@Z@dAAHHAZAQPp(tp#d@Y@@AA@t@dAAHHAtAQPpYdpzd@Y@@AA@Z@Pp(tpd@Y@@AA@t@PphpzzL H G IpppHLO3dplppp<tO <$tG{ @$L@<xO <$xG{ @$L@Z@?+PwZp{Z@?-PwlpZppZ@? PZ@?0P{Zp{pZ@+Ppw$?Z@PYpY@AA+AY@@,W@Yp?/Y_?9YWY@p@HoHHhp{,?o@Y_?oZYWY@p@HoHHhp{ @$L@( p @+Pp @?穄P p{@ A?穄Q@@p{L@?o`穄_?oz穄_.{?/穄_ ?9穄_{?o@穄_?oZ穄_{@@p(pwN,@+PpD+穄p<, p @+Pp @?穄P p{@ A?穄Qw@@p@<@w(0p(pw p{(p@{@@p(0pthp<hGlhp0@@p(@R4@h@?P穄w*hlpp?"穄 ?'穄{ p{!{8@h@?P穄w p{hp{@<@w$O<@G (@$TQ<@w$P$TQ@@+@M(|pw(pw$p|p<|O$.R|@@AA@I@@A,x@Yp(YpXY,l @dp(dpOEOg>,x@Yp(Yp.Y,l @hp(hpOd0ph4p@{ @{@{L IILpYp<_YGY@O C@PpYp{d8ph8pl8pL IppI,\Ͼ{L IpGLYp<h8d8;h8Ad8ApA@_@@A(AC_A AYpYA AH@GHGGYpY@{L H G IppHsspd8@h8@p@A_AA@(@C_@ @@ @HA@H@<@w@{9h8@O C@sPph8p<_h8w h8pl8p@{L H IpppI LYpdpOo>hpdpYpZYpY@+Pp(dpwY@PAA, @dpYp{܄d@{L IppILYp<h8d8ZZ@d8AO CAQPpd8@O C@Ppd8p<_d8w d8p<h8d8w l8pYp{Z@PpY@{L IpILYp,\4{L IppI08p,@{L IpI,?@|8p ,?@8p,?@8p,?@8pL IpppI|8,? 8,?8,?8,?L IpppIL,\:@Yp(Ypcc@@+@O O>,?c@@+@O O>,?c@@+@O O>,r?,,?,?OU,?,!,\1,?,\,@48pdp,dy(@,X@dp{<,dy(@,X@dp{,dy(@,X@dp(dpO4d_,+4pwO4,+4pwO43_,,\O(,\θ@_,,pO(,V@Yp(YpG/(p(p{.Y@O(@?/PY@O(@/PpY@O(@Pp,\@{L IpppI<48O48,@{L IppG_ L_ 8p8p<8O5ZO`:_,X(@w @$``:p8,p8p8pZ p @PA@@+@ p{ㄩ @+Pp$YZ,@8pO`:Z_,(8pwt@Pp8p{t@Pp8p8p@8px$8p88p<8pp8p@$`8pOR,?@)pT8p@8pH,dy(@,dy(@w{HH88px$8pt@P8pt@P8pZpZO3,p:(@3(8pw*Z_I,(@I,V(@OIp(8pC%HO3,p:(@HH8p8p(8pG$=\, @p(pK$5\<$*\O9,S @p<O?(< pwO>,E=O8,!@,$\+9pw$\(O9, ,(p,|p@$`{ @$`{ 8p>p(|pO_OR,?@x8p|,9@pO S,9(@ >p{,5@8p,\7{p,@8p(8pCK(8pw 8p{9(pO(< pw ,=,\^ (@O O>,[9(8pC=),?< w @$`{(>p@{@$`8,dy(@$]O?,p:(@jO O?,8,\ (@O O>,88,x8pp),?@$`@<)w@@T8pO`:Z_,t@(PpK$^O3,p:(@w8p$^O4,p:(@w 8p{o+4pe8,X@p(pw O9?p@+Pp-O4_,X8p(@ 8p{ 8p(8pw"(88pw8,x8p{t@(Pp t@8Pp8_TO8,y8_TO8,y8_TO8,y(8pG$`8,@AA+Aw$`88,@AAA,(@CO:?,:(8p;_8pp8_TO8,y(@COO?,:,2@,x(8p\8pO8@<(8w@@,0O8pO8p8_TO8,y@p,\'@D8p),?@<)w@@T8pp8p@{L H G IILYp(8p<(8YpZY, 2{L IppILdp(8pC @$b(<8p @$b@8pp8p(p&,\`i_,iep,\0(8p(8pO088,@AAA,@dpdp`?p(8pw$bOR,?@x8p,9@YpO S,9(@dpp(`?pG&`?p(Tp,9,\@dp<`?G`?p,9,\@dp<`?G:`?pp,98,x@dp,38pp@{L IpppILYp(8pC @$Pd(8pG @$PdYp8_TO9,y(@C Y@$Pd8,@AAlp(AC Y@$Pd9p@@@hp8l@@@,O9p8_T,y(@C8_TO9,y(@C8l,@{r_,,#O`:,/@,x9p8_TO9,y(@C@{&lp8l,(@C@{@{L IpIL(8pC@{<(<8p@{/8_TO8,y@Yp(YpC@8pY@{L IppI LZ,@Yp(@ pw5Z,@hp(hpC(Ap@{@${ h@$(pS(8pwJ(`8pKc8dp`8pd@$(l8pI@@@,(@O d@$(ZpGfI@@@,$~@Yp(Ypw{(YpO d@$<w$(\:p\:p8S@${{@${OR,?@x8pZ,9@hpO S,9(@Yp{I@@@,$~@Yp,\H(YpOd@{B(lp+*pwd@O@l@Ppdpd@O@l@YAO@\AQPplp{Ypdpz(lp+*pwd@O@l@PpdpO@ldO ,Pr@p@{L IpIL,\Z@YpOBZY@+Pp O B@{ O9?@@Y,{L IppIoDL(~pw$Û( ~pwO ~OH~,h)(Zpw OV~Zp(tpw OV~tp(xpw OV~xp($~pw, ~ ,~@AA$~p(AC ~p{i$~I@$@@,Y(@wOI@ @@Z ,It,I@ @@,< w5A<(AC*A@&@?PwA(p(Aw@{p{A{((pw9p~@ A A+A@{Ip~@ AA+A @{1{@{*&(p(p(AQ@(p{L H IILYpZ,@Yp(YpG @$ڨ(tpw @$ڨt@+Ppw @$ڨ(p(@ pw(Zp <Z{ @$ڨ<Zw5Z@@AA@Oh~@PA @@tt,V@,~{TtZ@@AA@Oh~@P,0<@w@{@@Yp< ZwZ@@AA@Oh~@P,tY@{L IpIZt,(@C @$(p(@ pw(Zp <Z{ @$<Zw1Z@@AA@Oh~@PA @@O|,~{Z{-O|Z@@AA@Oh~@P,0<@w@{-< Z < Z{Z@@AA@Oh~@P,t@{L IppI(p(@ pw(Zp <Z{x@{8Z@@AA@Oh~@PA @@tx,~_@Aw@@p$@($pC@{L H IpI,L(p(Zpw @$ٮZ,V@$p($pG @$ٮZ p< $w O,p:(@w @$ٮ @?o~Pw. ,B@ p( pw OV~ p @+PpwZ p I,Z@$p($pC @$ٮd@O@>_@@w(p((p (pw{d@O@>_@@{x(\ p $p{- ,V@AA$p(AC ,V@$p($pC @{2{0~pO점 _,~@p(@C@{L IILhp(Zpw @$㰀Z,V@dp< dwZO,p:(@w @$㰀Zlpl@?o~Pw6l,fA@lp(lpw OV~lpl@+PpwZlpl,V@dplZplp(pwZ,fF(@ @$㰀d@@@,y@lp(lpwO O,f@$㰀lZd@@@,dYp(YpO"Y@l@p@AA?/Qwhp{Yp{(hpz(YpOuY@l@p@AAQpl@+PpZl,E(@wNl,V@Yp(YpO.Y@l@p@AA?/QwY@l@p@AAQp{Yp{(Ypwl@Pp{{l@Y@.PpYpl@Y@Ppl@+PpwlOd@@@,l,V@dp(dpC{l,|(dpC@{@{L IppIL(p@{Z,Z@YpY@{L IpIZt_,L IpG_0Lhplppp(tpw$(Zpw OV~ZpZYpY@?o~Pw(Y,&?@Yp(Ypw OV~YpY@+PpYZppHZO,p:(@wHHp(pw/(|pw*ZI@@@,I@@@d_,:{s(pw<|wI@@@Z_,:{O(pw2Z,(@$I@@@_OZ, {I@@@Z_,pIGGG pIG_GG$p(p,p @+Ppl<_,Gc(p<(O' @+Pp @?/P p{䀩(p{ @?/Pw(p$@ AQPp p$p,p{$@PpI@@@I@_@@_,(xp (pw{tI@@@,$IGGGZptdpZ@+Ppw$ <X~lK$ Z@? P_hp(hpwZ@? PW{k(xpOVZ@? Pwd@o_Ppdplp{LZ@PA@@+@ p{Z@PA@@+@pd@ZAQPpdplpZpzWd@Ppdpd@? PW,\@,@p(p@ A+Qpw {lp{ @ lpl@@p@p@+Pp@p?/Pwp{,\DVlOt,M,{<~w@{~h,xZ@@AA@O~@PpdO,ZAAHHAOh~A@QpZ@@AA@Oh~@P~p(p&(p䘐p@{L H IpppIL@<Z < Z@@dpZ@@AA@O~@(Ppq(dplZ@@AA@Oh~@P,&@lpld~pZ@@AA@Oh~@~pPpZ@@AA@O~@Pp(lp@{@$t(~pU~ ,DI@@@,~@AAYp<~A @w>Bw @$̀{ @$̀䘐pZ_O䘐,+(@ O䘐Yp蜐pt_O蜐,+(@ O蜐dpYd,p:(@w @$̀Y,;*(@ @$̀d,&*(@w$M̀`pd,V@hp(hpG @$̀d@h@p@AA?/Q h@O蜐@/Pphph@O蜐@PpYI@_`@@,uhO蜐@@`h_@@,(pL(@ p!@@+@w4{(@ pw!@@+@w{d,<@O @$̀,`Z@GGpdp40p ,px@p(@ <@m{}@O@>_@@w _@p(dpZ@@,@Dp(xpC@{G(hpw@{>ZI@,@@,[(@Yp{Yp{@<4$K@@Yp{YpY@{L H G IpG LYpZ,V@HT,VHA@AAGGGplp<HlC@l@@AA@t@(Pp)l@@AA@t@P,|l@@AA@t@Pplp{Hp,y@Yp(Ypw @$ 　YTOXZ, Y,O׀lpOdpp(`p,\@H{/(p((pK(@PH(p{ ,\Ä@HH@@p<@w$ p? ? $ d@PpOdpd, <@w$ကd,}@p(p (pwzR(p (pz@d,V@p@@@,y@hp(hpw{BhO,~l@@AA@t@hPplp䀀,y@dp(dpwh@p@$X䀀d@p(YpwdYp{ h@dpdhplp< lG.Z@?/P$Z@+Ppd@p@AlAZ@PQpZplp{фd@p@AlAQp< lOZ@?/PZ@+PpZp{Z@?/PwZpzF(hpO`h,h)Y@{L IpILphplpppZ,@AAYp(Aw @$倀OdpZ@?/P d@.Ppdpd@/Ppdpd@PpO\Z,h)lp\hph@+Pph@?/Pwlphp{ldppt ~,h(@C@{x\,@hp\,@pp`,@lpYOd,5(YpY@pY,|Yp{@{L IG_LIGGGppp4p8p_@Aw@{@@4p{!tO,X4p(@w4p{:tO,Z<@@ĒAOA>_@Aw@{@@4p(pw`@?.Pw p(pw:\@?.Pw,\@@?/P\@@?.P p(pp(pwp(pG$耀(4p$耀xpx@Ppt@?/Pw tlp{=xGGGlpDp_@Aw@{@@4p{4p{:tO,Z<@@ĒAOA>_@Aw@{@@4p(pO@(4p:`@?*Pw,`@@+Ppwt4,(pC$-퀀tp(4pZ@{ \@@p(4p*(pw!(dpO(8pw((pw (8pw{ (pw{"t4,(pC$-퀀$ 퀀(4pw$ 퀀(pw (@pw{up|@/Pp|p|@Pp(pOCZ@(pw:,y@pZ@p(p@pZ,~Z@t|,z Y,xL H G IIL(pw~ ~,,(Zpw OV~ZpZ@+Ppw$"(tpC9ZO,Z<@@ĒAOA>_@Aw@{@@tp(p (tpw{(p(tpw{$"pZ@?.PwZ@@?/PwZp{p(pCp$"Z,V@Yp(YpG$"@Y@p@AtApA@@~A ~A,\@,@p(p@ A+Qpw {dp{ @ dpd@@hp@lpl@+Ppl@lp?/Pwlhp{,\DV(Zp Z@+Ppw{dhOv,M{dhOZ,M,$_@Aw@{@@YpYpOyZ_,Y@{L II(p@{"(Zpw OV~ZpZ@+Ppw@{@{L IpI(pp~Z,d(@@{@{L IppG_LLIGGG,p0p4p8p<p@pZYp(Ypw @$Y@+Ppw @$(xpw @$xZt,@pxpptdpY@?o~Pw2Y,@Dp(Dpw OV~DpD@+PpDYppY@+Pp2Y@?.Pw$Y@@?/PwYpY@?/PwYp{{{{ɄY@+Ppw @$Y@?/Pw+xYd,x,V@<p@p$,\}@AAHp(AgxHd,@<px@<@/Pp<p<dpY,V@AA@pt_I@_@@,(@$II@_@@_,X(@w p @{L IILZ,V@AAA,y@Yp(YpwO,,YZ,~Y@{L IpppHZ,@H(Hw @$(pH,|č,|؍,|܍,|,|O@XPppp ppppp pX,@p,@čp,@؍p,@܍p ,@pO@{L H IpHLH(Zpw OV~Zpp(}p @$|p~pZO1,p:(@ZO5,p:(@$ {(~pw @$O1,/(@wO5,(@w{ @${WO1,G@AA䍐p(A4|p~pOO5o@,@${ @$Z,@䍐p(䍐pw$䍐@ dp(dpw OV~dpd@+Ppw O?dpOV~HZ,b@Yp(Hw䍐p@{B{7(Yp䍐p@{0{%Yp~pOZo@,@{ { Yp@{L H II_ L(Zpw OV~ZpZ,V@dpZ@+Ppw @$@(pw OM@@O,U@Yp(YpThpI@@@_Y,(@-?#hW{߄I@@@Zd,X(@w@{hp{Y,t@{L IpI(}pO(~OV~OV~,䍐p}p|ppL IppIL IpppILhp(}pw (~pw {@$(Zpw OV~Zp~p(|pZ@+Ppw @$(|pw{(䍐pw O[dp{䍐@dpZd, @Yp(䍐p-䍐@A+QpY䍐@,p:(@w{䍐pp@$䍐@ ,p8}p䍐@hp(~pMO(~O^,\\@, :O(~䍐@P@(pw Og@@,(|pa(p hp{Oh,h)ph, (@C$pOO, (@C${h, (@C$䍐@,8(@C$|p(|pYppO|Ov ,DO}Z_,OO荐pO,{@ph荐pO|O_,O䍐@P,O0荐_,OoFOO, O, OoJOO, O, O_ OO0, O, OOo@,썐,`Z(,!pw$X撀p(|p O|@{ O@@lp(|pO|lpX撀p{OlpX撀pl,V@pO *,E@,:O)@@l_ ,DO)X撀,E@,:(|phlp{),\@lp(lpw OV~lpl@+Ppw 荐lpO$*l,V@,E@,:O)@@l_ ,DT撀,净@{p,\@{L IpIL(<pw @$b(Zpw O̳ZpZ,V@hpdp9YpǐlpZǐp9pȐp<@Pp<,@dp+apw8<<Fw HVpF{%?Hw@@VpFYVpF{HVpF{@@VpFYVpF+ap VpFHVpFGHFC<CCp_@# pIHHHlp I@ @@I@_ @@,00IHHHlp(lp*l@+Pp!O( l,Ȁ@Yp@@$蹐(p&p&p{(乐pp{<Tw oNPp{PpPp<lGPppOP@$C<@0@{oB@@Pp<lGPppOP@$C(p7(pPp{@p@AApAPp{ Pp<lG2Pp8p p,pDpOP@$C(Pp LH{HHG(8p 4GpGF( p FpFE(,p (E(DpE@@@ @_@{ E@ @_@@Pp< lGhpOP@$C(,pk@ @{!@@Pp< lGoPPpOP@$C<lOZAAQ@o@_@{ @@YpY@(YpC @@p,@ppp<lOGZ@@PApA@o@@G_GGp<lOZ@@PGo@GGp{ p(p7p<C)@@,0pAOA@Qpp{<lOZAAQ@_@{ @@p+p?W{ p<lOZAAQ@{#@@Yp< YO <>YO{O{_{?o__?o~_{pp{ pHp0p$p<p<T Tp dp< lG$HZ@ @PApA@o@@G_GGYp@YA4Ap(A(8p@@<p@YAAp(A( p@@$p@YA(Ap(A(,p@@0p@YA@Ap(A(Dp@@Hp<T0@YALAp(A(Pp(p@@Tpp dpZ@d@PA_AA@@+@ <,(@ p$(08pw(咀pY,Ї@{{@{L H IpHL ֐p(Zpw @$iZ@+Ppw @$ipOǐYpZ@+PpY@ZAQPpZpYp{pYAtHX@@QptpYp+@{Oǐ,(@O8:pppp p ֐p,\{{  ֐p@{L H IpppHLZ@PApA@o@@H_HHYpZpZHYHHp@PppZ,@hph@<_@C$1o_@<_ @_$1o@@$t,@8p@$5o,@AAtpApp@$5o,@AApAp@$5o,@AAdpA`p@$5o,@AA|pAxp@$5o,@AA\pAXp@$5o,@AAlpAhp@$5o,@AApAp@$5o,@AApAp@$5o,@8p@$5o,@ p  p$Ap@$5o,@pp@p@$5o(p(p @$5o,@hp(@ p!@@+@w2{(@ pw!@@+@w{<h <h{ @$5o(hpw 8 p<hw 8 php@$5o,@| p@$5o,@p@$5o,@p@$5o,@p@$5o,@p@$5o,@p@$5o,@lp<lG"(lpOlpp@$5o{'@?oBPwpp@$5o@$5o,@AATpAPp<_@#TO _@#Tpd:d,@hp(hp@{&d,긁@Yp(YpC@{dp@{L H G IpI:Oϐ,{L IpppGL:hph@@AA@O:@Pdph,h,긁@AAYp(AC(͐poYhOϐ,@lp(͐p(lpCl@{ZtO$⑁+D:p{lppppoYOD:,V@OD:,@hp(hpC h@$6#ZOϐ,Oplp{'oYZOϐ,@hp(hpC h@$6|p(@ p,(08pw#(咀p%Oϐ,Ї@$6{ @$6(`pO@YAA@A@@@@A֐A@p<`@O(p@$6,\򾁀YAA@A@@@@A֐A< wy( phZ,Z|p(@ p,(08pw#(咀p%Oϐ,ЇYAA@A@@@@A֐A@$6{ @$6(pO,\ΈZAAHHAORA@QpYAA@A@@@@A֐AYAA@A@@@@A֐A ,~@hp|p(@ p,(08pw#(咀p%Oϐ,ЇoSZYAA@A@@@@A֐AYAA@A@@@@A֐A ,YAA@A@@@@A֐A@{L H IpppILp pHߐp(@ p$(08pw(咀p Z,ЇZ,oE<,@Yp0ZoP,< dp< pXp,\N߁,၀d< p( p @@͐p@p p+@@+@w$(H p (H pw$(P pw$<dG( pw$lp(@ p((08pw(咀pOϐ,Їpo@TpTdpTPp<@Y@Pp<,V@lpoAl<,t{{@{L H IppHL<ؐw OTؐ@{sZdpd@dp?oNP Oא@{X{Qd@PAAYp? A_@Yؐp_YpY@<ؐ@WY@@AAHO\ؐHX@{ Oؐ@@dpd@{L H IpppG LZ@?oNPwZ,Z@אp@$ˁ<( $ˁZ@?1P$ˁZGGGhph@PApA@o@@G_GGYphpdpY@Yp(@O.dAA@A@@@@AoAh@PHpAGHGGdphp{(dpO d p( pO ,(@C@{Oאאp@{L H G IpGoHL apO( dp(pw(Pp+t@@,,x"ېp$uJ(pw$(pw}Oxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$󁀠,}(@K$,\e(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ Hߐp$uJ(pw${(p${􁀠Oxߐ,B,\(H pw@$xJ$u(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$1(@ p!@@+@$l{(@ pw!@@+@$l{Oߐ,B,\(H pw@$xJ$f(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$1,}(@K$!,\(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ pHߐp$uJ p(pw p(pw$(p$Oxߐ,B,\(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$,}(@K$,\/(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ Hߐp$uJ p(pw p p(pw$(p$Oxߐ,B,\5(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$(@ p!@@+@${(@ pw!@@+@${Oߐ,B,\D(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$,}(@K$x,\(H pw@$xJ$v(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ Hߐp$uJ(pw$(pw}Oxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$,}(@K$,\5(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ Hߐp$uJ(pw$o(pw}Oxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$Q,}@AAp(AK$/,\(H pw@$xJ$-(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{$(pw Hߐp{,\Hߐp$uJ(pw$(pw}Oxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$,}@AAp(AK$,\Y(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{(pw Hߐp{ ,\$uJ8$ p Oj, ,j,j8@+Ppw$98@P@!p(pw$(p$?oI@!w$?oL@!w$?oH@!yOxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{N p(p( pw'(pG,@p p Hߐp$Oߐ,B,\(H pw@$xJ$(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$uJ(pw$}(pw}Oxߐ,B,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$o(@ p!@@+@$n{(@ pw!@@+@$n{Oߐ,B,\(H pw@$xJ$h(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$o((H pw@$xJ$0(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ ,\>{ (,$?2L 0p( p$(pw OF,@H{- (0p O@{ OF@@, @HH,p(,pK$&2@(| p<| w( pw{@@x pO␀,B,\ݱ(H pw@$xJ$$2(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{( p ,\>{ ,\$uJO 㐀p ېp(x pp$63(pd(`!pC(d!pl!,ځ@p{l!O,ׁ@p{O,ށ@p{Y( pO,ށ@p{8O( O,ׁ@p@@@,(@K$>O㐀,B,\+(H pw@$xJ$>(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp{ Hߐp$@l,(@K$?O␀,B,\X(H pw@$xJ$?(P pP p@$xJ{i,x"(@C @$xJ,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp$@,\:@AAp{ ,\Hߐp@$0O$-M{ ,\Hߐp@$0O$0O,B,\ʔ(H pw @$0O{{(P pP p@{l{e,x"(@C@{W,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@{L H G F IpI䒀p+pw$dPO𐀠 ې,X(@$dP9ߐ@@P!,@p(pK$^P,А,B,\(H pw@$T$UP(P pP p@$T{i,x"(@C @$T,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$T$ TpT p(L pO ې ߐp$ߐp ېpp(`!pOO㐀p(d!pl!,@p{l!O,ׁ@p{O,ށ@p(pw$eS (L pw (`!pw {O@{ O@@, (@K$RO␀,B,\(H pw@$T$R(P pP p@$T{i,x"(@C @$T,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$T$_S( pL @+Pp?(`!pOLߐ,⨀{$(L p (pw{OLߐ,썀(X p(( p_,X p,`,၀(Xpw(Tpw 䒀p,\(H pw@$T$VS(P pP p@$T{i,x"(@C @$T,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$T$ T,B,\(H pw @$T{{(P pP p@{q{e,x"(@C@{\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@{@{L IpHL(,!p((O됀8@@@OLߐ,D釀8@@PYp?oQY$Y(@ p!@@+@$`U{(@ pw!@@+@$`U{O됀,B,\(H pw@$\$QU(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$YO ې ߐp$ߐp ېp8HHHhp8,V@dp8@@PYp8@@?o\Pw$8HHHhph@?o\Pwhp$ W?oKY$Vh,V@p(pOE@h@p@AA?)Qw08HHHhp8@@o\Pp8@@ofPp{O8@@o\Pp8@@ovPp8@@(Pp8@d@)Pp8@d@p@AAQp{~8@@o\Pp8@@ovPp8@@(Pp8@d@)Pp8@d@p@AAQp?oSYw8@@$Pp{?oGYw8@@omPp_dpO ېlphI@ @@I@@@,00(@K$ X(dpO O쐀@{ O쐀@@,B,\(H pw@$\$W(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$YO ې,<@G$X<,䒀p,\+(H pw@$\$X(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$YO ې,U(@Hߐp@$\$YO!쐀,B,\H(H pw@$\$Y(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$\?oSY$[(@ p!@@+@$Z{(@ pw!@@+@$Z{O2쐀,B,\@(H pw@$\$Z(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$[8@@PApA@o@@H_HHpp8@@Pp8@@@8@@p@AAA,F(@COI쐀,B{,\䒀p,\(H pw@$\$[(P pP p@$\{i,x"(@C @$\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$\$\Oߐ,B,\Z(H pw @$\{{(P pP p@{l{e,x"(@C@{W,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@{L H IpppH_L(@ p{!@@+@$]{(@ pw{!@@+@$]{O^쐀,B,\c(H pw@$`$](P pP p@$`{i,x"(@C @$`,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$`$`8@@PApA@o@@H_HHp@8@p@AAQ@p@AoAAH_HH pI@@@8@@@,:I@@@AAQpI@_@@@@@A8AA ,:I@_@@A AQp(,!p((Os쐀I@@@I@_@@,D釀(@ pw!@@+@$_{(@ pww!@@+@$_{I@@@I,I@_@@I@@@,I@@@Y,p:(@w I@_@@d,p:(@w$_O,B,\(H pw@$`$_(P pP p@$`{i,x"(@C @$`,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$`< Hߐ$`I@@@I@_@@,|ʀ(@O쐀,B{䒀p,\,\)(H pw @$`{{(P pP p@{q{e,x"(@C@{\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@{@{L H IpppH_L(@ p!@@+@$a{(@ pw!@@+@$a{O쐀,B,\-(H pw@$e$a(P pP p@$e{i,x"(@C @$e,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$e$e8@@PApA@o@@H_HHp@8@p@AAQ@p@AoAAH_HH pI@@@8@@@,:I@@@AAQpI@_@@@@@A8AA ,:I@_@@A AQp@8@p@AAQ@p@AoAAH_HH pI@@@8@@@,:I@@@AAQpI@_@@@@@A8AA ,:I@_@@A AQp(,!p((O쐀I@@@I@_@@,D釀(@ pw!@@+@$d{(@ pww!@@+@$d{I@@@I,I@_@@I@@@,I@@@Y,p:(@w I@_@@d,p:(@w$dO,B,\d぀(H pw@$e$d(P pP p@$e{i,x"(@C @$e,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@$e< Hߐ$eI@@@I@_@@,Ȁ(@O쐀,B{䒀p,\,\d぀(H pw @$e{{(P pP p@{q{e,x"(@C@{\,\\% p(pOLߐT!p( pېp(ߐ p,ߐp Hߐp@{@{L H IH_LYpDppp8@@+Pp&8@@PApA@o@@H_HHp(pw$i(pw$f(pOO쐀,B{d(,!p"(O쐀OLߐOLߐ,D釀O쐀,䒀p_,p(p ,\"$i(pG$i,}(@w.?os@!"䒀p(@ pO퐀,{(pw ,\z,\䒀(pېp+.p"+8p(hpw,H8p(퐀pw$s( Γpw$s( pw{(pwr(Ypw(++p_,i/p{Yp(dpw(+*p_,i.p{dp(dp (Ypw{O,dl撀p p p p(䒀pw(@@@p, p< ېO ېp ېp(ߐ p,ߐp<Oppp  pTpL IpH_L@!hpip ېp䒀p@ߐp<ߐpDߐp(@ pw$u,\|(@K$u(X p,`䒀p$t}?og@!wX(P!pOP!@?oLP"P!@?oFPP!@?oXP{ 䒀p{O-,$t}(@ pI(pC@( pw7(@ p((08pw(咀p O>,Ї$t}YpOdI|,X(@C7(@ p((08pw(咀p O`,Ї$t}C(@c<xw?h ,>@hp(hpw @$hO,p:(@w @$h,|A@Qp@$$JI@@@,0@AAYpC(@c<xw?h ,>@hp(hpw @$hO,p:(@w @$h,|A@Qp@$$I@@@,0@AAYpC(@T<xw7h ,>@hp(hpw@{?hO,p:(@w@{&,|A@Qp@{{@{ {@{L H IppHLp(Zpw O@Zp(tpw O@tpZ@+Ppw OZpx@O@PpZtI@@@,@Yp(YpC Y@$gd,%@dplpdp(|p-p@+Pp,j(@lp{p{<lwY(|pThp_`pdI@@@O`|H,X@AAYp(AC @$gdpd@+Ppwtdpd,@p@+Pp*,*(@CO,@$gdpd,(@Od,@{ad,(@x@dPp@{GdO5,p:(@'d,஀(@CO>d,@{{x@dPpY@{L H IIL`Yp`pZtx|,௲@dpY`pd@{L IIZtx|,ு{L IppIZtx|,\{L IpILZtxI|,7{L IILZtxI|,{L IpppFoxLpppp$p,p0p4p(Zpw O@Zp(tpw O@tpp@@+@p pp(p@+Ppwp(pH,V@dpd@@@,y@,p(,p,,~,@@$p@pOP t_,OP tppplpx@O@PpV@@dp<@,N@dp{:t,*(@C*Od,(,p ,,|@$px@Pplpd@<@C$@< @_$@@$,\Έ<@OM(p"O|,,(< pwO,@${,N@dp$O,(,p ,,|d@$(lpw x@tPpx@P,%xA@Qpx@PA+Qpw(,p ,,|@$(pw$ex@PpYp<YGY@@AA@I@@AAQpYp{lp<Zm_hpIGo`GGpO VI@@@I@@@,00O)VO4I@@@I@@@I@o`@@<,ؠ@hp{+dpOcVO4I@@@<,@hp(hpK$;pYp<`YCi<YC-Y@@AA@@(PpY@@AA@@P,|Y@@AA@@{cYp(dpOrV,@$><Zw+,(@wOV,@$><ZGY,(@wJ_@X,@AA\p(A)\@(p\@,V(@O \@pdp,V@dp(dpOd@@p@AAQdp,V@AAA,ylAAHHAIAAHH@Xp(@wwOV,Yp$>l@@AA@I@@AAQ,~<Z$C><G$C>AA@A@@@@AO"A*pwAA@A@@@@AO"A? dQAA@A@@@@AO"A hpipl@@AA@I@@AAQI@_h@@,,Zlp<`lOlOV`,Yp{((p8(8pO/(<pO&Yp8@@<@YO,\(@w{ {Ypdpz$@@䒀p{L IppIO],O]`B,@,O]Z,O],O]],O^],O],O2^XB@(XBpw OP^@@,OW^\B@(\Bpw OP^@@,O],L IpIOx^o@O^],!@O^Z, Ox^@{L IpppF_HLYpppppppppppppppppppp]pO4p]p<Z]OO^Z,]p<]]O]]p(]p$r(Zpw O4ZppZ@? PwZp{Z@+Ppw$r(]p$KZ@@AA,y@]p(]pwO^Z,]p$rZ@@AA,y@]p(]pwO^Z,]p$rpp<ZC5@@AA@]@Pp@@AA@]@Ppp{ĄZppZ@?(P$L@p+Pp p{넩@Z@p@AA?)Qwj@Z@p@AAQpZppZ@? Pw Zpp{p(pO2@Z@p@AA? Qw@Z@p@AAQpp{˄Z@+PpwO4p$rdpZ@@+PpZ@@+Ppw.{pZhpZ@?(PwO4p$r$N ZO_',bI@Yp(Ypw$rY@p(pK < G{O,_ ,]p$r(pw$r<w Z@?(PwZ,@p$rY@Ppp<Gf@@AA@I@@AAQp@@AA@@(Pp1I@@AAHH@@@@AA@@P,h)p{Z@?(Pw$h,@pI@@@,h)p<w(hph@?'Pwhp$rp(pG$ePhp(pw O4p@+Ppw$rpp@PA@@+@p$rO@PA@@+@@@+Ppwp$rO@?osP@?oSP$rOp@?oeP@?oEP{cp@?otP@?oTP{Bp@?oqP@?oQP{!@@+Ppwppp(p$eP@@+Ppw@?+Pwppp{`@?-Pwppp{A@?*Pwppp{"@?/Pwp_pp(pwVOH[hX]I@_@@,^6@p(pO)AA@A@@@@AOH[App<w|Oh]h]I@_@@,^6@p(pOO@<@%<@G <@ {9<@${2O4p$rOp$rOD3p$r<$}T(p~@<@Kn@<#@Wg@@$o@,y@p(pwO^h,]p$ro@pp@@Pppp<K$^p(]p$^p(p$^ppI@@AAHH@Pp(pw O4p@?'PVI@@AAHH@P,G@p(]p$r(pw O4p(pw<w$Vp@?'Pwfpp@?(PwPFFF p AQ@@<p p+@*?)<w @+Ppwp @@Pp{{(pw$d@+Ppwp(pw"AQ@A+@? @w p{{(p@@o{PpppAAHX@@Qppp+@w$gd@@<@Ow p@@Ppo@p,y@ p( pw!O`,]p$r ,~,| pzQp(p@@o}Ppp@@ Ppp@@Pp$Vp(pw2,3@p(]p$r(pw O4p<w$Vp@+Ppw[<?<8<1O`I@@AAHH@P,]p$rppp$e,@p(pwh@PA@@+@w4@?-P(@?+P@?.P@? P{,9{@<@wp,-@pAp<wh@<w <w@@@pGH<w<wGH,8 @GAHGpHp@_@*@w$Vp< <{G(pwp,(@w#O`,]p$r@<@C$?p@<&@_$?p@@$appp$Vpp,@pAp,D@A, (@p$Vpp,P @pAp,D@A, (@p$Vpp,@pAp,D@A, (@p$Vp@(p (p@@p(pwpH, (@, (@HH,D@pAp$Vp@(pw (pw{@@p(pwpH, (@w, (@w{HH,D@pAp$Vp@@@p,D@pAp$Vp@@@p,@pAp,D@A, (@p$Vp(p%, (@p{<p$Vp(p%,(@wp{<wp$Vp(p5,(@Cppp{<Cpp$Vp(p5,(@Gppp{<Gpp$Vp(p5,X(@Kppp{<Kpp$Vp(p5,|(@Oppp{<Opp$Vp(pw p{wp(pC7(pw#O`,]p$rpp pp(pO p{(p@@@p,D@A, (@p$Vp,D@A, (@>,|(@O&O?,@pAppppp$Vp,D@A, (@>,(@C&O?,P @pAppppp$Vppppp$Vp,|(@O(O?,@pAp{>,(@C&O?,P @pAppppp$Vp@p(@C@@@p,(@C$,P @GAHG@HA{ @A@pAp,D@A, (@p$Vp,D@A, (@p(p0,|(@Opp{<O p$Vp,D@A, (@p(p0,(@Cpp{<C p$Vpp,D@pAp,D@pAp$Vppp$Vppp$Vppp$Vp<OO`Z,]p$rp<%w p{:@(p (pw{(pw(pw{@@p(pp{(pp{O`h,]ppz(pw ]p(pw$ r pAA@A@@@@ADA(Qp7AA@A@@@@ADAQh,B*(@ p{ p( pBDhk,@p(pCOah,]p$r(pw$q,\ޓ<@OtHX@p,,dk@p,\^@HXp(pw|C@@AA@OPX@Pp(pw O4p{OaZ,]p{W,,dk@p(pw|C@@AA@OPX@Pp(pw O4p$r(pH(p@(pw@@p]p(p OD3@{ O#W@@p$r(pX(p5, (@@A{ O?@A@pAp,@p{4<-(p@(pw@@p,!@pp(pw O4p(]p$8u(pw$8u pp@+Pp0 @ p+Pp p{<]O ]p{p]@@AA@]@cpO],OFc,OYcI@@@,Olc\@(\pw O4@@,Oc`@(`pw O4@@,p@@AA@I@@AoXA(Qpw$@@AA@I@@AoXAQ@Pp@@AA@I@@AoXA(Qp @@AA@I@@AoXAQ@@{ O4@@pApA@O4Oy><,NÂ@AAYp(ACY@{A,\@AAdp(ACd@{*Yp䒀p@{Oe,@{L IH_LLYpdphp(ZpCO4Oy><,NÂ@AAYp(AC Y@$񣃀Y@<@K\@<@WT@@$xpOĢOi,$񣃀OȢO j,$񣃀O̢O5j,$񣃀@$񣃀OO[j,a$񣃀OТOj,I$񣃀Oj,OEO4OE<,NÂ@AAZp(AC Z@$񣃀,\@AAYp(AC Y@$񣃀Z@{ Op>@{ Oy>@@,O\r($p O3@{ O3@@,H@(Hpw YA8@@dp@pOyrd,@AoWA+AOr@@,Or,Or(pp @{*@@,p@(ppw YA@@,f`Or(tp @{*@@,t@(tpw YA$@@,f`(@ p@{@@hphp8@@<@hO,\(@w @${hpOs(xp @{*@@,x@(xpw YA(@@,f`hp8@@<@hO,\(@w @${hpO.s(|p @{*@@,|@(|pw YA,@@,f`hp8@@<@hO,\(@w @${hpOIs(p @{*@@,(pw{@(pw YAT@@,f`hp8@@<@hO,\(@w @${hpOds(p @{*@@,@(pw YAX@@,f`hp8@@<@hO,\(@w @${hpOs(p @{*@@,@(pw YAL@@,f`hp8@@<@hO,\(@w @${hpOs(p @{*@@,@(pw YAP@@,f`hp8@@<@hO,\(@w @${hpOs(p @{*@@,@(pw YA\@@,f`hp8@@<@hO,\(@w @${hpOs(p @{*@@,@(pw YA`@@,f`hp8@@<@hO,\(@w @${hpOs(p @{*@@,@(pw YAl@@,f`hp8@@<@hO,\(@w @${hpOt(p @{*@@,@(pw YAp@@,f`hp8@@<@hO,\(@w @${hpO!t(Ģp @{*@@,Ģ@(Ģpw YAt@@,f`hp8@@<@hO,\(@w @${hpOo@hp<Th hTp<h ֐,>o@hp<<hh@@Hp@@p@<p䒀p@$O\3O4OH3<,NÂ@AAdp(AC d@$,\@AAhp(AC h@$dp(tpu<dw@X@oBPp@X@@Pp{ @Xd,!@_,oSO1|@XO4,⸇@@!p@!@${䒀p@$,\@$Z@<_,G6,FoFFppppAA{I<_,w7,F_nFFppppAA{ A_ A@?@_$̓Oē p((p$̃O$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @@@A @A@$̓O$p(,pK2<2,G,,AA pA p  pA A$t̓<_,O><_,G6,FoFF$p$(p$(p((pA(A{I<_,w7,F_nFF,p,0p,0p00pA0A{ A_ AAA4p @4@P@{ O|@@<,NÂ@AAdp(AC d@$,\@AAlp(AC l@$((pw$1σO$8p(,pK!<2,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_nFF@p@A@AAA8@A@{ 8@_ @gpO$Dp(,pK!<2,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_nFFLpLALAAAD@A@{ D@_ @gp${ЃO$Pp(,pK!<2,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_nFFXpXAXAAAP@A@{ P@_ @gpO$\p(,pK!<2,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_nFFdpdAdAAA\@A@{ \@_ @gp$܃OLM((p O|@{ O|@@((pw$ZуO$hp(,pK!<2,G,@@A@AAAh@A@{s<_,O1<_,G),FoFFlplAlAAAh@A@{<<_,w*,F_nFFpppApAAAh@A@{ h@_ @P@$)҃O$tp(,pK2<2,G,,AAxpAxpxxptAxA$%҃<_,O><_,G6,FoFF|p|p|pptAA{I<_,w7,F_nFFpppptAA{ tA_ A@?@_$ӃOēp((pw$ӃO$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @P@@A@A@$ӃO$p(,pK2<2,G,,AApAppAA$Ӄ<_,O><_,G6,FoFFppppAA{I<_,w7,F_nFFppppAA{ A_ AAAp@@P@{ O|@@<,NÂ@AAdp(AC d@$OLM((pw O|@{ O|@@((p$ԃO$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @@$ՃO$p(,pK2<2,G,,AApAppAA$Ճ<_,O><_,G6,FoFFppppAA{I<_,w7,F_nFFppppAA{ A_ A@?@_$|׃Oēp((p$փO$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @@@A@A@$w׃O$p(,pK2<2,G,,AApAppAA$a׃<_,O><_,G6,FoFFppppAA{I<_,w7,F_nFFppppAA{ A_ AAAp@@P@{ O|@@<,NÂ@AAhp(AC h@$,\@AAlp(AC l@$((pw$gڃO$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFF p A AAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @gPpO$p(,pK!<2,G,@@A@AAA@A@{s<_,O1<_,G),FoFFpAAAA@A@{<<_,w*,F_nFFpAAAA@A@{ @_ @gpO$ p(,pK!<2,G,@@A@AAA @A@{s<_,O1<_,G),FoFF$p$A$AAA @A@{<<_,w*,F_nFF(p(A(AAA @A@{ @_ @kpO$,p(,pK!<2,G,@@A@AAA,@A@{s<_,O1<_,G),FoFF0p0A0AAA,@A@{<<_,w*,F_nFF4p4A4AAA,@A@{ ,@_ @kp$܃O$8p(,pK!<2,G,@@A@AAA8@A@{s<_,O1<_,G),FoFF<p<A<AAA8@A@{<<_,w*,F_nFF@p@A@AAA8@A@{ 8@_ @gpO$Dp(,pK!<2,G,@@A@AAAD@A@{s<_,O1<_,G),FoFFHpHAHAAAD@A@{<<_,w*,F_nFFLpLALAAAD@A@{ D@_ @gpO$Pp(,pK!<2,G,@@A@AAAP@A@{s<_,O1<_,G),FoFFTpTATAAAP@A@{<<_,w*,F_nFFXpXAXAAAP@A@{ P@_ @kpO$\p(,pK!<2,G,@@A@AAA\@A@{s<_,O1<_,G),FoFF`p`A`AAA\@A@{<<_,w*,F_nFFdpdAdAAA\@A@{ \@_ @kp䒀p@$O,OLPO|O4<,NÂ@AAlp(AC l@$l@<@C$惀@<@_$惀@@$O`HHO|Ob<<,NÂ@AAdp(AC d@$,\@AAhp(AC h@$d4Γp䒀p@$OΓ,n@AA䒀pA@$O$Γ,n@AA䒀pA@$O|O4I@@@<,@AAhp(AC h@$(͓p͓,|͓p(p@+Ppw{͓p䒀p@${^,V@AAA,y@AA͓p(A&͓,~䒀p@${䒀p@$OMMO4OM<,NÂ@AAdp(AC d@$<dwvON\NO4OM<,NÂ@AAdp(AC d@$,\@AAhp(AC h@$d͓p䒀p@$$V<dwrON\NO4O3<,NÂ@AAdp(AC d@$,\@AAhp(AC h@$d͓p䒀p@${6,\@AAhp(AC h@$d͓p䒀p@$O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$l Γp䒀p@$O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$<<w"@@+@w{䒀p@$lΓp䒀p@$OLMO4OaL<,NÂ@AAdp(AC d@$,\@AAhp(AC h@$g$pg%pg&pg'p䒀p@$OLMO}O }<,NÂ@AAdp(AC d@$OLMO'}O }<,NÂ@AAhp(AC h@$,\@AAlp(AC l@$k(pg)pk*pg+p䒀p@$OLMO@O }<,NÂ@AAdp(AC d@$OLMO,}O }<,NÂ@AAhp(AC h@$,\@AAlp(AC l@$ghpkipgjpkkp䒀p@$OtMO4O M<,NÂ@AAdp(AC d@$O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$d@<@K<@<@W4@@$ l͓p{ l͓p{lΓp{ lΓp{䒀p@$O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$l(Γp䒀p@$$惀O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$(p((pO.},䒀p@$lΓpp䒀p@$O`GO4O3<,NÂ@AAlp(AC l@$,\@AAhp(AC h@$(p((pO.},䒀p@$lΓp䒀p@$OJ}O4I@@@<,@AAhp(AC h@$$(tp,O`GO4O4<,NÂ@hp{*OGO4O4<,NÂ@hphdp(dpC d@$<d$/O O4I@@@,@AAdp(AC d@$@+Ppw ppO,h)O,&䒀p@$,\@AAhp(AC h@$(tpHoSO(dp OD3@{ O#W@@O4,⸇@@!p@!@${*(dpO p{ p䒀p@$O,n@AA䒀pA@$@$Z@<<@$<<@G <(@9$o@hp<Th-hTp(咀pO<Th,䒀p@$Z@<@w$<@G (@$<@A$O,n@AA䒀pA@$Ok,@$O,O4 I@ @@<,~@AAdp(AC d@$,\@AAdp(AC d@$< lO <>lO{OdOZ,p:(@OOd,{O􌑀,{n(xpwhp{0,\P@AAYp(AKYHHHhp{,\|@hphhp(Xp (Tpw{hp(hpO,Od,(hpw(ZpwC<LAw:(@ pw{/(Zp O_@{ Om@@,A@dp@X@@Pp@X_DX,ODX,h){{{ {{ lYpz,|(pwD\,p<@O1,\θ@_DX,ODX,h)(pwOOw,h)L H IpppH$L(p$,pTYpXdp(0pw+_,y@AA0p(AwO,J0O_,<pw p<YG$5*d@@PA?-Qw$5*d@@PA?=Qw$5*d@@PA?+Qw$5*<pw$5*d@@PO|,(@w$)O,B*(@ O,B*(@w{$ppp$D)O,B*(@ O,B*(@w{$ppp$D)O¥,B*(@ Oǥ,B*(@w{$ppp{LOΥ,B*(@ Oӥ,B*(@w{$ppp($ptYp(YpOedpd@PHHHlpd@PA?-QwEd@PAAQhp+hp2h@@p(p_O ,$,{,d@POۥ,p:(@w$,$,d@PA?-Q$,d@PAAQhp+hpw$,hApA@<+@C$,+@(X!p+8pw,H{(X!pw+8p ,H,\`򈀄@Ypp+/pw$v/+;pw$v/(pwx(< pwo,\|(@KdO,Oϧ,O,O:,Ob,O,O,d< p(Pp,\|(@C,@@,R,\ᇀ(YpG$>1< <$>1(pw$>1DO䨑k,<@wKO䨑T䒀AA@A@@@@AXaA@@@,bO䨑,(pw$>1<w!((pw(\!pp$>1< dp(< pw(O٩,,`$;O,,`$;O2,$;< O_3@@+@S(po p (p+鑀pp@O鑀@PpO鑀,̌(@C{z{ ,\~x(hp p{ z3pp(pG$p<(|p^(ApwU(pwO(YpOHpOꑀY,~@$p($pCO,\Z@,p{ $Yp{{J(|pwE+p;O<@l$>OapOlI@@@<,@Yp$>OpOI@@@<,@Yp$>OpI@ @@,\@_,@pO,V@p@@<_@GI@ @@O_,{I@ @@O_,OI@ @@I@@@<,@Yp{O̪Z,@$K@(YpC Y@$K@<YwhOw(ph,V@$p($pO"$@h@p@AA?/Qw O(p@X_h(, @Xhph@?o|PHh_@X,@AAp(A(@(p@,V(@O @hpDXh_,DXhpO뤑lpO𤑀O몑l<,NÂ@AAYp(AC Y@$K@Ydp,\@AAYp(ACY@{rZ@<@/<@G <@ {Y<@8{Rhd,Z@AApA@{=hd,@AApA@{#hd,0@AApA@{@{L IppIL(Zpw OZpZ@+Ppw @$A,,Z@?o|PwBZAAAYpY@+PpY@? P{ {Yp{Y,@p$nA(tpepppp pppOppZO,@p{Z,@p(pwO Z,\Z@,(pOO\aZ_,{ \ap@{L IppI@{L IpppILp(Zpw OZpZ@+Ppw @$C,,Z@?o|PwBZAAAYpY@+PpY@? P{ {Yp{Y,@p$B(tpe,p0p4p8p@pDpHpOLpPpZO,,@p{Z,@p(pwO Z,\Z@,(pOO`eZ_,{ `ep@{L IpppI@{L IpppH(LI@@@,I@@@d ,IHHHdpd@@Ppd@@Ppd@@Ppd@@Pppd@@PpO񐀄d@@@ ,2@AAYp(ACOT@$UDOO`Y, :d@@? P dAAQ@{0@@pd@ @Pp pp Yp<YGY@O@dAYAQPpYp{%pO@{L H IppIL(Zpw OZpZ@+Ppw @$E(xptp ,,Z@?o|PwBZAAAYpY@+PpY@? P{ {Yp{ Y,@p$E(tpehplppptp|pppOpp ZOh,@p{ Z,@p(pwO Z,\Z@,(pOOP]Z_,{ P]p(xpw ,,@{L IIL @p(@ <@{OYp{OYp{ OYp{Y@{L IppIO,Oȳ,z@,O,z@,O֫,z@,O򫑀,z@,O,咀@<@C$4G@<@Wz@@$O%O򨑀,{ZO%O,{DO%O),{.O%O4,{O%O8,{O> @( pw OU@@,O\,<TwOv,{cO}(Pp O@{ O@@,(Pp1O(Tp O@{ O@@O,O( pw O@{ Oì@@,Oʬ,z@,O߬pAA@A@@@@AO`AQ,O, ,z@,O,L IpppILO(D @@AA@O@P,(pHOED @@AA@O@PAA@@AO$AQ,Oa,{5OE@@AA@O$@P,O~,O,Yp<YK$J<YO$J<Yw$J<Yw$J<Yw$J<Yw$J< Yw$J<Yw{yY@@AA@O@Pdp<PdC8OY@@AA@O@Pd@@AA@O$@P,{%OƭY@@AA@O@Pd,Ypz.O,L IpppILOխ,( pw (pw{VO񭑀Od< !< w (@ pw{ (pw{ O@{ O@@,$vKOO$Od(@ p <8w{< w O@{ O@{ O)@@,<8,\u@AAhp(AK{O,{H<_"wO3,{-<_wO;,{OAh,( pw (pw{OE,{ON,(@ pOT,{OW,( pw"(pwO^,\@,{O,(p,(@ p#( pw@@,"D@dp{@@,"D@dpOj(p Ox@{ O@@d,(@ pw$oM( p$oMd@Pp@AA+A@@,W@plp(lpG(X@(Xpw OU@@,{ROT,hp<lhC0Oih@@@h@@AA@OX@P,hp{˜ldpOr,(DpO,{K(@pwO,{2<@wO,{<@wO,O(Qp O@{ O@@,dp8@@<@dO,\(@w @$l{dpO(p O광@{ O@@( p O@{ O@@,dp8@@<@dO,\(@w @$l{dp(QpOOQQ,{OQ,dp8@@<@dO,\(@w @$l{dpOP,(pOO`,{Oh,OqQ@(Qpw OU@@,dp8@@<@dO,\(@w @$l{dpO(p6p O광@{ O@@(l6p<l6w O@{ OƵ@{ O@@,dp8@@<@dO,\(@w @$l{dpOʵ((p O광@{ O@@,O䵑,,dp8@@<@dO,\(@w @$l{dpOԢ@(Ԣpw OU@@,dp8@@<@dO,\(@w @$l{dpO@(pw OU@@,dp8@@<@dO,\(@w @$l{dpO@ܢ@(ܢpw OU@@,Oe(t6p<t6w O@{ O @{ O@@,(t6p+Ow(x6p O{@{ O@@,Oآ@(آpw OU@@,dpdp8@@<@dO,\(@w @$l{dpO,<QwO,{[<QwOζ,{B<QwOݶ,{)<QwO,{O䶑,dp8@@<@dO,\(@w @$l{dpO綑,(PO%O,{(O%O,{Od,hp8@@<@hO,\(@w $v{hpO( p O@{ O@@,hp8@@<@hO,\(@w $v{hpO̲@(̲pw OU@@,hp8@@<@hO,\(@w $v{hpOӻ @( pw OU@@,hp8@@<@hO,\(@w $v{hpO񻑀 @( pw OU@@,hp8@@<@hO,\(@w $v{hpO @( pw OU@@,hp8@@<@hO,\(@w $v{hpO- @( pw OU@@,hp8@@<@hO,\(@w $v{hpOK(@@pw 0@{ OU@@,hp8@@<@hO,\(@w $v{hp(p>Oi,hp8@@<@hO,\(@w $v{hpO!(!p O@{ O¼@@(!p Oͼ@{ Oּ@@,hp8@@<@hO,\(@w $v{hpO⼑,J@,hp8@@<@hO,\(@w $v{hpO,J@,hp8@@<@hO,\(@w $v{hpOX~,hp8@@<@hO,\(@w $v{hpO<\~,hp8@@<@hO,\(@w $v{hpOZ䒀@(䒀pw OU@@,hp8@@<@hO,\(@w $v{hpOx䒀@(䒀pw OU@@,hp8@@<@hO,\(@w{t{hpO,hphp8@@<@hO,\(@w{?{hpO,O,Oͽ,O޽,L H IppILOὑpAA@A@@@@AO`AQ,(pp$}Oｑ,(p$O,{"O5,OR,z@,(pOm,Ot,<wO,{O,Oɾ@@@@,Oྑ,O$$,O8,z@,O.@@@A@@,OE`(`pw Oa@{ O@@,On@@@@,(pO,{O,Oο@,O俑T,(pO,{O,O,\X,OEh,Ok ֐$֐,O,<TwOv,{cO}(Pp O@{ O@@,(Pp1O(Tp O@{ O@@O,O޽,pAA@A@@@@AO`A(@@Yp(@w OYpO,Y@+PpY,⮅O,{O,pAA@A@@@@AO`A,@@Yp(@w OYpO,Y@+PpY,⮅O,{O,pAA@A@@@@AO`A0@@Yp(@w OYpO,Y@+PpY,⮅O,{O,@X@Pp(p$@XO, :{@XO, :@X@+PpO5@X,O;@($ pw@@,z@,OL( pw Oa@{ On@@,O{, ,z@,z@,O(p O광@{ O@@,OX@(Xpw OU@@,O\@(\pw OU@@,O,O,O,Oͽ,(ppw$.O ‘,pAA@A@@@@AO`A4Yp(Ypw OYpO,‘Y@+PpY@{ OU@@,pAA@A@@@@AO`A8Yp(Ypw OYpOO‘Y@+PpY@{ OU@@,pAA@A@@@@AO`Ah@@<_@GOliO_ϑZ, :{OliO}ϑ, :{$Y AA@A@@@@AOXAQZp(xpC5,pOliTp(2pOliOϑZ, :$Y <(w|@(|pw O@@Tp$Y pxFFFdp(dpK>d@@AA@t@(Ppwxp{ d@@AA@t@PA+Qpwxp{{dp{<($t@PAATp(AT@+Ppw5{,pOliTp(2pOliOϑ, :$Y T,%@TpT@?o\PwTpT@PAAlp?%A$dTpT@PlpOTp+lpw3,pOliTp(2pOliOϑ, :$Y ?/l_k?9lWc(|CpCl@@AA@Olm@PTp{:|CAA@A@@@@AOloAl@@HH@A@@A_@AQTp$I?*lwl_ppOlitpOliTpOϑI@ot@@I@op@@,00(@C-,pOliTp(2pOliO Б, :{5l@AA+A _lpl@@AA@Olm@PTp(Tpw OTp$Y $?&l$`TI@ot@@I@op@@,(@C3,pOliTp(2pOliO'Б, :$Y tp,n(@OYotpt@@AA@O9@4,€@hp(hpChpOliO/ёh, :OliTp{ O8ʑTp<xG$llipI@_@@8,IF_FFp@?o\Pwp,pOliTp(2p$Oli_O2ёZOΑ, @?&P$Y @@+Pp*@@?o[Pw@@?o]Pw{$Y @@??P_,@@?oZPW@@AAQF FFPp@@PAAh,녀@AA|p(AC$Y ,p|@@AA@Oly@PpOliO/ёh, :(pʑpgp@@AA@pʑ@(Pp<@@AA@pʑ@P,|@@AA@pʑ@Ppp{pʑ,|I@_@@Oli,h@@@AA,y@pʑp(pʑpw$pC(@w$\,@p(pw?FlFFdpp(pCpp(|pw(pCp$(pCp(|pQ<O p@@p@FFFp(pC$Y FFFpX@@Pp{*FFFp(pCp<K$Y {,pZ,OliTp$Y (pw$(|p@?o^Pw |pp(|pw(pCFFFppp(pK>X@@@䒀@@AA@8@P,,(@w p{(pC p{p{GX@@@䒀@@AA@8@P,,@p(pO p{58|䒀@@AA@8@P,#@pOliO/ё, :OliTp$Y (xpG$Y <xGT4_,$pp4,V@lp8,V@p<xO<,V{@@pl@@p@FFFdpdp<xOZ@,>C(@@,@p{8,p(2p$Oli_OΑZOΑ, $Y (dpO(lp (pw({T4_,T@_@Pp$4Xpd@dp(@G$8X䒀@@AA@8@P,B*(@w?(pp<{((pT<_,TpXp{T@XAQPpXpTpzrT@PpTAXHX@@QpXpTp+@{(pC6@@p@FFFppOliTpdp(pOz OliTp$Y 4@+Pp4,腀{ O@@\p\,>C(@v\,@Yp(YpK0<_YG)OliTpT@cPpTpT@PpOliTp{2,p(2p$Oli_OJёZOΑ, {,pZ,$Y 4,V(@O1OliTp4@PYpTO/ёY@_@@, :{ OTp$Y (xpO+OliTpTO/ё4,V@, :{ O8ʑTp$Y 4@(4pw O@@XpOliTpX@+PpKX@PA@@+@X@PAA,VTA@Qp{T@XAQPpTpXp{T@PpOliTp$Y 4@+Pp4,腀{ O@@\p<xG$18@+Pp8,腀{ O@@`p\,>C(@w$"`,>C(@w$"\,@Yp`,@dp$@<@ <@G <@ {o<@{h4@d@p@FFFXpYpC(@w$0\,@p(pG$.OliTpT@Pp4,V@hph@@<_@OJ,p(2p&Oli_OeёZOΑ, { lipOliTp$Y (hpOTYp<YCD4XpdpC(@9\,@p(pCp8,V<@O$\ń{,pZ,d$Y YpO8ʑTp8FFFXpX@+Ppw$[ńX@Pp䒀@@AA@8@(Ppw-@AA+A@@,W@pdp4p@+Ppj@Pp䒀@@AA@8@(Ppw-@AA+A@@,W@p?wdp{ p{(dpw)OliO/ёY@@@, :OliTp{ XpYpzp$Y (xpG$ńp<xOl8,>C(@'8,@FFFp(pCp{8,p(2p$Oli_OΑZOΑ, $Y 4@@@,@τ@Tp{ OTp$Y (xpG$Y 4,V<_@O$Ƅ4XpOliTpX@+Pp^X@PAA@@AAA pT@ AOAQPpTpX@PAAA pXpT@ AOAQPpTp{T@PpOliTp$Y (xpG$Y 4,V<_@O$'Ʉ4XpOliTpX@+Ppw$Ʉp<O$Ȅ@@AA@I@@A_AX@PQpXp@@AA@I@@A_A(QpwOTp$(Ʉ@@AA@I@@A_AQ@O@PAA+A>@@AA@I@@A_AQ,WAAHHAIAAH_H@Xp@@AA@I@@A_AC(@9X,@p(pCp4,V<@O$˄{8,p(2p$Oli_OΑZOΑ, $Y 4FFFXpX@+Ppw$˄(p$˄X@Pp䒀@@AA@8@(Ppw-@AA+A@@,W@p8@(8pw O@@p@+Ppl@Pp䒀@@AA@8@(Ppw-@AA+A@@,W@p?w p{ p{(p{T@XAQPpXpTpzT@PpOliTp$Y p(xpG$Y <xO|<@(C(@!X,@p(pCp{8,p(2p$Oli_OΑZOΑ, $Y 4FFFXp<xG$̄8,V(@G$̄4,V<@O$̄X@+Ppw$̄8pX@Pp䒀@@AA@8@(Ppw-@AA+A@@,W@p pAQ@@pp+@[䒀@@AA@8@(Ppw-@AA+A@@,W@p?w  p{{( pw{T@XAQPpXpTpz T@PpOliTp$Y $@<-@C$҄-@< @_$҄@@$ؑ(xpG$Y 4,V@AAlp(AG$τ<_lO_lpOёXp<xO8XpX,V@p(pGOёXpp<-($΄Oli4_,lFOkiFFTpC(@w,pZ,6$Y \,@p(pCp4@@Xp@,V@FFFhp(hpChpOliTph@hp(@OT@XAQPpXpTp{T@PpOliTp$Y ppOё pOёpOliTpT@Pp4@@Xp(@w$Y X,V@AA p(AG$Y Pp<xG$:ք8@+Ppw$:ք8,>C(@w$:ք8,@p(pC?ppp<O$քĩ@@AA+AfX@ AA?QPwQ @X@p@AA@@?PQw1OliX@@@_, @Oji@Pp$Y p$ՄOliX_,$Y 8@PPp+Ppw X@PPp<xO<@+Pp <@PpX@?PP$ׄ+p$?ׄP@<<@U<<@G<'@[<'@G <"@I{_<(@ {Xp{P"p{H'p{@'p{8<xw Pp{*OliX ,: @Oli@Pp$Y @X@p@AA?Qw6OliX@@@ @@@,: @Oji@Pp$Y OliX ,: @Oli@Pp$Y 4,腀@\p\@+Ppw,pZ,$Y Oli<>(w Oґ@{ Oґ@@\,l @, :<>(wC(@w8,p(2p$Oli_OΑZOΑ, $Y 4,@ p( pOh@ @@ p{( pw p{ @hA@AA pOliO/ё , :OliTp$Y $@C(@w/,pOli_OΑZOΑ, $Y H,@p p( pw~OΑ\p<xO0@+Pp0,腀@\p\,>C(@w/,pOli_OΑZOΑ, $Y \,@p$B܄<xG$B܄0@+Ppw$B܄I@_@@0,,p(2p$Oli_O2ёZOΑ, ?&穠$Y +穢p?o[穢w?o]穣w{$Y ?o@穡_?oZ穡W p?o`穡_?oz穡W{$Y plip,pp<xO <$p<xO @(p<xG$܄D8p(8pw O8ʑ8p8@+Ppw O8ʑ8p8,>C(@$8,@p<w op{8,p(2p$Oli_OΑZOΑ, $Y ,$( ,bI@4p(4p 4A@{@@p(pCK,p(2p7Oli_<w OБ@{ Oґ@@ZOΑ, $Y ( pw$ބOli,!@_,(pw$ބ@@,녀@AAp(AC8,p(2p$Oli_OБZOΑ, $Y p<p<<GS@@AA@Oly@<AAHHFPFpF@@4@<AAHHFPFpF@P,h)<p{@@AA@Oly@PAQp@@AA@Oly@POli,h){:4@PAAQ<p(<pw O<pOli<_,$Y $@ґZOΑ, OliTp$Y <xG$㄀8Xp(Xpw OXpX@+Ppw O8ʑXpX,>C(@wA,p(2p$Oli_OΑZOΑ, OliTp$Y X,@ p( pT , @TpPw{$Y @@Pp@@AA@|@@@@@,h)(xp:@@AA@x@@AA@A@@@@ADA,h),V(@C$Y pzOliO/ё, :OliTp,p$Y <_(w>p(xpO"OliTpOli4_,{ OTp$Y <_(<_($O8ʑTp(xpG$Y 4<_(w@{@@ ,>@Tp(Tpw3(2p$Oli_OJёZOΑ, $Y ,pOliT_,OliTp$Y <_($O8ʑTp(xpG$Y 4XpX,V<@8,p(2p$Oli_OJёZOΑ, $Y OliTpp<O$p<O$@@AA@I@@A_AX@PQpXp@@AA@I@@A_AQ@O@PAA+A>@@AA@I@@A_AQ,WAAHHAIAAH_H@Xp@@AA@I@@A_AT@PpTpX,AAHHAIAAH_H@XpTXp{8,p(2p$Oli_OJёZOΑ, $Y pzbX,@pTO'ӑ, :$Y <_($,pOliTp<xG3(2p$Oli_OБZOΑ, $Y 8,C(@<,C(@w5{(2p$Oli_OΑZOΑ, $Y 48,@<,@,>@Tp(Tpw3(2p$Oli_OJёZOΑ, $Y ,pOliT_,OliTp$Y <_($ppOёpOёp,plipI@_@@4,IF_FFpI@_@@I@_@@,H@AAp(AC3(2p$Oli_O2ёZOΑ, $Y OliTp@@AA@O9@Pp(pCp<O p(pC p<O p,p(pG$Y Op<xO(8p8@+Pp 8pptppup<xG$M<p(pw O8ʑp@+Ppw O8ʑp,>C(@,,@p(pK C(@@,(@Op(pwOpp{,V@ppp<O$@@AA@Oly@AAHHFPFpF@Pp(pw Opp(p4pAQ@@pp+@? 穼w p{{ؠ,V@p((pw(pp(pw$pp@@@,y@AAp(A\@@@I@_@@I@_t@@, I@_@@,h),|ppp(pOOli_,@p<Cp(pw@@+Pp5<C,Oli_,@p<Cp(p8,p(2p$Oli_OeёZOΑ, $Y pz$Y <_($ppp,pOliTpT@Pp(4pw$Y 4,V@p(pw$Y <_O8,p(2p$Oli_OeёZOΑ, $Y (8pw4Oli_,$Y IF_tFFpIF_FFpp<_GEI@_t@@AAQpI@_@@AAQpI@_@@AAQpp{pp<O$I@8@AAHH@Pp(pw Op@@AA@I@@A_AQpppAQ@@pp+@w$<_O$@<@C$@<@_$@@$ۑ@@@PpppzP੘ppz??-穼8,p(2p$Oli_O8ӑZOΑ, $Y pzppz?o]穼8,p(2p$Oli_O8ӑZOΑ, $Y php<hG#<_G@@kPpphp{ڀpppzfzcpzpp<_GWI@_t@@AA+QpAI@_t@@AAQhpIA_AA@h@pIA_AAHHXPpp{4pp<CI@@PhpI@_@@AhA+Qpw{T@pIA_AAHhHXPpTpp{T@PpOliTp$Y <_(whp(xpO4,I{ O@@TppOlipATHX@@QpTpp+@{OliTp$Y <_($(4p44@+Pp4,腀@H{䒀,!@HH\p{䒀,!@\p,p<xOx8@+Pp8,腀{ O8ʑ@@`p\,>C(@`,>C(@w5{(2p$Oli_OΑZOΑ, $Y {䒀,!@\pO8ʑ`p\,@p`,@p(pK<䒀G{3(2p$Oli_OJёZOΑ, $Y ,pOliTpAA@A@@@@AXaAQp(p(Oli,!@_,$Y @<@@<@G (@$<@w$$OliOLӑ_,$AA@A@@@@AXaA@@AA@Oy@Pp_Oli,(@wOli_,{KOliAA@A@@@@AXaAHH@H@@@@AOloAQ_,{$Y <_($w4H(4pw ,\ C@HHp8H(8pw ,\ C@HHp,4@Tp(Tpw;,p(2p-Oli_OUӑZOΑ, OliTp$Y <_($p,pppOliTp4,Bڂ@p(pRI@_@@,8,Bڂ@AAp(A I@_@@,p(pw4,p(2p$Oli_OUӑZOΑ, {XI@_@@I@_@@,p:@p(pO p{(pCpOliO/ё, :$Y <_($ OliTp,p4,Bڂ@AAp(Aw$ I@_@@,I@_@@,I@_@@Ohӑ,I@_@@,Bڂ@AAp(AI@_@@,I@_@@I@_@@,4@AATp(A]I@_@@T ,I@_@@,Bڂ@AAp(A%,pOli_,OliTp(,p-(2p$Oli_OUӑZOΑ, $Y <_($ OliTp4I@_@@,Ղ@AA p(ACJ,p(2p6Oli_< w Ojӑ@{ Oӑ@@ZOΑ, $Y TOA, :$Y <_($] 4p(pw OpOliTpAQ@@pp+@N?:穼w@?o\PT@/PpTp{(?o\穼wT@/PpTp{T@PpTp{T@PpOliTp$Y <_($ 4p(pw Op@?o~Pwp@?/PwpOliTpAQ@@pp+@$T@Tp?/穼 A{o\AAPp{ȄT@PpOliTp{`<_(w'4(8p 8AQ@{=@@,͕@Tp{3,p(2p$Oli_OӑZOΑ, pphpQ-Oli_OӑZOΑ, OliTp{-Oli_OӑZOΑ, OliTp(2p |ʑp(2pOӑT,{ O@{T@{L H G F IIL,\\@YpO(ۑOAY, :O(ۑ@{L IF8L(Zpw OZpZ,V@Yp(2p@C$!>@NO,?=O,-=O ,=@hpO<,=O,Xw@{{@{L H IpppH Lhplp(tpw Otpptp@+Pp hpp{t@Pmpm@AA+Am@@,V@mp(hpG @$< xG H$9pxpp@@<@K$,p< GvAApA@@AAAA@@@@HHH@H@@@@AZAQ@Plpl@AA+Al@@,V@lp?mlS Hp{HpzrH?mlSHpx@@<@HK$HH@H@@@@AZAQp(pw Op@+Ppw$C@Plpl@AA+Al@@,V@lp?lm$Ct,B*(@w H@$th,B*Yp(@wYpH@H@@@@AZApA@ @Pth,B*@dp(Yp (dpH@{W(Yp@{M(dpO@{CHzxAA@A@@@@AZApA@@Pth,B*(@w x@@{@{L H IpELdphpG(tpw OtpptE+Up dpE{t@PFF@AA+AF@@,V@Ft@@+Ppwhp(dpG @$U< xG H$lpxppl@@<@C~p< GtAlApA@@AAAA@@@@HlHH@H@@@@AZAQ@PGG@AA+AG@@,V@G?FGSHlp{Hp$lH?FGSHpZ,_(@C @$Hp(lp Z$,@$H{(pG @$H(ppdAA@A@@@@ADA(pAdAA@A@@@@ADA,|dAA@A@@@@ADAppdhp$h,||C@@AA@O@lAAHHGPGpG@@A_@AQp|CAA@A@@@@AOloAl@@HH@A@@A_@AQhp|CAA@A@@@@AOloAl@@HH@A@@A_@AQp{F? l_ ?olW{ @$&l@@AA@Olm@Phpl@@AA@Olm@Pp(hph,|hp{(lp Z,@$&Z@?&P$ZII@@@,(@C @$&oYpY@@AA@Oly@PAAp(Aw @$&Y@@AA@O9@|C@@AA@@@AOLXAA|C@@AA@OPX@P,h)|C@@(pwsO,pYp<kYCHYAA@A@@@@ADAQYAA@A@@@@ADA,(@C{Yp{@$݅pp<K$p@@AA@I@@A_AQp(pw Op@+Ppw$,(@w$pZp<kZCtZAA@A@@@@ADAQ,,(@BZAA@A@@@@ADAQZAA@A@@@@ADA,pZp{(pwZp{${!Dk,f̈́@Zpp(p @+Pp O @PAAp,{ڠO,$vȅYAA@A@@@@AO A<jYAA@A@@@@AO A<4LYAA@A@@@@AO As@@+@w ZZp{pw@@+@w ttp{@e{rC(@wI@_@@,h)@{x(Ypw @@{@@pI@@@,YAAHHAIAAH H@Xp{ pzYpzI@_@@,h)t@lPpx@Ppd@{L H G IppG_<Lt@xAQpPpZ,V@lphpYpC(@w%(咀pO),@{k{@{dI@_,@@,@AAdp(AC<(VpwO,(咀pO),@{{@{ x@dPp@{L H G IpppGLZ@@Phph@O@PAA+Aohpt@hPpx@Pp@$Z@?&P$ZI@@@I@ @@,@hp(hpC-C(@$,tA@Qp{<$,@$p$,>C(@w @{{$,tA@Qp@{L H IpppILZI,(@C@{)(xptYp{tYpZY,!@,Y@{L IGL(ZpC @$!ldp|Cp{~@$>~,V@ p<_ OOT~,@$>I@@@~_,pIHHHp?o\dw?%e ?&e{p@?%P@?&P$ =O~OQ,@AA~p(AC~@$>(pAODJhJOTO?J,NÂ@AAYp(AC Y@$>(YpO7Zp<~wVOTO|LO~,@AA~p(AC~@$>~,%@~p$=<~$=O~OQ,񅀄@AA~p(AC~@$>~Q,n(@C @$>OUO|LO~,@AA~p(AC~@$>$=(pAODJhJOTO?J,NÂ@AAYp(AC Y@$>(YpO7ZpO,UO|LO~,@AA~p(AC~@$>~,%@~p~@+Ppw!,䒀p@$><7Z _,Qdpd@dp(@OC,\\@AA~p(AO!~p<~,֎{{,8{(䒀pwzpOjO|LO~<,ƻ@AA~p(AC~@$ѐ0p@X~,%@_,{Oj,@$ѐz1,\@AA~p(AC~@$ѐ G@@AAHOhHX@{ Om@@ p @@PApAHoHH@H@@@ AAQHHAoA@GAGGp @PA HHX@AHAHHHHA@AA@A@@@@A_0A @@PHHAA@A@@@ AAQHHAoA@GAGGp @ @PApAHoHH@H@@@ A AQHHAoA@GAGGp @ @PApAHoHH@H@@@ A AQHHAoA@GAGGp @@PApAHoHH@H@@@ AAQHHAoA@GAGGpI@_ @@Om@@ @@@@@@@@, :IG_ GG p$ @P p @@P p @@Pp @@Pp-p @@Pp @@Pp-p @@Pp @@PpI@_@@ @@@,~IG_ GG pI@_ @@,V@p ppI,΀@p(t p`( pCY(p,I@_@@OmO n I, :{&I@_@@OnO n I, :{S(p*I@_@@On  I, :{$I@_@@O1n  I, :(| pw$O|LppII@_@@D@,®@p@<@KD@<@W<@@$oO?np{&ODnp{OOnp{OZnp{@+Ppw!( p OZn@{ O?n@@p@+PpGI@_@@,V@p@@<_@G I@_@@AAA,~(X pc(ipZI@_@@,V@p@i@p@AA<_AG(I@_@@AAAO_ni, :(L pw$I@_@@,V@` pT @<@$<@G(@ {'<@{ p GGGl p{l p{ l p{;T @<@$<@G(@ {&<@{p GGGl p{ l p{l pffl P ,;` p<f` K$cO9[` @@AA@f@P,f(8 pw$f@@<@` K(H pw$(<pOy` @@AA@f@P,V@p@A<Ap(A@@p` @@AA@f@P,V@A<ApA@@@< p{< p8@@<@< O,\(@w p$߬{< p` pz(H pw(D pw$ެcOn < w On@{ On@@$ <$ w O|L@{ Okd@@( <( w O|L@{ Okd@@,f( ,D@AO.A,@pApO@@,|(@O4cOnO@@,@A,f{>Oz?O{G,X(@KcOn,fcOn,fp<,AO,Ap,Ap,\PpTapTa@ PpTap(pOiO pO|LO~,ƻ@AA~p(AC~@$Ӻ򐀠O K,p:(@Op,@$ӺOpO|LO~,@AA~p(AC~@$Ӻ~,V@AA~p(AG @$Ӻ~@?o{PQ~@~@p@AA?o}Q4@X_OWp~OZp, @X~pO~OTaTa@DX@@_AA,,(@CO]p,@$Ӻ(pw$DOpk,@~p(~pC\OpO,<DOpk,@AA~p(ACOp,䒀p@$Ӻ$zDOpk,@~p(~pCXOpO8,<DOpk,@AA~p(ACOp,䒀p@{[~䒀AA@A@@@@AXaA@@@,@AA䒀pA@{Oq,@{L H IGLdphplp(Zpw O|LZpZ@+Ppw @$Z@PA@@+@Z@PApAGoGGdpZp{ @$Z@PA@@+@.dAZHX@AHAHHHHG@GG@@GoGGdpZpZ@?:PwZp{Z@+Ppw ${ @$Z@PA@@+@Z@PApAGoGGhpZp{ @$Z@PA@@+@.hAZHX@AHAHHHHG@GG@@GoGGhpZp<@<>@G <@{(@G<>@G <@$Zwk(QpJ,\P@Tp(TpC䒀p@$ņT@Q@<Q@w䒀p@$ņ{(~pw䒀p@$ņ$'ņ@X,p@Xp<PwpZw@(Qpw@@䒀p{@(~pw@@䒀p䒀@{L H G F IpppI L(䒀pG%Or|C,䒀p@$AȆ_,y@dp(dpw䒀p@$AȆdhp_Yp(Zpw O|LZpZI@@@I,00<@OdZpp(|CpG$udž|CAA@A@@@@AODoA(Qpw$udž䒀AA@A@@@@AXaA<Q$udž|CAA@A@@@@AODoAQOr,X(@w$[dž|CAA@A@@@@AODoAQOr,X(@h|CAA@A@@@@AODoAQOr,X(@6|CAA@A@@@@AODoAQOr,X(@w{oU, ,\F,\Fz(lpgZ@+Pp2Or|CAA@A@@@@AOloAQZ,{.Or|CAA@A@@@@AOloAQ,,\F(Zpw O|LZpZ@+PpwZp|C@@AA@@@AOLXAAZ,h)d,|䒀p@{L IppILhpOJJO sO|L<,NÂ@AAYp(AC)I@_@@O vO|LO|L<I@_@@,I@_@@O|LO|LO|L,I@_@@,@~p(~pC$熀<$K܆,\֐@lp@<:l <=l{@@p(@0,\ꐂ@AA+AwOR,~p$熀(pw0,\ꐂ@AA+AO(R,~p$熀p@<@C$&܆@<"@_$&܆@@$tz(,IG_GGZpZ@?:P :pZp(pwO(pwIZ@@?.PZ@@? PZ@@+Ppw#{O{Z,䒀p@$^(䒀pw"O0{ ,䒀p@$^Z,V@lp(䒀pG$J䒀AA@A@@@@AXaA<Q$;pIGohGGpI@$@@I@_@@I@_@@,00I@$@@I@oh@@?,p(p p$B(pC(@Ta,@p{@Ta, 酀@ p ,>C(@ ,@p{ @$ O|O|LI@ @@<,ƻ@dpC(@p,@|p{@p, 酀@ p ,>C(@ ,@|p{ @$ <6HX HX@{@@p@<|C < ^{<| <*L{<|G <:{<|w <({<|K <{<|O< {@@hp<6HXw Qp{ Qp$O|O|LI@ @@,ƻ@YpC@hpQp$O|O|LI@ @@I@@@<,@AAhp(AC h@$ I@ot@@l,nՀ@,O|O|LI@ @@I@@@<,@AAhp(AC h@$ l,nՀ@pI@ot@@,V<@w,V<@w{O},@$ HI@ot@@,p:(@OHHhpQp$Qpdhp$Qp(CpO?/C_?/C_{ hp$@XO|L, @_,@Xlpl@@Pp@XOC,X@hp(hpw6@X@ @@,°@HOC,l <@HK@{@@hp@X@Pphhphhp$OOPO}O|L<,NÂ@AAYp(AC Y@$ <_'Y <Y{,\|ᇀ@(咀p@@hp{]<_"Yw&(@ p,\|@AA@@@{@@hp{2<_aYw@(p@@hp{Y,hp(@OhpQp$hp$hp$hp$O'}O|LI@ @@<,ƻ@Ypp(p (pOzZp$@PpOĮ,腀@,@hph@{L H G IpppH,LZ,@hp(hpC h@$1<-Zw[,\0@p(pw O|Lpp@+Pp$@? P@? P{p{{{ք@?o{PwoJZpZ@h_@<@w$@<@G(@w$>$K<@w$B<@w$ >$K<@w$B<@G< @w$xA< @w$K=$K<@w$C<@w$>$K<@w$H<@G<@w$E<@O$3G$E<@w$K<@G<@w$%I<@w$J$K<@w$fJ<_ '@w$FJ$KON˒Of˒ O䒀<,~@AAȲp(ACȲ@$K<䒀!<䒀Oh˒,@$K,\@AAȲp(ACȲ@$K<䒀w o4 p{<䒀w _4 p䒀p@$K,\$KO5䒀p{O|䒀p{O䒀pOO˒䒀<,NÂ@AA䒀p(AC䒀@$K,\@AA䒀p(AC䒀@$K䒀p䒀p@$KO̹𹒀O˒O<,NÂ@AA䒀p(AC䒀@$K,\@AA䒀p(AC䒀@$K(ZpEoSO˒䒀@@,!@O5,⸇@@!p@!@$K{PpAA@A@@@@AO`A䒀p䒀p䒀p䒀p@$KO˒,!@ O䒀<,~@AAȲp(ACȲ@$K,\@AA䒀p(AC䒀@$K(ZpAoSO˒䒀,!@O5,⸇@@!p@!@$K{䒀p䒀p@$K(Zp O@{ O@@(Zp ඒ@{ @@O˒O<,NÂ@AA䒀p(AC䒀@$K,\@AAȲp(ACȲ@$K䒀 p䒀 p(ZpAoSO˒䒀,!@O5,⸇@@!p@!@$K{䒀p@$KOȸ(O˒O<,NÂ@AA䒀p(AC䒀@$K,\@AAȲp(ACȲ@$K(pO ̒,@$K䒀ppAA@A@@@@AO`A䒀p(ZpAoSO.̒,!@O5,⸇@@!p@!@$K{4(pw 8 p<w 8 p䒀p@$KO8 ,؄@AA䒀p(AC䒀@$K(8 p p{ p䒀p@$KOHO5O𵒀<,NÂ@AAȲp(ACȲ@$K,\@AA䒀p(AC䒀@$K(Zp^oSO2̒(Ȳp<Ȳw OÒ@{ O6̒@{ O1ɒ@@O5,⸇@@!p@!@$K{Ȳ| p䒀p@$KO8̒O5I@@@<,@AAYp(ACȲO{o@Ȳp<䒀Ȳ:ȲTp(pw%(咀pOђȲh,ȲTppAA@A@@@@AO`ATpȲPpo@Ȳp<<Ȳ.(pw%(咀pO]ҒȲh,{䒀Ȳp<p <p{=<_䒀2<_䒀'OҒ,ODҒ,@$kȲ@@Hp@@p@<pLppAA@A@@@@AO`AL ppAA@A@@@@AO`A<p(咀pj(ppwa(pwXӒOÒ I<,~@AAȲp(ACȲ@$k(YpGO*ӒY,@$kOWӒO1ɒ I@@@<,~@AAȲp(ACȲ@$k,\@AAȲp(ACȲ@$k䒀p䒀䒀pp䒀@@p@p(pYpdp䒀p@$k< Zw2O@O5O𵒀<,NÂ@Ȳp{0O쵒O5O<,NÂ@Ȳp(ȲpCȲ@$k,\@AA䒀p(AC䒀@$k< Zw5Ȳ ppAA@A@@@@AO`A $p{3ȲppAA@A@@@@AO`A p䒀p@$kOpӒO1ɒ O䒀<,~@ȲpO䒀䒀Ȳ_:,ĺ@AAȲp(ACȲ@$k䒀$p䒀p@$kȲYp_,y@hp(hpwOӒ,@$kpdp<_dG)d@@AA@h@dAAFFAOӐAQPpdp{p0&p<5Yw OӒ@{ OӒ@@O5 OȲ<,~@AA䒀p(AK$c0&p<䒀w$d<䒀$c(hph,|hp򐀠O,B*(@^򐀠OӒ,B*(@B򐀠OӒ,B*(@&򐀠OӒ,B*(@$c{,\@AA䒀p(AC䒀@$kpȲp<_ȲGPȲ@@AA@OӐ@ȲAAFFAOӐAQH<5Yw HAA{HAAAPpȲp{<5Yw Ӑph!?o|hOؒ,@$pdp?>hwd@?>Pw dph!ppd@? Pd@? P{dp{d@+Ppw2O&ؒ?>hw O3ؒ@{ O<ؒ@@,@$p?>hw%d,஀(@CODؒd,@{Y`!p@?o|hw@@d!p(d!p(wYhp{?o|wYlpYp{(hpK$r(lpK$r(@ p$r<גU<גL<גC<ג:<ג1<ג(<ג<ג<ג <ג{6Oג,(`pOؒ,@$t,%@pZ@Pp@$t`!pYpwY@@p@AA?>Qw h!p@Y@h!AA@HAHHp@? P@? P{p{@+Ppw3O&ؒ?>w O3ؒ@{ O<ؒ@@,@$t?>w',஀(@CODؒ,@{sOl!,h)@Y@p@HHHp<_!@? P@? P{ p{܄@@Pp,%@pZ@Pp@{L H IILYpdphplpp(@ p( p&,\|(@K{Oؒ,@$yOؒO5O䒀<,ƻ@AA䒀p(AC<䒀䒀@$y䒀,V@Ȳp(ȲpG$vȲ@@@,y@AAYp(AwOؒ,p$'y{Y䒀,~OؒO5O䒀<,ƻ@AAp(AC<$'y䒀,V@Ȳp(ȲpG$vȲ@@@,y@AAdp(AwOؒ,p$'y{d䒀,~OؒO5O䒀<,ƻ@AAp(AC<$'y䒀,V@Ȳp(ȲpOLȲ@@@,y@AAhp(AwOؒ,p$'y{h䒀,~O䒀,@AAp(AC$'y(Yp$ yppOdB_,lpOؒ,j@@,R,<,p䒀p(䒀pC/,\O5O5O䒀,@䒀p{̠䒀,V@Ȳp(ȲpGOْ,$'yȲ@@@,y@AAYp(AwOؒ,$'y{Y䒀,~Oْ,j@@,R,<,p䒀p(䒀pC8<䒀/,\O5O5O䒀,@䒀p{à䒀,V@AAA,y@AAdp(AwOؒ,{T{d䒀,~Oْ,,\@AAp(AC{oIYdh,⸇@@!pp(lpOdB,j(hph,|hp(dpd,|dp(YpY,|Yp<O(@ p<O ,\~x@{L IpppH_TL`!pd!ph!p(ZpC Z@$Zגp<ZwlO,O5O5<,NÂ@AAdp(AC)OᒀᒀO ᒀO<,NÂ@AAdp(AC d@$ꚇ{O3ؒ(dpw O-ᒀ@{ O:ᒀ@@I@ @@<,@䒀p(䒀pC䒀@$ꚇ<䒀wOFᒀl,@$ꚇl_@X,@AAp(A(@(p@,V(@O @lpDXl_,DXlpO𤑀OfᒀOrᒀ<,NÂ@AA䒀p(AC 䒀@{Z䒀hp,\@AAYp(ACY@{;Z@<@{%<dwlh,@AA䒀pA@{{䒀p@{L IpppILpOdB_,Z,j@@,R,(咀p<,,\Yp(YpC+O5O5O䒀,@Yp,\{Ԡt䒀x,OdB,j@{L IpILppOdB_,Z,j@@,R,(咀p<,,\dp(dpC+O5O5O䒀,@dp,\{Ԡt䒀x,Oْ,OdB,j,p@{L IppI LYpdp(pOᒀ,䒀p@$kOᒀ,Oᒀ@(pw Oᒀ@@,Oᒀ~,Oᒀ@(pw Oᒀ@@,O⒀Y@(Ypw Oᒀ@@,O"⒀@(pw Oᒀ@@,hp<hG>h@@AA@O@(Pp(O"⒀h@@AA@O@P,hp{O>⒀,OZ⒀撀@(撀pw Oᒀ@@,Ov⒀L撀,O⒀d@(dpw Oᒀ@@,O⒀0@(0pw Oᒀ@@,O⒀@@,O⒀~,O㒀|,O㒀4!,O:㒀,OV㒀@(pw Oᒀ@@,Or㒀~,O㒀 ~@( ~pw Oᒀ@@,O㒀4@(4pw Oᒀ@@,O㒀8,䒀p@{L IppIolLYpdphplppppp(Zpw O5Zp(tpw O5tppZ@+Pp t@+Ppw{(|pOdB_,YpZ@+Pp$(|pw @$Oؒ,j@@,R,,\|(@G$٠,섀@dp(dpC,( pp<_dwig@@X8O섀,@dp(dpC$d@<@K8@<@W1@@$䒀X8p{X8p{+8pw{$zY(咀p<,,\dp(dpCaO㒀O5O䒀,@dpO,$+O,$+O ,$+O%c@@+@ OF@{ OI@@,OMc@@+@ OF@{ OI@@,Onc@@+@ OF@{ OI@@,Oc@@+@ OF@{ OI@@,Oc@@+@ OF@{ OI@@,Oc@ @+@ OF@{ OI@@,L IIL IpppIL IpppI(Zpw O咀Zp(lpw ,\VZ,썀@@@,(L IILZ,V@Yp(@ pw5,Z(@'< (wO!,!{O!,1{n(tp9AA@A@@@@AO"A @ @+@w?+8 @$n(pZAQ@@@{@@<pAA@A@@@@AO"A @@+@(pw @$n{8AA@A@@@@AO"A @@+@w(p @$n@<@C$e@<@_$e@@$2O#<$I@_@@,2@ p( pC @$n ~p$j<_I,(@I<pO ~<,h)$jO#<$I@_@@,2@ p( pC @$n ~p$jO#<$I@_@@,2@ p( pC @$n ~p$j p<@+PpR<@?/P_<@?7PW{ @$n @@AA@o@<AQHp@GHGG p<p{ ~p$j<_I,(@I<pO<,h)$j<_I,(@I<pO<,h)$j<_I,(@I<pO<,h)$j<O,&O<,h)$jO#<$I@_@@,2@ p( pC @$n p$jO#<$I@_@@,2@ p( pC @$n 8p$j<_I,(@I<pO4<,h)8p$j<_I,(@I<pO4<,h)$j<,C(@w @$n<,@p$jpp$j<_I,@AA@p(A0O撀@@,h)O撀I,h)L撀p$jO#<$I@_@@,2@ p( pC @$n L撀p$jO2,@+PpO2,O,(pw < ({{3{,pppp{@{@{L H G IpH_LO\3(4OPOP<,NÂ@AAdp(AC d@$ (dpw{Ol8,N$6X@P,Vz,\@AALp(AC L@{T@Y@?*Pw-Y@T@p@AA?*QwT@Y@PpYp{(p (pw{O9,@{hT,@AAdp(A6򐀠_dOd, ,\^Vp@{{OfT,@{L IpIoLLYpI@@@OO@O@䒀@@AA@@@AO~AA,\@,h)T,j䒀p@{L H IF_LZ4Ap@<4A9Z OO@OT<,@AALp(ACL@$߈(,\@AALp(ACL@$߈hp䒀p@$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw ,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw,y$߈<_Zw@,\@AALp(ACL@$߈,݇䒀p@$߈<_Z$6وOO OL<,~@AAPp(ACP@$߈,\@AACp(ACC@$߈L,@AA䒀pA@$߈<_Zw,\$߈<_Z$و(pX(@ p!@@+@w{(@ pw!@@+@w{ (pw{O,@$߈<<w"@@+@w{䒀p@$߈,\`,$߈<_Z$ڈ,\@AALp(ACL@$߈DOyEk,@LpL䒀AA@A@@@@AXaA,@AA䒀pA@$߈<_Z$ۈ,\@AALp(ACL@$߈DODk,@LpL䒀AA@A@@@@AXaA,@AA䒀pA@$߈<_Z$ۈ,\@AALp(ACL@$߈DOGk,@LpL䒀AA@A@@@@AXaA,@AA䒀pA@$߈<_Z$&ވOP\t\OяO@<,NÂ@AALp(ACL@$߈L@<@w$݈<@G(@w$݈$&ވ<@$&ވOߏO@ OC<,~@AAPp(ACP@$߈CpO폓O OC<,~@Pp(PpCP@$߈Cp,\@AAPp(ACP@$߈(pK (pK{O,@$߈(8pO<8O 8p(<pO<<O <p,n䇀@PpP@@@@AA䒀pA@$߈,\@AAPp(ACP@$߈,\~䇀@PpP@@@@AA䒀pA@$߈,\@AAPp(ACP@$߈,\䇀@PpP@@@@AA䒀pA@$߈<_Z$߈O}d~O$O@<,NÂ@AALp(ACL@$߈L@<@K{@< @Ws@@$䐓oG,Β$߈,\$߈,\6$߈,\$߈L,-$߈,\$߈,\p$߈,\$߈O4,@$߈<_Zw ,\$߈<_Zw,\C$߈<_Zw ,\B$߈<_Zw,\t$߈<_ZwpI@_@@,n{y<_Zwm@X򐀠_,OXO@OT,@AALp(AC L@{&Oh@X,䒀p@{@{L H G F IpIsspHLp?s ?s{Hp$O∀H@<@C$O∀@<@_$O∀@@$X?sw Hp$O∀?o[sw Hp{|?oPs?o\s_E?o_s_{;Hp?o_sw)({dp{{(dpw@{*蒓p pAQ@p{L IppI8Lhpp,\⒀(@O쒓,,,?,?,?pp4I@@@,$~@AAp(AG(pC,,\A{ɠ4,x4p(phlp,@hp(hpC@,\(< pwO,O ,t,\b,~,\(hpw%( p<w< lw++pw{<_h$숀( pw$숀<$숀*p+ p,\k@@O"爀,@AAp(Awo*@<@',8O*,~,\ {3+@<@ %,8O+,~,\z$숀<wA(< pwO,O ,t,\Rx,@,\$숀<wA(< pwO ,O ,t,\Rx,,\K$숀<wA(< pwOJ,O ,t,\Rx,,\$숀<w?(pw6p,8O,~,\z$숀<w>(p5p,J8O,~,\zc$숀<w(po@{_@@hp{a<w+;p(pw p{?<w6(< pwOg,O ,t,,\{z{(pohp+fp(Γp h,v(p7h,⻇@$p$@+Pp$@PAA$p,{$T򈀸0 hp(X!pw+8pw$k@@,P@(p((pw(pk@@,@(p((pw$,p((pC,p((pP p{ P p(p((p<($((pw0O,͐,V@4p0p<40C,0p{{0p<0G,0p{(P p@{@@,8O,͐,V@Yp8I,~(YpO8O,͐Y@@@,~TOx(AA@A@@@@AO`AQ(,p O@{ O@@pAA@A@@@@AO`AQ, :T,V@pp,\t8O,~8T@@@,~8O0,~(0pO28O,~80,~,\6(p2<hwpz{<hw pz(p_hpkpPp(Dpk@@,/@p(Dpw$@@+@w$<Hw z$<Lw5(pw,,(p(䒀pw ,⇀$(pw$,\,8O,~8T@@@,~8O0,~(0pO28O,~80,~,\pdp<PdK$T򈀄d@O@Php(pwL4hp< hw7(䒀p.h,t(p(䒀pwk@@,⇀ hph,H(p(䒀pwk@@,⇀( pw$N򈀇k@@,z@AAp<w5+*pw ͓@{ ͓@<@<@{ ,p{,p{<,O7 ,0p@AA,v(p ,,hphp{5k@@,0p?@w ( p<w_,vk@@,0p@AA,v<@Ol(pa(p,⻇@,{@@,(p)lp(䒀pw < w lp@@,⇀{OV,pdpzz,?tp,?((袓pwO袓O,h)(࢓pwO࢓O,h){<(袓pwO袓O,h)(࢓pwO࢓O,h)OآO ,x@,**OO,x@,**OO,x@,**O(,x@Yp(Ypw$@Y@+Ppw$@lpI@ @@Y,h)(lpw$@l I@@@,8dp<dGRI@@dAAHH@(Ppw{;d@@AA@O;@@I@@dAAHH@P,h);pdp{I@ @@,h)L H IpppILZ|p,\O2(pw O?@{ OD@@,( p2,\@p@+PpOK,|@<@C$@<@_$@@$$<wOP,{D<w-O}(pw O@{ O@@,{O,O ,t@@+@ ,vXp$O,O ,t䒀p@@+@ ,v Xp$+pdOǭ,OYpY@+Pp5Y@PA@oW@+@OʭY@PAA,Yp{ƠOͭ,{%(pw Oϭ@{ O䭓@@,O,(XpC ocXp{WO,Xp{?O,O ,t@@+@ ,v Xp(p,|p(p,|p(XpC obXp@{L IpG_Llppp|@(|pw A,@@dpd,V@H,VHA@A<_AOYOH,,\n(p,|p(p,|p@$2O@,h),\](|p$@@+@w$<@w (pw{"<@$(p${dhp@?oTPw$@?oPPw$@?otPw$@?opPw$hOo,B*(@$h@@?oTPw$h@@?oPPw$h@@?otPw$h@@?opPw$<@woT@{oP@@ph@PA@@+@@@,V@p,V<_@G;I@@@Os@@, :O@I@@@,h)(pw Dp(p(Dp${,\@2(@K$(pw$< Xw$,`OdO@ ,X(@CuOx,OOd,Xp(p,|p(p,|p,\w@$2Dp< XT|pp( p;,\@p(Dpw#@+PpO,@@+@w$/< Xw$/<,O,@ ,V(@O( ,9@ ,U,9{p< Xw$|",9_,p(4pn(p(@+Ppp<,{=@@+@.@LA+Qpp@L<,F{l(p(@+Ppp<,{=@@+@.@PA+Qpp@P<,(pO(pFH,X@p(pC,O;,Oi,O,(pOp(8pw$!(pK (4pw{Oگ,{l(p(@+Ppp<, {=@@+@.@TA+Qpp@T<,{l(p(@+Ppp<,{=@@+@.@XA+Qpp@X<,w(p3(p*H,X@p(pCO,<w$A#@@+@w$A#< Xw$A#(p$A#(pw|(Ģpws(Ȣpwj(̢pwa(p OOB , :{OOL , :O<,,$%< Xw$%p(p_(p(@+Ppp<,2{.@lA+Qpp@l<,{](p(@+Ppp<,{.@pA+Qpp@p<,(pw$%(pH,X@p(pw$%(pw$%@<@Kw@<@Wo@@$Ģ@(Ģpw At@@hp{GȢ@(Ȣpw Ax@@hp{&̢@(̢pw A|@@hp{hp(hp1h@+Pp(h<,(pH,X((phOp@(pwA@@p(p5@+Pp*<,T(pH,XOpТ@(ТpwA@@p(p5@+Pp*<,(pH,X<$&@(pw A\@@p(pw Op@+PpE<,O <@{ A0@@,a(pH,X{OS,,9$)< Xw$'Op(pN@+PpC<,O <@{ A0@@,(pH,X@($pw$'@$A+Qpw$'@$<,O <@{ A0@@,`O,?@p ,9@((p/@(A+Qp@(,v_,,,9,?@@+@w$(<w$(< Xw$(<_O _p(HpOk(0pObHp(HpK$@(蹓p*@_@? P@_@? P{p๓p{E(蹓p*@_@? P@_@? P{p๓p{( p(p ,$'@@_@@O͵,p:(@w ๓p@_@@Oҵ,p:(@w ๓p{T@_@@Oֵ,p:(@w ๓p{*@_@@O޵,p:(@w ๓p$'@@_@@O嵓,p:(@$@_@@O鵓,p:(@w {4p{W@_@@O,p:(@$@_@@O񵓀,p:(@w {4p{ ๓p{z@{L H G IpI@{L IpppI๓pZ乓pt蹓p(pw*_,y@AAp(AwXp@{;4pOZO@{L IppI(<ϓpO<ϓ,T<ϓpox@ϓp@{L IpppC_L< @$u< @$u<_ZW <_Z_{<_Z @$u(tpK <2tO!{<_tO <_tO{<_t$l<_Z$jO$H(tpK<2tGt@@A@AAAH@A@{b<_tO*<_tG#tCoCCpAAAAH@A@{3<_tw$tC_nCCpAAAAH@A@{ H@_ @+ p @$u<_Z$XkO$G(tpK<2tGt@@A@AAAG@A@{b<_tO*<_tG#tCoCCpAAAAG@A@{3<_tw$tC_nCCpAAAAG@A@{ G@_ @+p @$u<_Z$kO$F(tpK<2tGt@@A@AAAF@A@{b<_tO*<_tG#tCoCC p A AAAF@A@{3<_tw$tC_nCC$p$A$AAAF@A@{ F@_ @+ p @$u<_Z$lO$E(tpK<2tGt@@A@AAAE@A@{b<_tO*<_tG#tCoCC(p(A(AAAE@A@{3<_tw$tC_nCC,p,A,AAAE@A@{ E@_ @+ p @$u<_Zw <%twYp(Γpw$n(tpK <2tO!{<_tO <_tO{<_t$n(tpK <2tGt@{-<_tO<_tG t@o@{<_tw t@_n@{7@@hpZC_CClph@@AA@OhC@@AlA?QW$n($Γpw(pw(pw$nOd#_ OXғ<_ZW <_ZW {<_Z{1<_Z!Z@@AACOCC0p0CS@{ Oqғ@{ OfΓ@@Ouғ(tpK <2tO{<_tO <_tO {<_t{qOÓD(tpK<2tGt@@AD@A@{L<_tO<_tGtAoAA4pD@4@{(<_twtA_nAA8pD@8@{ D@_@P@{ OfΓ@@, ($Γpw (pw{Od#,h9@$uh@@AA@OhC@@AlAQph@@AA@OhC@lAO,ΓAQ0pYp(YpOԓ,i(@C ,\Ą@{Yp,\,\Ā@{YL H G F E D C IIL< @$%(͓p @$%,\͓p@<@KX@<@WP@@$Փ͓p@{Pp ppOpՓ,@{$@{ p,\@Yp͓pY@{L IppHLYpdphp(|pO (xpw {@$pYp<|YK$ڧZOՓt,dp<dO$Y@d@<|@CDI@ @@OՓ<dw O֓@{ O֓@@Y@d@p@AxAQ@@, :{/I@ @@O ֓<dw O֓@{ O֓@@, :ZI@ @@t,dpzdZOuғt,hp<hO$ħY@h@<|@K$ħI@ @@O֓<hw Ouғ@{ O֓@@Y@h@p@AxAQ@AoWA+AY@h@p@AxAQ@{.@@, :ZI@ @@t,hpzgY@@@HdHHYpYpz}ZOՓt,Z,V{L H IpI($Γpw (pw{)<(< ( ((p{ Z,썀L IppIL< @$< @$(ZpK < ZG{ @$(Zp <Z{ 8p{3<Z < Z{ 8p{<Zw :p{<Zw 9p<Z$_Yp_ap/bpscp@dp_ep_fpgp($Γpw(pw (pw{XOd#_ O֓@@@,l"@Oғ, ($Γpw (pw{Od#,I,~<@G @$$_Yp_ap/bpscp_dp_epfp($Γpw(pw(pw${pZ@<@KV@< @WN@@$t֓O̓p{9O/֓p{.O4֓p{#O>֓p{OG֓p{ OR֓p{Od#_ O\֓Oғ, ($Γpw (pw{Od#,I,~<@G@{@{L IpGo`Lt@Ppplp<(lO$yxG,W@AAhp(AC h@$t_hpl@OLd@kPplp(ppOד$p{/pO$ד$p{ pO0ד$p{pO?ד$p{{$Z@֓p{#O=ؓp{Op{ O̓p{$Z@<&@K@&@< @W8@@$ݓOHؓp{#OPؓp{OTؓp{ O̓p{$Z@<,@+<,@G <&@{*<1@{#Oaؓp{O̓p{ Omؓp{$Z@<,@+<,@G <&@{*<1@{#Oœp{O̓p{ Oyؓp{$Z@<,@+<,@G <&@{*<1@{#Oœp{O̓p{ Oؓp{$Z@<,@+<,@G <&@{*OÓLp(dpK<2dGd@@AL@A@{V<_dO#<_dGdAoAAPpL@P@{.<_dwdA_nAATpL@T@{ L@_@P@{ OfΓ@@O!ߓ, ($Γpw (pw{Od#,O$Xp(dpK<2dGd@@A@AAAX@A@{n<_dO/<_dG(dCoCC\p\A\AAAX@A@{:<_dw)dC_nCC`p`A`AAAX@A@{ X@_ @+ pw$EO$dp(dpK<2dGd@@A@AAAd@A@{n<_dO/<_dG(dCoCChphAhAAAd@A@{:<_dw)dC_nCClplAlAAAd@A@{ d@_ @ pO$pp(dpK<2dGd@@A@AAAp@A@{n<_dO/<_dG(dCoCCtptAtAAAp@A@{:<_dw)dC_nCCxpxAxAAAp@A@{ p@_ @pOd#_ OUߓ(dpK <2dO!{<_dO <_dO{<_d$ OÓ|p(dpK<2dGd@@A|@A@{V<_dO#<_dGdAoAAp|@@{.<_dwdA_nAAp|@@{ |@_@P@{ OfΓ@@Obߓ, ($Γpw (pw{Od#,êO$p(dpK<2dGd@@A@AAA@A@{n<_dO/<_dG(dCoCCpAAAA@A@{:<_dw)dC_nCCpAAAA@A@{ @_ @ pd@<@w$=<@G <@-$K@@L I@{IZtx|,<>O @L I@L IpIZtx|,<>G@@@L I@{ppIZtx|,<>C@@@L I@{pppIZtx|,DL IpppIZtx|,? @L I@L IpIZt,CL IpppIZtx|,>L IpppGZAGQH;w;{AQH;w@<@G_"p@YL H G F E D C I;w<Ewb;_W;0@{;7@{oW@@F\p>>>w3Gl@@ ,X(@wE,xF@L H G F E IFEY@@$,$~<$@E,x@L H G F E IppHZAtBxHl,wF$@O@<_ @w2(G"@bACB{GABG"A"F"I"T"W\"`"c/"i"l>"x"{/"/""\""/""\""\ Internet Kermit Service ready at %s%s C-Kermit ready at %s%s %s login loopAccess denied. Login Timeouton_loginInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commands\%0 耀,, -., telnetiksdCan't initialize!rx %ssx %ssx -a %src %srbsb %ssb -a %srzsz %ssz -a %skermit -irkermit -rkermit -x{{./.readme}{README.TXT}{READ.ME}}Can't allocate i/o buffers!Can't open device: /dev/ttyCan't allocate packet buffers!Internet Kermit Service cannot be started at a terminal.can't initialize i/oC-Kermit library, 8.0.031, 29 Jul 2001&NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUS&&䀐&耐&쀐&&&&'''' ' '''''' '$'(','0'4'8'<'?'C'G'J'M'PXXXBPHNBHINDNELSSAESAHTSHTJVTSPLDPLURISS2SS3DCSPU1PU2STSCCHMWSPAEPASOSSCICSISTOSCPMAPCNBS'Ԁ'Ԁ'؀'܀''䀐'耐'쀐''''(((( ((((((#(&(*(.'Ԁ(2(6(:(=(A(D(H0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZDELSHY%lx0%lx-10ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=>?456789:;<=  !"#$%&'()*+,-./0123CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCevenoddmarkspacenoneinvalid%02ld:%02ld:%02ld"{'([<"}')]>UNIX Communications support, 8.0.278, 8 Dec 20013 AT&T 3B2 System V3/dev/tty3none3B LINESCOLUMNSle_putsle_putstrFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! Locked by process %d Warning, problem releasing lock /dev/null%s is not a terminal device Can't unset O_NDELAYioctl(TCSETA)setuphangupresetclose?d?j?q?w?WARNING - close failed: %s Removing stale lock %s (pid %d terminated) %d/usr/spool/uucp?LCK..%sLOCKFILE_NAME_TOO_LONG/%s/LTMP.%05dUUCP not installed or Kermit misconfigured Warning - Lockfile %s seized by pid %d Warning - Can't remove lockfile: %s Warning - Can't remove secondary lockfile: %s mAm]m]m]m]m]m]m]m[m]mOm]m]m]m[prppppppppppppppv$v)v/v6v=vEvMvUv]vevmvuv}vvv^%c... Canceled... Can't send BREAKHZ%s%s %s :UNIX File support, 8.0.185, 8 Dec 2001|@ AT&T 3B2 System V|prm -f |cp |mv |pwd |ls -l ||cat |Mail|lp|df ||who |' /usr/adm/wtmp/var/log/iksd.logTerminal input not allowedrwa*(pipe)%.24s [BUFFER WOULD OVERFLOW] %.24s %d %s %ld %s %c %s %c %c %s %s %d %s _ikskermit %c/dev/nullzchko: Malloc error 46 .NONAME.././HOME/bin/shSHELL-cfgen can't malloc string space q.~*~.~%d~/----------%oU1%04d%02d%02d %02d:%02d:%02d;Zx0NS=ؑ==ʀ====(;Zx0NĀܡܡܡ9ܡܡ^ܡܡ܉echoL **?String space %d exhausted - use SET FILE STRINGSPACE to increase ?Too many files (%d max) - use SET FILE LISTSIZE to increase LOGNAME?Privilege cancellation failure sh-i/.////../?Local resource failure: malloc ftpanonymous/usr/bin/bash/etc/ftpusersxxiks_%04x(unknown host)anonymous:Anonymous login. User %s logged in. USER=LOGNAME=HOME=C-Kermit functions, 8.0.210, 10 Nov 2001TDisabledLocal onlyRemote onlyEnabled-b4)Lz hM]pU6Z Q~"#In'+Af/T=23uV7J;,}?PCtiGx KXaOdRS$Y^W(j[쑖_!cgl*kNo1rs yw9{& ȡDH٪>@£F꫼mqʻ\v0B`%:< Ӥ|ߴe8E.5Error receiving file%cfnlist: no memory for cmargbufstdinCalibrationNo files meet selection criteriaToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not found?%s ' '쀁'(( ((CALIBRATENONAMEAccess deniedException listWrite access denied?Sorry, receive filter + filename too long, %d max. Name too long/dev/nullCan't append to a directoryCan't rename existing directoryCan't overwrite existing directoryFile has same name as existing directory000/ခ0a0߀0U1UNFILE%02ld?Sorry, send filter + filename too long, %d max. Recovery attempted in TEXT mode: D? ?:? ?%D7CALIBRATION?Internal error expanding ADD list . Client Command Status Description REMOTE LOGIN required GET %-14s%s Transfer file(s) from server to client. SEND %-14s%s Transfer file(s) from client to server. MAIL %-14s%s Send file(s) as e-mail. REMOTE ASSIGN %-14s%s Assign value to server variable or macro. REMOTE CD %-14s%s Change server's directory. REMOTE COPY %-14s%s Copy a file on the server. REMOTE DELETE %-14s%s Delete a file on the server. REMOTE DIRECTORY %-14s%s List files on the server. REMOTE EXIT %-14s%s Exit from Kermit server program. REMOTE HOST %-14s%s Execute a shell command on the server. REMOTE PRINT %-14s%s Send a file to the server for printing. REMOTE QUERY %-14s%s Get value of server variable or macro. REMOTE MKDIR %-14s%s Create a directory on the server. REMOTE RMDIR %-14s%s Remove a directory on the server. REMOTE RENAME %-14s%s Rename a file on the server. REMOTE SET %-14s%s Set a parameter on the server REMOTE SPACE %-14s%s Inquire about disk space on the server. REMOTE TYPE %-14s%s Display a server file on your screen. REMOTE WHO %-14s%s List who is logged in to the server. FINISH %-14s%s Return the server to its command prompt. BYE %-14s%s Log the server out and disconnect.VW4WbWW΀WX*XXXXXY0Y^YYY老ZZDZrZZREMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) type*.~[0-9]*~0000-00-00 00:00:00%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s -> %10ld %s %s%s%s %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiess./*Listing files: %s%s%s*/*DIRECTORY %sDIRECTORY %10s: %s%sskippingdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETEjj#jJjqo1o1o1jo1jj态o1o1k o1k4j#o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1k[j#jJjqo1o1o1jo1jj态o1o1k o1k4j#o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1kwkk؀o1o1o1o1o1o1o1lslllǀl、lo1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1o1mm|m뀁n1nfo1no1o1o1no1o1o1o1o1o1o1o1o1oL3N3 !"$'(+-.03569:Retransmission(resend)Draining incoming packets, wait...Drain complete.String too longGET Packet Internal Error 1GET Packet Too Long for ServerGET Packet Internal Error 8@ GET Packet Internal Error 9Send Packet FailureGET with no filenameGET Packet Internal Error 2Ox%dGET Packet Internal Error 3GET Packet Internal Error 4Mx%dGET Packet Internal Error 5GET Packet Internal Error 6GET Packet Internal Error 7B00шreceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermit"Bad packet headerBad packet lengthBad sequence numberChecksum errorCRC error(crunched) %c-xx-%02d-%c-%02d-%02d- W#Z#Zini_pkts: no memory for s_pkt%ld%d׻sizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionoriginformatsys-dependent23456789:;<=>name@ŀʀπ׀߀䀐퀐%,:<>@BDFHJLNPRTY unknowngtattr: no memory for dsbufgattr: no memory for spbufN+N?* ++++Ϥ+Шl΀͂mCan't create backup fileCan't open output fileAccess deniedCommand or pipe failureCan't open fileCan't close fileWart Version 2.14, 10 Nov 1999ڬC-Kermit Protocol Module 8.0.156, 10 Nov 2001 SERVERUser cancelledError sending stringLogin requiredDeleting files is disabledBadly formed server commandREMOTE HOST disabledHOST commands not availableCan't do system commandDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE CD disabledREMOTE CDCan't change directoryREMOTE TYPE disabledREMOTE DIRECTORY disabledREMOTE DIRAccess deniedNo files matchCan't list directoryREMOTE DELETE disabledREMOTE DELETEIt's a directoryFile not foundDELETE failedSERVER FINISHFINISH disabledREMOTE EXITEXIT disabledSERVER BYEBYE disabledREMOTE HELPCan't send helpREMOTE SETREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPECan't type fileREMOTE MKDIR not availableREMOTE RMDIR not availableREMOTE SPACE disabledREMOTE SPACECan't check spaceREMOTE WHOREMOTE WHO disabledCan't do who commandQUIT disabledUnimplemented REMOTE commandCan't open windowRECEIVEZXUser canceledError writing dataCan't create fileRENAME failedMOVE failedCan't print fileCan't mail fileReceiver can't delete temp fileCan't close fileRESEND capabilities not negotiatedSENDCan't execute commandCan't open fileCan't send attributesUnknown errorProtocol errorERRORUnexpected packet typeԀ ݀ŀ؀mퟀ| V󬀁7 ܀WʀꀂuQ 7 u Ep 4]W = $r&o&(Ā)u)؀*,."..ƀ/2E4X4:E<===@CC瀂DπFGTI^I4。56E68y8y8y77IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII IIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII8IIG4IIIIIIIIIIIIIIIII5IIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII6II7GIIIIIIIIIIIIIIIIIIII:IIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII9GIIIIIIIIIIIIIIIIIIIIIIIIII=IIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIAIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIBIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIDIIIIIII IIII IIIIICIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIEIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIFIIIIIII IIII IIIIIHIII IIIIIII    11111111111111111111111111111111 1!"#1&1(%11111')*-/.$11111111 1,11 11+110111 1111111IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIG4IIIIIIIIIIII IIII53IIIIIII IIII IIIII2III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIIIIIIIIIIIIIIIII IIII IIIIIHIII IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIIIIIIII IIIIIIIIIIIII IIII IIIIIHIII IIIIIII -s "" %s %sREMOTE QUERYREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedREMOTE COPY disabledREMOTE COPYCan't copy fileREMOTE RENAME disabledREMOTE RENAMECan't rename fileAlready logged in.REMOTE LOGOUTLogged outUsername too longLogged in as guest - restrictions applyLogged inAccess denied.Logout ignoredLogin ignored.Logout ignored. IKSD IDLE TIMEOUT: %d sec SERVER IDLE TIMEOUT: %d sec SERVER DISCONNECTSEND disabledproto set binary modeA Kermit Server is not available proto reset binary mode?No connection Sorry, you must 'set speed' firstCan't open lineCan't condition lineCarrier required but not detectedsrgcjhk Sorry, only Kermit protocol is supported in this version of Kermit KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...C-Kermit server doneGET disabledUnknown GET ParameterGET without filename"(((((((((((ʀ(oCommand package 8.0.150, 8 Dec 2001 JanFebMarAprMayJunJulAugSepOctNovDec8<@DHLPTX\`daprilaugustdecemberfebruaryjanuaryjulyjunemarchmaynovemberoctoberseptember  Command? /:%s %s%s%s ?Memory allocation failure ?Name too long - %s %s %sfatal error: unable to allocate command bufferscmpush: no memory for cmpcmnum: illegal radix - %d -1Output file?Name too long ?Wildcards not allowed - %s /dev/tty?Write permission denied - %s ?Default name too long IKSD IDLE TIMEOUT: %d sec ?Timed out Command or field too long Expanded name too long ?cmifi: malloc error ...?Wildcard matches more than one directory /?No %s match - %s directoriesfiles?Too many %s match - %s ?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s %s Default name too long %c ?Partial name too long ?Directory name too long ?Completed name too long Directory name Input file specification %s: %s %s%s, one of the following: ڀIWWWqqP?Default too long Value too long Please complete this field %s%s- Text string?Unexpected return code from gtword() - %d sÀ?Keyword table missing Evaluated keyword too long ?Not a switch - %s ?Ambiguous - %s ?No keywords match - %s ?No keywords match - "%s" %s:?Evaluated keyword too long No keywords match One of the following: %s, one of the following: or a macro name ("do ?" for a list) or the token %c or one of the tokens: %s %d - Unexpected return code from gtword ǀ4ѹѹѹ%BBBBTTϊTtdaysmonthsweekswksyearsyrsnowtodaytomorrowyesterdayFridayMondaySaturdaySundayThursdayTuesdayWednesday@GNW^gocdtcstedtestgmtmdtmstpdtpstutczulu [A-Z][a-z][a-z] [A-Z][a-z][a-z] [ 0-9][0-9] [0-9][0-9]:[0-9][0-9]:[0-9][0-9] [0-9][0-9][0-9][0-9][A-Z][a-z][a-z] [A-Z][a-z][a-z] [ 0-9][0-9] [0-9][0-9]:[0-9][0-9]:[0-9][0-9] [A-Z][A-Z][A-Z] [0-9][0-9][0-9][0-9]dBase year out of rangeBase month out of rangeBase day out of rangeBase hour out of rangeBase minute out of rangeBase second out of rangeResult year out of range%04d%02d%02d %02d:%02d:%02d%s %02d:%02d:%02d̀U٘00Date-time string too longInvalid monthUnrecognized day of week 00:00:00TtYyNn Tt_-:Numeric date too longInvalid date-time separator -/._Inconsistent date separatorsToo few fields in dateMisplaced time separatorProblem supplying current dateUnrecognized word in dateToo many non-numeric fields in dateNon-digit in third date fieldUnknown month%02dDay not numericDay or month out of rangeDay and month are ambiguousToo few digits in yearAmbiguous numeric dateToo many digits in yearUnexpected date formatUnknown date-time wordInternal error - date not defaultedMonth out of rangeDay out of range%04d%02d%02dInvalid time%s%s%02dToo many time digitsToo many time fieldsImproper fractionInvalid time charactersama.m.pmp.m.Unknown timezoneInvalid delta timeInvalid units in delta timeExtraneous material at endInvalid hoursInvalid minutesInvalid secondsInvalid minutes or secondsb􏀂适ဂwǀc#7%ldd%d:%02d%d:%02d:%02d%ldd%d:%02d%ldd%d:%02d:%02d%04d-%s-%02d%s%02d-%s-%04d%sDate and/or time?Evaluated date too long ?%s ?Command history error %s aw?Not confirmed - %s Press the Return or Enter key to confirm the command nnnnnހ?cmfdb - unexpected function code: %d Does not match filename or switchDoes not match filename or keywordNot a number or valid keywordNot a number or valid switchNot valid in this position?%s: "%s" dĀF55 5555555555555555555555555555*55?Saved word too long ?Field too long error 1 ?Field too long error 2 ?Too long %s %s%s?Command too long, maximum length: %d. ?Command buffer overflow  0000000000000000000000000000000000000000000000000000000000000000000000000Trustees of Columbia University in the City of New York. Press ? for a list of commands; see documentation for detailed descriptions. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1,plus supplements at http://www.columbia.edu/kermit/ckermit.html.d뀑퀑82nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. More info at the KermitProject website, http://www.columbia.edu/kermit/.d뀑퀑䀑1xSyntax: ARRAY verb operands...Declares arrays and performs various operations on them. Arrays havethe following syntax: \&a[n]where "a" is a letter and n is a number or a variable with a numeric valueor an arithmetic expression. The value of an array element can be anythingat all -- a number, a character, a string, a filename, etc.The following ARRAY verbs are available:[ ARRAY ] DECLARE arrayname[n] [ = initializers... ] Declares an array of the given size, n. The resulting array has n+1 elements, 0 through n. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ... by including = followed by one or more values separated by spaces. If you omit the size, the array is sized according to the number of initializers; if none are given the array is destroyed and undeclared if it already existed. The ARRAY keyword is optional. Synonym: [ ARRAY ] DCL.[ ARRAY ] UNDECLARE arrayname Destroys and undeclares the given array. Synonym: ARRAY DESTROY.ARRAY SHOW [ arrayname ] Displays the contents of the given array. A range specifier can be included to display a segment of the array, e.g. "array show \&a[1:24]." If the arrayname is omitted, all declared arrays are listed, but their contents is not shown. Synonym: SHOW ARRAY.ARRAY CLEAR arrayname Clears all elements of the array, i.e. sets them to empty values. You may include a range specifier to clear a segment of the array rather than the whole array, e.g. "array clear \%a[22:38]"ARRAY SET arrayname value Sets all elements of the array to the given value. You may specify a range to set a segment of the array, e.g. "array set \%a[2:9] 0"ARRAY RESIZE arrayname number Changes the size of the given array, which must already exist, to the number given. If the number is smaller than the current size, the extra elements are discarded; if it is larger, new empty elements are added.ARRAY COPY array1 array2 Copys array1 to array2. If array2 has not been declared, it is created automatically. Range specifiers may be given on one or both arrays.ARRAY LINK array1 arra2 Makes array1 a link to array2.[ ARRAY ] SORT [ switches ] array-name [ array2 ] Sorts the given array lexically according to the switches. Element 0 of the array is excluded from sorting by default. The ARRAY keyword is optional. If a second array name is given, that array is sorted according to the first one. Switches: /CASE:{ON,OFF} If ON, alphabetic case matters; if OFF it is ignored. If this switch is omitted, the current SET CASE setting applies. /KEY:number Position (1-based column number) at which comparisons begin, 1 by default. /NUMERIC Specifies a numeric rather than lexical sort. /RANGE:low[:high] The range of elements, low through high, to be sorted. If this switch is not given, elements 1 through the dimensioned size are sorted. If :high is omitted, the dimensioned size is used. To include element 0 in a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort elements 0 through n). You can use a range specifier in the array name instead of the /RANGE switch. /REVERSE Sort in reverse order. If this switch is not given, the array is sorted in ascending order.Various functions are available for array operations; see HELP FUNCTION fordetails. These include \fdimension(), \farraylook(), \ffiles(), \fsplit(),and many more.̀뀑뀑1뀑G뀑P瀑뀑#뀑LȀU쀑4뀑x뀑ڀ9̀뀑V뀑׀9뀑|‑-뀑vـ뀑 8뀑Yրj뀑瀑뀑(뀑w뀑Ȁ]@뀑bm뀑ҀjSyntax: COPY [ switches ] file1 file2 Copies the source file (file1) to the destination file (file2). If file2 is a directory, file1 can contain wildcards to denote a group of files to be copied to the given directory. Switches: /LIST Print the filenames and status while copying. Synonyms: /LOG, /VERBOSE /NOLIST Copy silently (default). Synonyms: /NOLOG, /QUIET /SWAP-BYTES Swap bytes while copying. /FROMB64 Convert from Base64 encoding while copying. /TOB64 Convert to Base64 encoding while copying. ̀ !>!뀑!!뀑" "뀑"M"[뀑"y"뀑""Command-line options are given after the program name in the systemcommand that you use to start Kermit. Example: kermit -i -s oofa.exetells Kermit to send (-s) the file oofa.exe in binary (-i) mode.Command-line options are case-sensitive; "-s" is different from "-S".If any "action options" are included on the command line, Kermit exitsafter executing its command-line options. If -S is included, or no actionoptions were given, Kermit enters its interactive command parser andissues its prompt.Command-line options are single characters preceded by dash (-). Somerequire an "argument," others do not. If an argument contains spaces, itmust be enclosed in doublequotes: kermit -s "filename with spaces"An option that does not require an argument can be bundled with other options: kermit -Qis oofa.exeExceptions to the rules: . If the first command-line option is a filename, Kermit executes commands from the file. Additional command-line options can follow the filename. . The special option "=" (equal sign) or "--" (double hyphen) means to treat the rest of the command line as data, rather than commands; this data is placed in the argument vector array, \&@[], along with the other items on the command line, and also in the top-level \%1..\%9 variables. . A similar option "+" (plus sign) means: the name of a Kermit script file follows. This file is to be executed, and its name assigned to \%0 and \&_[0]. All subsequent command-line arguments are to be ignored by Kermit but made available to the script as \%1, \%2, ..., as well as in the argument-vector arrays. The initialization file is not executed automatically in this case. . The -s option can accept multiple filenames, separated by spaces. . the -j and -J options allow an optional second argument, the TCP port name or number.Type "help options all" to list all the command-line options.Type "help option x" to see the help message for option x.Kermit also offers a selection of "extended command-line" options.These begin with two dashes, followed by a keyword, and then, if the optionhas arguments, a colon (:) or equal sign (=) followed by the argument.Unlike single-letter options, extended option keywords aren't case sensitiveand they can be abbreviated to any length that still distinguishes them fromother extended-option keywords. Example: kermit --banner:oofa.txtwhich designates the file oofa.txt to be printed upon startup, rather thanthe built-in banner (greeting) text. To obtain a list of availableextended options, type "help extended-options ?". To get help about allextended options, type "help extended-options". To get help about aparticular extended option, type "help extended-option xxx", where "xxx"is the option keyword.At present, most of the extended options apply only to the Internet KermitService Daemon (IKSD). Type "help iksd" for details.#<#뀑#뀑#ǀ뀑$뀑$N$$%%뀑%8%%ɀ뀑%뀑뀑& 뀑&\뀑&r뀑&&׀뀑'#'k'(뀑(M(()+)s)뀑)݀뀑*"*k뀑*~*뀑*+:++̀,,g뀑,뀑,,-;--ɀ.뀑.).t뀑 %s, Copyright (C) 1985, 2001, %s %s passwordpromptuserid222allcautiousminimalnone2D2H2Q2Yprefixedunprefixed22newold22diagnosticserror22pacingspecial-escapes331234blank-free-23D3F3H3J3Lcountsprefix33automaticoffon333333quietverbose4 4&linelengthsessiontimestamps4L334W4_fullhalf44/direct-serial/modem/remote4444keepxon/xoff3 5, 2Y514bellcodecresclfxoffxon5|55 55 2Y55asciibinarydebugtexttimestamped-text666 c66internationallocallong-distancep>u>yat-commandsdcechardware-flowhwfcitukssbsoftware-flowspeed-bufferingswfctbtelebitv25bis-commands><>>=> > >=Z>>>@>>@>>?area-codeconfirmationconnectconvert-directorycountry-codedirectorydisplayforce-long-distancehangupignore-dialtoneintervalininit-stringintl-prefixintl-suffixlc-area-codeslc-prefixlc-suffixld-prefixld-suffixlocal-area-codelocal-prefixlocal-suffixmmacromemethodmnp-enablemodem-hanguppbx-exchangepbx-inside-prefixpbx-outside-prefixpulse-countriesrestrictretriessortstringsuffixtesttimeouttf-area-codetf-prefixtoll-free-area-codetoll-free-prefixtone-countries?<??)@@= @" @,=.==?@4/@H@O2@_@h@k@w@=Z@.@,@-@@ @@,@-@@4@@AA 33A!A&"A8#3 AK5A[*AdAl%=AqAx$A7AA&A'A&A'A66dtrmodem-commandrs232-signalv24-signalDdDhDvDautoanswerdial-mode-promptdial-mode-stringhangup-commandno-flow-controlpredial-initpulsetoneD <D D =D>@O@kDE E >=zE=autorts/ctsE 2YE51defaultE F(EEkermitshellFdFk/match-dot-files/no-match-dot-filesFFevenhardwaremarkoddspaceFeFHFm2YFoFsFeFo433messagepathGxGfileG33on-disconnectstatuswarning@HGGGalwaysH(33remote<==>=!=++--**==!.andorxormaxmin%||&&quoteevalabstruncateroundceilingfloorfloat#&|~ZZZZZZZZZZZ Z Z Z ZZZ(Z)ZZ ZZZZZ'Z[[[[ [ *Aq+[[[ [$ [* [2 [8 [>%[@#[B$[D&4+nilpit]\]`]c4 sexpression echo-result: %s sexpression depth-limit: %d maximum depth reached: %d longest result returned: %d last sexpression: %s (none) last value: %s dosexp[] ?S-Expression depth limit exceeded: %d ?Memory allocation failure - "%s" \%[]&$+-/=*^_@!{}/<>|.#~'`:;??Too many operands: max = %d ?Not defined - "%s" ?Invalid operand - "%s" ?Too few operands - "%s" ?Too %s operands - "%s" manyfew?Invalid assignment - "%s" ?Assignment to constant - "%s" ?Not numeric - "%s" Array not declaredSubscript out of rangeOut of memoryError creating variable?%s - "%s" ?Too many operands: IF - "%s" '()?Memory re-allocation failure - "%s..." ?Not Numeric - "%s" ?Divide by zero - "%s" ?Too many operands - "%s" BAD OP [%s] ?Macro disappeared! - "%s" ?Resources exhausted - "%s" QMQMQ%QpQpQpQpQQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQpQHQMQpQpQpQHQMfgOgi#kZp?hfրp?ijXjjknրnap?ll mmπm3p?p?p?oKp?oiĀhh{p?p?p?ooop0o push%s available not CHECK: push not available pipes%s available CHECK: pipes not available %s%s available CHECK: %s not available E= %s: No record. FTPKermit %s: No connection. ActiveClosedUnknown Status: %s Opened: %s User: %s PID: %s Type: %s To: %s From: %s Device: %s Origin: %s %s Elapsed time: %s (unknown) Encrypted: %s YesNo Log: %s ?gii+iiiiiSiiii~ %s %s T=SERIAL H=%s D=%s LOGLINE BUFFER OVERFLOWWARNING: modem info for "%s" not filled in yet This space available (use SET MODEM NAME)Modem parameter?No keywords match: "%s" how to hang up modemcapability of modem?value required modem typebased on existing modem typeunknownDescriptive name for modemUnexpected SET MODEM parameter _䀃䀃_䀃__䀃䀃_䀃__䀃_m䀃䀃S䀃k䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃䀃vModem initialization stringTelephone number prefixDialing command for modem, include "%s" to stand for phone number, for example, "set dial dial-command ATDT%s\13"?Dial-command must contain "%cs" for phone number. Seconds to wait for call completionKermit/modem timeout differential10ASCII value of character to escape back to modem43Modem's command to %sable %sendisModem's hangup commandModem's command to enable hardware flow controlModem's initialization stringModem's command to disable local flow controlTelephone number prefix for dialingModem's command to enable local software flow controlCommand to configure modem for tone dialingCommand to configure modem for pulse dialingCommand to enter dial modeModem response upon entering dial modeCommand to turn modem speaker onCommand to turn modem speaker offCommand for low modem speaker volumeCommand for medium modem speaker volumeCommand for high modem speaker volumeCommand to tell modem to ignore dialtoneCommand to send to modem just prior to dialing?Unexpected SET DIAL STRING parameter Number of times to try dialing a numberSeconds to wait between redial attempts30Area code you are calling from?Sorry, area code must be numeric (please omit the parentheses) (no slashes, please) Country code you are calling from?Sorry, country code must be numeric (please omit the plus sign) 0118008888778660033International dialing prefixInternational dialing suffixLong-distance dialing prefixLong-distance dialing suffixLocal dialing prefixLocal dialing suffixInternal-call prefix of PBX you are calling from\v(d$px)\v(d$pxx)\v(d$p)Outside-line prefix of PBX you are calling from Telephone number suffix for dialingToll-free area code(s) in the country you are calling fromExchange(s) of PBX you are calling fromAnother toll-free area codeAnother PBX exchange Long-distance prefix for toll-free dialingArea code to which calls from your area are localMilliseconds to pause between each character sent to dialerName of macro to execute just prior to dialingCountry code where Pulse dialing is requiredCountry code where Tone dialing is availableAnother country code?Unexpected SET DIAL parameter s̀ဃ̀CހtkՀrހހހ`ހ܀ހҀ%ꀃJjހ5󀃣ހ2]Bހހdxaa΀/G_w׀]-E܀܀􀃓 Sorry, command disabled %s Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem carrier-watch: off on auto unknown Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s Modem compression: %s Modem speed-matching: %s (interface speed %s) changesis locked Modem flow-control: none xon/xoff rts/cts Modem hangup-method: %s Modem speaker: %s Modem volume: %s Modem kermit-spoof: %s Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Speaker on: %c Speaker off: %c Volume low: %c Volume medium: %c Volume high: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: %c Ignore-dialtone: %c Predial-init: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. %ld - illegal value, must be 0 or positive Internal time conversion error, sorry. %05ld3D3F7E17E27M17M27O17O27S17S28E18E28N18N28O18O2vvvvvvvvv v vv v v 4vvvvvvvvvvvvvvpurge@"w=&4gotherxxmodemxmodem-crcyymodemymodem-gzmodemwFdwwwwxx xx {}?Sorry - maximum length is %d ?Sorry, REDIRECT capability required for external protocols. Optional command to send to host prior to uploading in binary modeOptional command to send to host prior to uploading in text modeOptional command to send to host to start Kermit serverExternal command to SEND in BINARY mode with this protocolExternal command to SEND in TEXT mode with this protocolExternal command to RECEIVE in BINARY mode with this protocolExternal command to RECEIVE in TEXT mode with this protocol|lprPrinter or file name?Directory names not allowed Sorry, printing disabled ?Memory allocation failure ?Access denied - %s ...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. 310Send buffer size?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small Receive buffer size400/client, /server or?This switch does not take arguments ?Unexpected value - %d desired server stateUNKNOWNdesired client stateparameter for TELNET negotiationsinitial TELNET echoing stateterminal type for TELNET connectionsDOacceptWILLu?Sorry, command disabled. Prompt string%% fields are not used in this command. Positive number?A positive number, please bytesize for command characters, 7 or 87 ?The choices are 7 and 8 maximum number of commands in recall bufferCommand screen width, characters80Command screen height, rows24Max length for debug log strings?Sorry, debug log feature not enabled Number of seconds before starting to send5EXIT status codeFlow control type, one of the following: dtr/cd dtr/cts keep none rts/cts xon/xoff or connection typeFlow control type, one of the following: keep none xon/xoff or connection type?No keywords or switches match: "%s" Flow control type?Sorry, "automatic" can not be assigned to a connection type. ASCII value?Character must be in ASCII control range Maximum retries per packet403Number of seconds, or 0 for no idle timeoutInterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs 404Name of file420type of fileTransmission rate for (bits per second)Serial-port speed (bits per second)?SET SPEED has no effect without prior SET LINE ?Speed cannot be set for network connections ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, 134.5 bps %s, %ld bps character-setASCII code for cancellation characterCancel character must be 0-31 or 127 How many required to cause cancellationNumber must be 2 or greater ?Sorry, only Kermit protocol is available 410Sorry, access to pipes is disabled Who expands wildcardswhether to match filenames that start with "."Shell expansion is disabled Window size for Kermit protocol, 1 to 32Window size for ZMODEM protocol, 0 to 65535Window size for current protocol?SET WINDOW does not apply to %s protocol 406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. TELNET IAC = 255, CR = 13, not affected. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. Sorry, not on a TELNET connection. repeat-count compression parameter(not implemented yet, nothing happens) ?Illegal value for prefix character Seconds from now, or time of day as hh:mm:ss?Number, expression, or time of day required ?Alarm time is in the past. Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. value for login scriptSorry, too long Name of temporary directoryend-of-file detection methodCD PATH stringStop bits for serial deviceSerial device character size, parity, and stop bitsfor commandTime limit for ASK command, secondsMaximum recursion depth1000Not implemented - %s 퀃(뀃퀃퀃퀃퀃퀃§²R½RǀҀ݀R R’œ+"4KRRR=R考RRDl\bππππ ڀππ⢀䬀ππππππππV倃ππL< !D|앀〃Qt'-: [[[[[[[[[[[[[[[[[[~RӀ_ERfzĀ؀쀄ـMҀ݀GÀ-[ z[o퀄" A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. OK to close? OK to exit? control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d 255: %d SET SEND DOUBLE characters: %d SET RECEIVE IGNORE characters: JanFebMarAprMayJunJulAugSepOctNovDec<@DHLPTX\`dh0123456789ABCDEFSunMonTueWedThuFriSatĀȀ̀_lineapcactiveargcargsauthnameauthstateauthtypeblockcheckbyteordercmdbufsizecmdfilecmdlevelcmdsourcecolsconnectioncountcpscpucrc16cttycx_timecx_statusd$acd$ccd$ipd$lcd$lcpd$lpd$pxd$pxxdatedaydialcountdialnumberdialresultdialstatusdialsuffixdialtypedirectorydm_hfdm_lpdm_spdm_pddm_tddm_wadm_wbdm_wddm_rcdownloadeditoreditfileeditoptserrnoerrstringescapeevaluateexedirexitstatusfilenamefilenumberfilespecfsizeftimeftypeheraldhomehosthourhwparityinputincharincountinidirinmatchinstatusintimeinwaitipipaddressipromptkbcharlinelocallockdirlockpidmaclevelmacrominputmodelmodemm_aa_offm_aa_onm_dc_offm_dc_onm_dialm_ec_offm_ec_onm_fc_hwm_fc_nom_fc_swm_hupm_initm_namem_pulsem_sig_cdm_sig_ctsm_sig_dsrm_sig_dtrm_sig_rim_sig_rtsm_tonenamendatendaynewlinentimeosnameosreleaseosversionpacketlenparitypasswordpexitstatpidplatformprinterprogrampromptprotocolp_8bitp_ctlp_rptqueryreturnrowssdepthsecuresendlistserialsetlinemsgsexpressionspeedstartupstatussvaluesysidsystemterminaltesttextdirtfsizetftimetimetimestamptmpdirtriggerttyfdty_lnty_lcty_lmuseridversionwindowxferstatusxfermsgxfer_badpacketsxfer_timeoutsxfer_retransmitsxprogramxversionW] %.9CNV_i,n0y&_:9;hh<\[$  &,28>DJPVA_nfpooxU~V}8T bc)s!" SR%~,3^6^@HO TZbjsy/7IHEDCGFKMLJBN !*4O;@FK+SY`jtY~#>da |?@feg4 -x%5-4;1A H.QtV^elq{Qy=ZuwmXaaconvertabsolutearraylookb64decodeb64encodebasenamebreakcacapcapitalizecapscharacterchecksumcmdstackcmpdatescodecommandcontentscvtdatedayofyeardefinitiondelta2secsdeltatosecsdialconvertdiffdatesdimensiondirectoriesdirnamedos2unixpathdostounixpathdoydoy2datedoytodateexecutefileshex2iphextoiphex2nhexifyindexip2hexiptohexjdatejoinkeywordvalueleftlengthliteralloplowerlpadltrimmaximumminimummjdmjd2datemjdtodatemodulusn2hexn2octaln2timenextfilentohexntooctalntotimeoct2nocttonpathnamepatternpermissionsradixrandomrawcommandrdirectoriesrfilesreprepeatreplacereverserightrindexrpadrsearchsearchsizespansplitstripbstripnstripxsusubsubssubstsubstitutesubstringtablelooktod2secstodtosecstrimunhexifyunix2dospathunixtodospathupperutcdateverifyworda]%`/_95B+H/K/O/Z/_i3r{64MSNOLACN!P*P~K4 <BIQW)^dk6sNy~9.QRR>?WFTSV>?W&2/7XCIDP7[Bh@o s z [Z,F:8^lUV V-*"/= CKREuappendnew3.14159265358979323846264338327952.7182818284590452353602874713527%0.250f%0.6f\v(home){} PATH/prescan: no memory for kermrc.kermrcftpftpstelnettelnetsiksdkermithttphttps+--Extended argument errorinvalid argument bundlingmissing usernameusername too longmissing name in -y+,䀄+,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄+,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄+€,Ҁ,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄+؀,䀄,䀄,䀄,䀄,C,Q,䀄,䀄,䀄,䀄,䀄,i,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,s,䀄,䀄,䀄,_,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,䀄,u,,?Sorry, IKSD cannot CONNECT. Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. _apc_commandsnone?Can't start command: %s ?Can't open file %s Can't open device %s Can't condition line ^C... ?TRANSMIT file read error: %s ?TRANSMIT output error: %s ?Can't transmit character ?Connection lost ?Output error Connection closed. Session Limit exceeded - closing connection. ?Communications error ?Timeout ?Anonymous log creation not allowed packet.logName of packet log filesession.logName of session log fileCX.LOGName of connection log file ?Unknown log designator - %d Disposition?%s - %s %02dtextbinaryunknown Transfer Bell: %s Transfer Interruption: %s Transfer Cancellation: %s Transfer CRC-calculation: %s Transfer Display: %s fullscreencrtbrief Transfer Message: %s (none) Transfer Locking-shift: forced%senableddisabled,%s%s not used Transfer Mode: %s automaticmanual Transfer Pipes: %s Transfer Protocol: %s Transfer Slow-start: %s FƀF܀FGG Connection type: %s Current flow-control: %s Switches automatically: yes Switches automatically: no Defaults by connection type: %-14s: %s %-14s: (%d) Communications Parameters: Network Host: %s%s (reliable) %s: %s%s, speed: Line (closed)75/1200134.5%ld Mode: , mode: remote, modem: %s Parity: %s%shardware , stop-bits: (default), stop-bits: %d (8%c%d) (7%c%d) (8N%d) D, duplex: %s, halffullflow: %s, handshake: %d none offonauto Carrier-watch: %s, timeout: %d sec, timeout: none, close-on-disconnect: %s Lockfile: %s Secondary lockfile: %s Lockfile directory: %s Typical port device name: %s Terminal bytesize: %d, escape character: %d (^%c) %-21s %12s %12s %12s %12s Telnet OptionMe (client)U (client)Me (server)U (server)%03d %-17s UNKNOWN%12s %12s %12s %12s %21s %12s %12s %12s %12s WILLWONTDODONTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSET TELNET parameters: echo: %s NVT newline-mode: off (cr-nul)on (cr-lf)raw (cr)(lf) kermit: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %sstartedstopped u, n/a me, %s; me, n/a; BINARY newline-mode: binary-mode: me, accepted; me, refused; u, %s; me, %s BINARYNVT binary-transfer-mode: %s bug binary-me-means-u-too: %s bug binary-u-means-me-too: %s bug sb-implies-will-do: %s terminal-type: TERMnone (%s will be used) ZZ\ZrZ[ [[0[@[[s[[\̀\\\ ]d]T]t]]ǀ]]׀] No networks are supported in this version of C-Kermit (none) \\%c\{%d} Dial status: %d Dial directory: %s Dial directories: %2d. %s Dial method: auto defaultpulse tone Dial sort: %s Dial hangup: %s Dial display: %s on Dial retries: %-6d Dial interval: %d Dial retries: (auto) Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s Dial confirmation: %s Dial convert-directory: %s ask Dial ignore-dialtone: %s Dial pacing: %d Dial prefix: %s Dial suffix: %s Dial country-code: %-12sDial connect: %s %squietverbose Dial area-code: %-12sDial restrict: international long-distance local ? Dial lc-area-codes: %s Dial lc-prefix: %s Dial lc-suffix: %s Dial ld-prefix: %s Dial ld-suffix: %s Dial force-long-distance %s Dial intl-prefix: %s Dial intl-suffix: %s Dial toll-free-area-code: Dial pulse-countries: Dial tone-countries: Dial toll-free-prefix: %s Dial pbx-exchange: Dial pbx-inside-prefix: %s Dial pbx-outside-prefix: %s Dial macro: %s relativemmm m(m Transfer mode: %s File patterns: %s (but disabled by TRANSFER-MODE MANUAL) (SHOW PATTERNS for list) File scan: on %d File scan: off Default file type: %s File type: %s converted(unknown) File names: %s Send pathnames: %s Receive pathnames: %s Match dot files: %s yesno Wildcard-expansion: %s shell File collision: File destination: %s nowherescreendiskkeep File incomplete: %s File bytesize: %d File end-of-line: crlfcrlf File eof: %s ctrl-z File download-directory: %s Send move-to: %s Send rename-to: %s Receive move-to: %s Receive rename-to: %s Initialization file: %s Kermit doc files: %s Disk output buffer: %d (writes are %s, %s) bufferedunbufferedblockingnonblocking Stringspace: %d Listsize: %d Longest filename: %d Longest pathname: %d Last file sent: %s Last file received: %s Also see: SHOW PROTOCOL, SHOW XFER, SHOW PATTERNS, SHOW STREAMING Protocol: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Cancellation: %s %d %d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Pause: %11d%9d Attributes: %s Packet Start: %11d%9d Max Retries: %6d%s (unlimited) Packet End: %11d%9d 8th-Bit Prefix: '%c' 8th-Bit Prefix: ('%c' but not used) Packet Length:%11d %8d Repeat Prefix: '%c' Repeat Prefix: ('%c' but not used) Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: Auto-upload command (binary): Auto-upload command (text): Auto-server command: Packet timeouts: dynamic %d:%d Packet timeouts: fixed%-31sSend backup: %s Transfer mode: %sautomatic manual Transfer slow-start: %s, crc: %s Transfer pipes: %s Send filter: %s Receive filter: %s Also see: SHOW FILE, SHOW XFER Executed by external commands: SEND command (binary): %s SEND command (text): %s RECEIVE command (binary): %s RECEIVE command (text): %s Autoreceive command (binary): %s Autoreceive command (text): %s Show what? (Type "show ?" for a list of possiblities.) No file transfers yet. protocol : %s status : SUCCESS FAILURE (interrupted) FAILURE (i/o error) FAILURE external protocol statistics not available crc-16 of file(s) : %ld crc-16 of file(s) : (disabled) reason : %s remote system type : %s files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) control characters : %ld prefixed, %ld unprefixed 8th bit prefixing : yes [%c] no locking shifts : %s window slots used : (streaming) window slots used : %d of %d reliable: : %s%s not negotiated clearchannel: : %s%s packet length : %d (send), %d (receive) compression : yes [%c] (%ld) block check type used : blank-free-2 block check type used : %d elapsed time : %d sec, %s transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps (%d%%) effective data rate : %ld cps peak data rate : %ld cps Use STATISTICS /VERBOSE for greater detail. ?Connection %s %s is not open. to?INPUT initialization error Internet Kermit Service in SERVER mode. Please use REMOTE commands. Fatal error - disconnected. III?malloc error 6 ;Zx0N<[y1O0-1%04d%03d %s%04d%03d%04d%02d%02d %s%04d%02d%02d%%0.%df-0.00.0\fjoin(&_[],{ },1) ?\fexec() too deeply nested %d%lx%lo0%lx./UNIXC-Kermitu3bfileevenmarkoddspaceimagelabeledmacbinary2480CK_TMPTMPDIRTEMPTMP/tmp/.|(default)rejectedNULL 8%c%d 7%c%d 8N%dۀOk(5ZꀅCN=n؀؀؀؀؀؀؀'ˀ؀؀؀؀؀؀؀؀؀؀؀ʀ؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀؀u333333331XҀj~Հ Yꀅ8 22b΀C倅 6SpǀȀ,9Fk <iÀJwр! Q *!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ɀ!"f%1""?""À"##,%1#S#}$c$$စ$%%Y%f%s%'3'3%%&M'3&&&'3'3&܀'\'(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ((((ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ''(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ( (ɀ(ɀ(ɀ(ɀ(ɀ(ɀ'(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ(ɀ'р()+k+k+k+k),)9)`)m)+k))+++++++++++瀅,,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5,5++,_,,/,Ԁ,Ԁ,Ԁ,Ԁ,Ԁ,Ԁ---Ӏ///-////..<.i/..//.̀.ڀ.瀅./////////////0/////////D/W- -%--A-3-O?definition is circular or too deep ?Out of memory\fjoin(&_[],,1)\&a(\v(dir)) C-Kermit>(\v(dir)) IKSD>00set parity mark, set dupl half, set handsh xon, set flow noneHif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1set win 4, set rec pack 2200, set prefix cautiousset win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all, set reliable off, set clearchannel off@_assign _for\v(cmdlevel) { _getargs,def \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)7hdef \%1 \feval(\%2),:_..top,if \%5 \%1 \%3 goto _..bot,\%6,:_..inc,incr \%1 \%4,goto _..top,:_..bot,_putargs},Ȁ7h_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)Ptր_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:default,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)<_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)successtimeoutinterruptedinternal errori/o errorX`ht/usr/local/doc//usr/share/lib//usr/share/doc//usr/local/lib//usr/local/share//usr/local/share/doc//usr/local/share/lib//usr/doc//opt//doc/Ȁ؀耑0FPVifnotcmdlevelgoto>incrdef_assignechoevallitdo_getargs<_putargsasgelseK_INFO_DIRECTORYK_INFO_DIR/ckubwr.txtkermit/%ld75/1200.5cmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for xquietcmdini: no memory for kermrccmdini: no memory for apcbufcmdini: no memory for linecmdini: no memory for tmpbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_forz_xif_while_switx\&@[%d]\&_[%d]=--++ + " \%0CKERMIT.INICKERMIT_INIr?%s - %s %s ?Memory allocation failure [getnct] %3d. %sWARNING: Last line of %s lacks terminator command filedirectory file?Line too long, maximum length: %d. %2d. File : %s (line %d) FORXIFWHILESWITCH %2d. Macro : %s %2d. Prompt: %2d. ERROR : Command source unknown %2d. Prompt: (top level) COMMAND PROMPT?Connection broken (carrier signal lost) ************************* SEND-class command failed. Packets sent: %d Retransmissions: %d Timeouts: %d Damaged packets: %d Transfer canceled by receiver. Receiver's message: "%s" Fatal Kermit Protocol Error: %s Most recent local OS error: "%s" HINTS... If the preceding error message%s not explain the failure: s do does . Did you start a Kermit receiver on the far end? . Try changing the remote Kermit's FLOW-CONTROL setting. . Try placing a new call to get a cleaner connection. . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Adjust the timeout method (see HELP SET SEND). . Increase the retry limit (see HELP SET RETRY). . Try it again with SET PREFIXING ALL. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET CLEAR-CHANNEL OFF. . Try it again with SET PARITY SPACE. . %sive a ROBUST command and try again. As a last resort, gGAlso: . Be sure the source file has read permission. . Be sure the target directory has write permission. (Use SET HINTS OFF to suppress hints.) ************************* RECEIVE- or GET-class command failed. Packets received: %d Packet length: %d Transfer canceled by sender. Sender's message: "%s" Most recent local error: "%s" . Did you start a Kermit SERVER on the far end? . Did you start a Kermit SENDer on the far end? . Choose a different FLOW-CONTROL setting and try again. . Is the other Kermit in (or does it have) SERVER mode? . Try smaller packets (SET RECEIVE PACKET-LENGTH). . Try a smaller window size (SET WINDOW). . As a last resort, give a ROBUST command and try again. . Give a ROBUST command and try again. . Try telling the %s to SET PREFIXING ALL. serversender . Try giving a ROBUST command to the %s. on_closeCommand file terminated by error. Command error: macro terminated. ?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersCommandText to be ignored ?Invalid - "%s" Command stack: ?Invalid: %s Kermit command error in background execution%syFyyyyyyyyyyyyy*yyyyyyyyyyyy>> %s: "%s" >>> %s: (undef) ?addmmac malloc error: %s !addmmac internal error! on_exiton_logout?addmac malloc error 2 addmac macro error 7: %s ?Macro table overflow ?Addmac: Out of memory - "%s" ?Space exhausted - "%s" [%d] -F: "%s" _for_swi_whi[%d] -M: "%s" ?Packet log wasn't open ?Session log wasn't open ?Connection log wasn't open ?Unexpected log designator - %d ZBBB(null)offautomatic(unknown)\{%d}%c Versions: %s Numeric: %ld Built for: %s Patches: %s (none) %s for%s %s %s %s Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminalTERM %19s: %-13s %13s: %-15s TypePrintEcholocalremoteLocking-shiftNewline-modeCr-displaycrlfnormaluncheckedno-inputunchecked-no-inputAPCAutodownloadon, error stopon, error continue %19s: %-13d %13s: %-15d HeightWidthDebugSession log %19s: %-13s Trigger %19s: %-13s Suspend CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: Set file type: %s Set file patterns: %s (but SET FILE SCAN ON overrides) Maximum patterns allowed: %d File binary-patterns: File text-patterns: (none) {%s} %s Output pacing: %d (milliseconds) Output special-escapes: %s Input autodownload: %s Input cancellation: %s Input case: %s observeignore Input buffer-length: %d Input echo: %s Input silence: %d (seconds) Input timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Array name?Bad array: %s Array not declared: %s \&%c[]: Dimension = %d (Link to \&%c[])%3d. %s Declared arrays: \&%c[%d] => \&%c[] No arrays declared Macro nameMacros: %s - (not defined) %s - ambiguous No network support in this version of C-Kermit. %d Server timeout: %d Server idle-timeout: %d Server keepalive %s Server cd-message %s Server display: %s Server login: "%s", "%s", "%s" Server get-path: (none) %d. %s SUCCESSFAILURESorry, command disabled. Variable name or pattern* The following functions are available: \F() \v(%s) = Global variables: \%%%c No variables defined Macro arguments at level %d (\v(argc) = %d): (NULL) \%%%d = %s \&_[%d] = %s Top-level arguments (\v(argc) = %d): Type SHOW DIAL to see DIAL-related items. Type SHOW MODEM to see modem-related items. Command quoting: %s Take echo: %s Take error: %s Macro echo: %s Macro error: %s Quiet: %s Function diagnostics: %s Function error: %s Script echo: %s Command buffer length: %d Atom buffer length: %d File type: %s Terminal bytesize: %d Terminal echo: %s Transmit EOF: ^%c Transmit Fill: %d Transmit Fill: (none) Transmit Linefeed: %s Transmit Prompt: %d (%s) Transmit Prompt: (none) Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d (millisecond%s) s Transmit Timeout: %d (second%s) Escape character: Ctrl-%c (ASCII %d, %s): %s , speed: unknownauto, carrier: %s, timeout: %d sec, timeout: noneType SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Character set translation is not supported in this version of C-Kermit Exit warning %s always Exit on-disconnect: %s Exit hangup: %s Current exit status: %d Printer: %s%s | (default) Command autodownload: %s Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s Command interruption: %s Command quoting: %s Command doublequoting: %s Command more-prompting: %s Command height: %d Command width: %d Hints: %s Quiet: %s Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d (not defined)on_unknown_command ON_UNKNOWN_COMMAND: %s Suspend: %s Access to external commands and programs%s allowed notAlarm at %s %s (no alarm set) send-list is empty %s, mode: %s, alias: %s Triggers: (none) Triggers: "%s" Most recent trigger encountered: "%s" Packet log: %s Session log: %s Connection log: %s Reliable: %s Clearchannel: %s Streaming: %s Streaming will be done if requested. Streaming will not be requested and will not be done. Streaming will be requested and will be done if the other Kermit agrees. Last transfer: %sstreaming%s, %ld cps. no , clearchannel --nointerrupts --bannerfile=%s --cdfile:%s --cdmessage:%d --helpfile:%d --wtmplog:%d --wtmpfile=%s --anonymous:%d --privid:%d --permission:%04o --initfile:%s --userfile:%s --root:%s --xferlog=%d --xferfile=%s --timeout=%d --database=%d --dbfile=%s (db directory=[%s]) IKSD conf=%s CDPATH current directory: %s previous directory: %s cd path: %s cd message: %s server cd-message: %s cd message file: %s Nothing to show... L݄gL؀݄d݄݄倅݄|:YφϹȷQA逅Y݄ĸրo8݄ĭѽр܀逅v݄݄݄݄c՜݄"݄݄݄݄݄݄[oֳz8CN݄݄և٣E݄6B`i/r{ِ݄Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s Protection: %s %s = Too long - "%s" Bad number - "%s" စစစစစစစစစစစစစစစစ?Divide by zero р2<<<ǀ<<<<+-|<>#@?Extra characters after expression ?Missing right parenthesis ?Operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript missing or not numeric ?Array dimension or subscript not positive or zero ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m()Macros nested too deeply ?TAKE files and DO commands nested too deeply %0[%d] +M: "%s" \flit(+-\fjoin(&_[],{ },1)..Carriage return for home directory, or name of directory on this computeron_ctrlcINPBUFSIZ=%dINBUFSIZE=%dOBUFSIZE=%dXFRCANXPRINTPIPESENDCK_SPEEDCK_FASTCK_APCCK_AUTODLNOMKDIRMINIDIALWHATAMIDYNAMICCMDDEP=%dDEVNAMLEN=%dINCL_PARAM_HCKMAXPATH=%dCKMAXOPEN=%dZ_MAXCHAN=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dUIDBUFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMAXWLD=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXCK_TMPDIRNOFRILLSPARSENSETIMEHCK_NEED_SIGCK_TTYFDTNCODETTLEBUFIKS_OPTIONIKSDBIKSDCONFCK_LOGINCONGSPDNOSETBUFPATTERNSCKEXECNOKVERBSATTSVSVORPOSIXOS2ORUNIXVMSORUNIXu3bu3b2__STDC____GNUC__CK_ANSICSIG_IUSE_MEMCPYHWPARITYCK_TTGWSIZCK_NAWSMDMHUPDCMDBUFCK_RECALLCK_TIMERSTTSPDLISTCK_PERMSCKTUNINGNOFTPNOHTTPSTREAMINGUNPREFIXZEROCKREGEXZXREWINDCKFLOAT=doubleMajor optional features included: External XYZMODEM protocol support RESEND command Control-character unprefixing Streaming Autodownload Internet Kermit Service with user login support Major optional features not included: No fullscreen file transfer display No transaction log No debugging No built-in help No network support No Kerberos(TM) authentication No SRP(TM) (Secure Remote Password) protocol No Secure Sockets Layer (SSL) protocol No Transport Layer Security (TLS) protocol No encryption No X Windows forwarding No Telnet Remote Com Port Control Option No SOCKS No built-in FTP client No built-in HTTP client Support for most modem types excluded No hardware flow control No character-set translation No SET KEY command No REDIRECT or PIPE command No pseudoterminal control None att3b2Target: %s GCC version: %s 2.3.3Compiled %s %s, options: Nov 12 200113:01:49byte order: littlebig endiansizeofs: int=%ldlong=%ldshort=%ldchar=%ldchar*=%ldfloat=%lddouble=%ld/all/after/ask/before/directories/dotfiles/except/heading/l/larger-than/list/log/noask/nodotfiles/noheading/nol/nolist/nolog/nopage/not-after/not-before/not-since/page/quiet/recursive/simulate/since/smaller-than/summary/tree/type/verboseC<CACHCMCUCbCl CtC}CCCCCCCCCC CCC C CD D D DD+D4D:D@ C}CCCCCCD@/append/fromb64/swap-bytes/tob64F4F<C}CCCCCCFEFQD@ /as-name/binary/calibrate/command/delete/filenames/filter/image/move-to/pathnames/pipes/recover/rename-to/subdirectories/text/transparentFFFG @GClGG$HG,G3G<GG"HCGND GWGb Gr Gx!/protocolFFFG @ClGG$HG,G3G<GG"HHpCD GWGr Gx!cdctsdsrfilemodem-signalsriILIOISIWI\IjILIOISIjcreationdeletionmodificationIIJ::=:==J8J<J?!read!writeappendhostlineportreadwriteJlJrJyJ JJJJ!!=&&()<<===>>=absolutealarmandasktimeoutavailablebackgroundc-kermitcommandcountdcldeclareddefineddirectoryemulationequalerrorexistfailurefalseflagfloatforegroundguiiksdintegerk-95kbhitkerbanglgtlltlocalmatchms-kermitnewernotnumericokopenorquietreadableremote-onlystarted-from-dialersuccesstapitrueversionwildwriteable||KK*K&K(K )K KJ?KK KK!K"K(&K,#K7"KAKL,KU1K]Kc7Kg7KpKxKKKKKKK K2KK8K3KK-K4K5K K K0KK.LL LLLL'L!+L'$L0L<LPLXL]Lb6Lj/Lo%Ly'L|=!read-file!write-fileappend-fileconnectioncx-logdebug-logpacket-logread-filescreensession-logtransaction-logwrite-fileOl Ow O O"OaOK'OO OOOO cryptoencryptionk4k5kerberos4kerberos5krb4krb5ntlmsrpssltlsPPPPPPPPPPPPL|  /timeoutQL|Variable name or switch?This switch does not take an argument ?This switch requires an argument seconds1Variable name?Variable name required ?Read file not open ?Oops, no READ buffer! Prompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).?Timed out, assuming "No" Please respond Yes or No ?Timed out Please respond.by amount?Variable %s not defined or not numeric %s (SELECTED) (OK) (FAILED) /matchingCSD D@?Memory allocation failure Macro or variable name %s...error ?UNDEFINE /MATCH can't be used with arrays. (Type HELP ARRAY to see other methods.) undefined: %d, errors: %d ?Name too long: "%s" operatorDefinition of variable?Argument vector array is read-only Definition of array elementDefinition of macro?%s failed ASSIGNDEFINEError - No phone number to convert ?Too long: "%s..." Error - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined WARNING - Prior SET DIAL AREA-CODE needed rw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK Opening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippedtimeout (seconds)0Number to dial or entry from dial directoryNumber to dialSorry, dialing is disabled. Please SET HOST first, and then SET MODEM TYPE Sorry, you must SET MODEM TYPE first Sorry, you must SET %s or SET HOST first LINE/dev/null Sorry, you must SET SPEED first ?Lookup what? %s ?No DIAL command given yet?You must specify a number to dial Lookup: "%s" - not found%s - dialing as given Lookup: fatal error - dialing skipped %s => %s ?Bad phone number WARNING - memory allocation failure: redial number Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... WARNING - No modem signals detected. Is your modem turned on? If not, use Ctrl-C to interrupt dialing, turn on your modem, then %s. ANSWER againREDIALWARNING - SET FLOW RTS/CTS is in effect but modem's CTS signal is off. Disabling flow control temporarily %s... while waiting for callduring dialing Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number TESTING... Number: "%s" => "%s" Number: "%s" Will redial in %d second%s- press any key to redial immediately. Ctrl-C to cancel... %c ************************* DIAL-class command failed. Modem type: %s Device: %s Speed: %ld Dial status: %d [%s] . SET DIAL TIMEOUT to a greater value and try again. . Is the modem turned on? . Are you using the right communication port? . Is the modem connected to the telephone line? . Please choose a specific modem type with SET MODEM TYPE and try again. SET MODEM TYPE ? to see the list of known modem types. . Are you sure you have chosen the appropriate modem type? . Maybe the interface speed (%ld) is too fast: SET SPEED to a lower speed and try again. SET SPEED ? to see the list of valid speeds. . SET MODEM HANGUP-METHOD RS232 and try again. . SET MODEM HANGUP-METHOD MODEM-COMMAND and try again. . If that doesn't work, try again with SET DIAL HANGUP OFF. . Give a HANGUP or SET DIAL HANGUP ON command and try again. . Use SET DIAL DISPLAY ON to watch the dialog between Kermit and modem. . SHOW COMMUNICATIONS, SHOW MODEM, SHOW DIAL to see current settings. (Use SET HINTS OFF to suppress future hints.) ************************* p€ppҀpppppppppҀppҀppp?Can't open output file %s: %s ?Not a regular file: "%s" ?Can't open file: "%s" ^C... %4d. %s: %d line%s s%s: %d match%s es/count/nameonly/nobackupfiles/nocase/nomatch/output/linenumbersdCbdddCCdCd d C CD D: L|String or pattern to search for, or switchVariable for resultFile for GREP'd lines?Pattern required File(s) to search?File specification required *.~[1-9]*~%s:%s%s:%d ׀wZ 򀆂M"-=hvĀ11::1&/array/ascending/backup/brief/descending/englishdate/files/isodate/message/nomessage/norecursive/nosort/noxfermode/reverse/sort/xfermodeCA C<ff fCM"ff CUCbfClfCtfCfdCCfCfg C!C#C! g d(CD g D Dg D+$D:%g&D@L|'datenamesizeiiiDIRECTORY/DIRECTORIES/ALL/FILES/VERBOSE/BRIEF/PAGE/NOPAGE/ENGLISHDATE/ISODATE/DOTFILES/NODOTFILES/BACKUP/NOBACKUP/HEADING/NOHEADING/RECURSIVE/NORECURSIVE/XFERMODE/NOXFERMODE/NOSORT /SORT:NAME/SORT:SIZE/SORT:DATE/REVERSE/ASCENDING/NOMESSAGE/MESSAGE:{}(no options set)SwitchSort keyMessage to append to each line?This option can not be set   )3>~ဆ뀆 HShs] *4G=Enter or Return to confirm the command, or file specification, or switchFile specification*File size in bytes?Array name required Array name (a single letter will do)?Bad array name - "%s" File-time?Date-time required PatternallFile for directory listing?Sorry, not implemented yet - "%s" does not match switch or name of accessible filenot found or not accessible"%s" - %s ?Array declaration failure ?Empty directory - "%s" ?%s %s match - "%s" NoToo manydirectoriesfiles* Warning: Failure to allocate memory for sorting. * Will proceed without sorting... Directory of %s Files: %d 00000000 00:00:00xxx%2d-%s-%4d %02d:%02d:%02d%10s%-10s %s %s%-10s %s %s%10s%10ld %s %s%10ld %s %s (T) (T)(7BIT) (T)(8BIT) (B) %s?Memory allocation error - try /NOSORT %ld director%s, %ld file%s, %ld byte%syies (%0.2fGB) (%0.2fMB) ƀҀ5̀׀〆݀뀆 ! /$,ǀǀǀǀEQOi󀆦瀆 Arguments for lsDirectory and/or file specificationCK_DIR?ELSE doesn't follow IF command to be ignored{}Closing parenthesis?Closing parenthesis required _switx {series of cases{ }?Unbalanced braces _switx?SWITCH macro definition gone! _forx initial value%dfinal value-1incrementCommand to execute_forx?FOR macro definition gone! _forz?Incomplete FOR command seconds to wait, or time of day hh:mm:ssseconds to pause, or time of day hh:mm:ssmilliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required eventFilename?Wildcards not valid here modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. ?File does not exit: %s ?Can't get modification time: %s ?Can't return from level %d _xif_for_swi_whi<<< %s: "%s" <<< %s: (null) mode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled System command to read from?Command name required ?Write to pipe disabled ?Write file already open System command to write toCan't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedπʇ܀€€hhthis commandRECEIVEGETREGETRETRIEVECRECEIVECGETMGET?Sorry, %s works only with Kermit protocol Optional name/template to store incoming files under, or switchRemote filename, or switchOutput filename or CommandFile(s) to GETRemote filename?Sorry, system command access is disabled ?Sorry, no GET /COMMAND when RECEIVE FILTER selected Command, or switchon?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending?Destination required?New name required?Sorry, as-name not allowed with MGET Name to store it underFilter program to receive through?Filter must contain a replacement variable for filename. convertedFile-transfer protocol?Sorry, this command works only with Kermit protocol ?Unexpected switch value - %d ?Unexpected function code: %d Local command to pipe intoName or directory for incoming file?A remote file specification is required ?Command required ?Sorry, no GET /COMMAND while RECEIVE FILTER selected ?A Kermit Server is not available to process this command Sorry, you must specify a name when receiving a file with XMODEM protocol ?Sorry, /MOVE-TO not available to guests ?Directory "%s" not found ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?Can't get current directory ?Can't access %s 0Ӊb&&&&&Ӊ@&&0䀆eۄf00&&ؽڗվվӉ&&&&&&ӉӨFORWARD_FORWARDGOTO?Bad label syntax - '%s' ?Sorry, %s only works in a command file or macro :default?Label '%s' not found ?Stack problem in GOTO %s ]Number, numeric-valued variable, Boolean expression, or keywordArray nameDirectory nameFile?File or directory name required first word or variable name?Text required ?IF: strings too long second word or variable namefirst number or variable name?Quantity required argcnumber or variable namevariable name or constantFirst fileSecond file?Failure to get file date file or logString or variable?String required File or directory nameWord?Boolean expression too long ۀ  倇 ꀇ Object commandelse?XIF macro gone! { \flit(if ( not ) goto _..bot) } ?Internal error parsing WHILE condition _while?WHILE macro definition gone! ?Can't allocate storage for WHILE command?TAKE files and/or DO commands nested too deeply [%d] +F: "%s" /connect/server$-5binary-patternsbytesizecollisiondefaultdestinationdisplaydownload-directoryend-of-lineeoleoffastlookupsincompleteinspectionlistsizenamesoutputpatternspermissionsprotectionscanstringspacettext-patternstypewarningt '  '27CESXabsolutenoneoffonrelativeautoctrl-zlengthnoctrl-zDKRasciibinarytextblockingbufferednonblockingunbufferedglobalkermitsystemuserDGKKRSYGdynamicfixedechofilllinefeedlocking-shiftpauseprompttimeoutappendbackupdiscardno-supersedeoverwriterenameupdate5record-length ,Scrcrlflf|  convertedliteralstandardapcautodownloadcr-displaydebugescape-characterheightnewline-modeprinttransparent-printtriggerwidth  '.;4A4S0S[5error(5continuegostopdmpnormalno-inputuncheckedunchecked-no-inputaudible(5undefinedtbriefcrtquietserial5packet-lengthcontrol-prefixdouble-characterend-of-packetfilterignore-characteri-packetsmove-tonegotiation-string-max-lengthpad-characterpaddingpathnamesquoterename-tostart-of-packettDS5drZyXu`Gv5attributesblock-checkfilereceiveretryservertransferwindowxfer"  #%$%% alldatedispositionencodingformatrecord-formatsystem-id K'S buffer-lengthcancellationcasedefault-timeoutsilencetimeout-action proceedquit4<ignoreobserve\cdisabledenabled ?Value required %s?Not a number: %s ?Sorry, %d is the maximum Control character, numeric ASCII value, or in ^X notation, or preceded by a backslash and entered literally ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d /case/key/numeric/range/reverse(/Array name or switchArray name?This switch does not take arguments Column for comparison (1-based)1low:high element?Not numeric: %s ?Unexpected function code: %d ?Array name required Second array to sort according to ?Bad array name: %s ?Array not declared: %s ?range %d:%d exceeds array dimension %d ?Bad range: %d:%d ?Array %s smaller than %s ! !z#=/after/ask/before/delete/dotfiles/except/heading/keep/larger-than/list/log/noask/nodelete/nodotfiles/noheading/nol/nolist/nolog/nopage/not-after/not-before/not-since/page/quiet/recursive/since/simulate/smaller-than/verbose  "+1 >DI PZfqv~ŅōŘŤ ůŵż  PURGE/ASK/NOASK/DOTFILES/NODOTFILES/KEEP:/LIST/NOLIST/HEADING/NOHEADING/PAGE/NOPAGE(no options set)Switch?This switch does not take an argument ?This switch requires an argument How many backup files to keep?Please specify a number between 0 and %d ?This option can not be set *+x+++++++x++++++++++++++Filename or switchFile-time?Date-time required File size in bytes0Pattern?Pattern required ?Not implemented yet - "%s" .~[1-9]*~*.~[1-9]*~?File deletion by guests not permitted. Purging %s, keeping %d...%s (SIMULATION) %s (SKIPPED) Delete ? %s (%s) OKSELECTED %s (FAILED) Matches = %d: Not enough to purge. DELETEDERROR %s (KEPT) %s.~*~ (KEPT) Files purged: %d%s (not really)/F/ۀ//0 0/倇212100(110101010112'112000ƀ0file transfer display styleRemote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 local text-file line terminatorhow to handle filenames301file record length312type of file transfer300Filename collision action?This command not valid for guests 3023102Name of local directory, or carriage return?Wildcards not allowed in directory name end-of-file detection methodoutput file writing methodoutput buffer size32768?Bad size - %d MEMORY ALLOCATION ERROR - FATAL How much to scanMaximum number of filenames?Memory allocation failure Number of characters for filename list?unexpected file parameter FFFF Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. ?Sorry, command disabled. bytesize for terminal connectionwhich side echos during CONNECTremoteapplication program command executionAuto-download optionsnumber of columns on your screen8024number of rows on your screenString to trigger automatic return to command modeLMRMhMzRMRRRRNRRORPހRRRRRRQQ RRROŀRRRNRRRRRRRRRRRRRRRR8RRRRWhether Kermit should ring the terminal bell (beep)Confirm with carriage returnParameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character 13Sorry, the legal values are 0-31 Maximum number of characters in a packet90?Sorry, this command does not apply to %s protocol. Use SET SEND PACKET-LENGTH for XYZMODEM Sorry, 10 is the minimum 401 Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Adjusting packet size to %d for %d window slots Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start characterHow many padding characters for inbound packetsPacket timeout interval402?Out of range - %d Minimum timeout to allowMaximum timeout to allowMilliseconds to pause between packets?Internal error - malloc failure Character to doubleCharacter to ignorenonnon?Please specify a number or the word NONE ?Please enter a character code in range 0-255 Filter program for sending files - use \v(filename) to substitute filenameFilter program for receiving files - use \v(filename) to substitute filename?Filter must contain a replacement variable for filename. Max length for protocol init string-1?Please use SET FILE COLLISION to choose the desired action Directory to move file(s) to after successful transferTemplate to rename file(s) to after successful transferCharacters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill characterNumeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmissionSeconds to wait for each character to echolllkm1lmCm Type your escape character, %s, followed by X or E to cancel. > filename, | command, or type carriage return to confirm the command?"%s" has no effect in remote mode ?Not confirmed ?%s missing FilenameCommand?Access denied - %s ?Sorry, access to external commands is disabled. Hint: Try again with an output redirector. ?No connection User ID?Internal error: malloc PasswordAccountUsername: ?Canceled Password: ?Parameter name required ?Sorry, REMOTE CDUP not supported yet Remote directory nameName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specificationCommand for remote systemConfirm, or remote directory nameRemote function invocationRemote variable name or functionQRemote variable name?Too long Assignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to renameNew name of remote fileName of remote directory to createName of remote directory to delete?Name required ?Not implemented - %s :z{#{ʀ|f|s}\}〇~*?nzc?File specification required File Attribute packetsSorry, command not available 132143142141135133139134145146147?Not available g)Uۀۀр;Positive numberSeconds of inactivity before INPUT failsNumber of bytes in INPUT buffer݀l Wv Closing connection on_closeMaking connections is disabled?Sorry, making connections is disabled Network connections not supported?%s Device name, or switchInternal error?Internal parsing error Timed out - no carrier?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Access to lock deniedSorry, write access to UUCP lockfile directory denied. ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Access to device deniedSorry, access to device denied: %s Device is in use or unavailableSorry, device is in use: %s Device open failedConnection to %s failed: %s Sorry, can't open connection: %s on_openhistory5What to savescrollbk.txthistory.txt?Sorry, %s is a directory name Dispositionnew5?Command disabled IKS Settings Anonymous Initfile: %s Anonymous Login: %d Anonymous Root: %s Bannerfile: %s CDfile: %s CDMessage: %d DBfile: %s DBenabled: %d Helpfile: %s Initfile: %s No-Initfile: %d Privileged Login: %d Server-only: %d Syslog: %d Timeout (seconds): %d Userfile: %s Wtmplog: %d Wtmpfile: %s Xferfile: %s Xferlog: %d Your username, or "ftp", or "anonymous" Login cancelled anonymousftpEnter e-mail address as Password: Enter 's Password: Enter Password: Login cancelled րĀրЀMWr`rlRemote file not olderIdentical modification timesTypeSizeName collisionException ListDot fileBackup fileRecovery not neededAccess deniedNot a regular fileSimulatedSimulated - Remote file olderSimulated - No remote file'DIN]lu偀啀壀嶀/dev/cua, /dev/acu, /dev/tty0, etcError number out of range*.txt*.c*.h*.r*.w*.cpp*.cc*.ksc*.bwr*.upd*.html*.htm*.mss*.tex*.nr[Mm]akefile*.hex*.hqx*.for*.f77*.f*.F*.s*.pas*.java*.el*.lisp*.sh*.m4*.perl*.pl*.pod*.pm*.awk*.sno*.spt*.sed*.TXT*read.me*READ.ME.**/.**.mem*.mac*.bat*.cmd*.jav*.asm*.hpp*.cxx*.makread.me*.mapmakefile*.com*.rno*.rnh*.mar*.bli*.hlp*.doc*.cld*.bas*.ini*.log*.mms*.opt*.sai*.pcl*.b36*.pub*.req*.r36*.ccl*.ctl*.ttp*.cm*.pl1*.emacs*.er*.cli*.a*akefile"&*.28=CIOV\bhmy酀鋀鑀镀陀靀飀骀鯀鶀黀ǀ̀Ҁ׀݀〒递= =VO!'-y"&2399.飀CI?EMS8ǀ̀Ҁ\"酀靀bhntz\ꀀCꆀyꌀꒀꘀꞀ꤀=ǀ̀Ҁ݀〒=VO!'-y"&2399.飀CI?EMS=V!'-y"&2399.CI?EMS!zꀀꒀ酀ꪀt靀݀〒가\b궀b꼀€ȀC΀Ԁh=!zꀀꒀ酀ꪀt靀݀〒가\b궀b꼀€ȀC΀Ԁh==VO!'-y"&.飀CIڀ倒뀒EǀS"&.CIE="2&酀鋀鑀镀陀靀飀骀鯀鶀׀݀〒递.=CIOV\bhy *.gz*.Z*.tgz*.gif*.tar*.zip*.o*.so*.out*.exe*.jpg*.jpeg*.tif*.tiff*.pdf*.so.**.class*.rpm*.bmp*.bz2*.BMP*.dll*.vxd*.dcx*.xl**.lzh*.lhz*.au*.voc*.mpg*.mpeg[wk]ermitkrbmit*.obj*.wav*.ram*.cla*.drv*.ocx*.vbx*.lib*.ico*.snd* .voc*.bak*.bin*.adf*.stb*.mai*.sys*.dmp*.dat*.par*.sav*.rim*.rel*.unv*.tap*.dvi*.ob*.pr*.z*.ar*.zoo*.l*.pcx !'-16 Size: %ld, Type: Size: unknown, Type: , STREAMING File Percent Packet Bytes Done CPS Lengthހ̮̾%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld %s %sSENDRECV (%s) (%ld byte%s)s: OK (%d sec, %ld cps) [OK]: DISCARDED [discarded]: INTERRUPTED [interrupted]: WOULD BE TRANSFERRED (New file) : WOULD BE TRANSFERRED (Remote file older) : WOULD BE TRANSFERRED : SKIPPED (%s) : SKIPPED Would Send: Would Receive: [simulated] [skipped]: ERROR: %s Error: Message: : REFUSED Refused: : INCOMPLETE [incomplete]*** screen() called with bad status ***%c SUMMARY: %ld file%s, %ld byte%s, %ld sec, %ld cps. ERROR: %s WARNING: %s : *** screen() called with bad object ****ѧJҀn?Ȁۿ Qܤڀ)jlҫGӨဇՀZÀ' Closing %s...OK on_closeon_exiton_logout09K].%03ld: ERROR WRITING SESSION LOG, LOG CLOSED!%s   0ASdhlp  r+/var/log//iksd.db%s%s%s000000000000INIT7F000001%08lx:%010ld %s%08lx.%lx%s%siksd.lck%s iksdtelnetDIP [filename] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. If the first command-line argument is the name of a file, interactive- mode commands are executed from the file. The '=' argument tells Kermit not to parse the remainder of the command line, but to make the words following '=' available as \%1, \%2, ... \%9. The command file (if any) is executed before the command-line options. If no action command is included, or -S is, then after the command line is executed, Kermit issues its prompt and waits for you to type commands. πрdEπuP [option-list] host[:port] [port] The option-list consists of zero, one, or more of: -8 Negotiate Telnet Binary in both directions -a Require use of Telnet authentication -d Turn on debug mode -E No escape character -K Refuse use of authentication; do not send username -l user Set username and request Telnet authentication -L Negotiate Telnet Binary Output only -x Require Encryption -D Disable forward-X -T cert=file Use certificate in file -T key=file Use private key in file -T crlfile=file Use CRL in file -T crldir=dir Use CRLs in directory -T cipher=string Use only ciphers in string -f Forward credentials to host -k realm Set default Kerberos realm <`ր8a퀓&NuπOP"" - Usage: Complete listing of command-line options: -%c %s (action option) %s Argument: %s -%c %s%s Argument: (none) To prevent this message from scrolling, use '%s -h | more'. For a list of extended options use '%s --help'. +--invalid command-line option, type " -h" for helplocal action=%c No actions or connections allowed with -A-l or -j or -X required-a without -s, -r, or -gcan't change to '-a' directorywrite access to -a file deniedunredirected -k can only be used in local modeanonymousbannerfilecdfilecdmessagecdmsgdatabasedbfilehelpinitfilenointerruptsnopermsprividroottimeoutuserfileversionwtmpfilewtmplogxferfilexferlog"(" "+"2"< "B("K("R"W("` "m"u("| ("(" ("" ("("("(P0123456789falsenooffokontrueyes########## #######--anonymous:{on,off} [IKSD only]Whether to allow anonymous IKSD logins--privid:{on,off} [IKSD only]Whether to allow privileged IDs to login to IKSD--bannerfile:File to display upon startup or IKSD login--cdfile:File to display when server changes directory--cdmessage:{on,off}Whether to display CD message file--helpPrint this help text about extended options--helpfile:File containing custom info for HELP command--xferfile: [IKSD only]Name of ftpd-like logfile.--xferlog:{on,off} [IKSD only]Whether to keep an ftpd-like logfile.--initfile: [IKSD only]Initialization file for anonymous users.--root: [IKSD only]File-system root for anonymous users.--userfile: [IKSD only]Forbidden user file.--wtmpfile: [IKSD only]Name of wtmp logfile.--wtmplog:{on,off} [IKSD only]Whether to keep a wtmp logfile.--timeout: [IKSD only]How long to wait for login before closing the connection.--nointerruptsDisable keyboard interrupts.--database:{on,off}Enable/Disable IKSD database (IKSD only)--dbfile:Specify IKSD database file (IKSD only)--nopermsDisable file-transfer Permissions attribute.ՀE}퀇%]̀=u倈U 100% transparent CONNECT mode for "in-the-middle" operationConnection is 8-bit cleanKermit is to be started as an Internet serviceKermit is running in Batch or Background (no controlling terminal)Interactive-mode Commands to be executedCommands separated by commas, list in doublequotesDelay before starting to sendNumber of secondsExit automatically when connection closesGET from server, send to standard outputRemote file specificationSuppress program startup Herald and greetingConnection is reliable, streaming is allowedRecursive directory descent for files in -s optionMy user name (for use with Telnet, Rlogin, etc)Username stringBe a server for One command onlyDon't convert file (Path) namesQuick (FAST) Kermit protocol settingsRemote-only (makes IF REMOTE true)Stay (enter command parser after action options)Transfer files in Text modeDisable automatic per-file text/binary switchingSkip initialization fileAs-name for file(s) in -s, -r, or -gAs-name string (alternative filename)Speed for serial deviceNumeric Bits per secondCONNECT before transferring filesCreate debug.log file (a second -d adds timestamps)Maximum length for incoming file-transfer packetsLength in bytesSend Finish command to a Kermit serverGET file(s) from a Kermit serverPrint this message (pipe thru 'more' to prevent scrolling)Transfer files in binary modeRECEIVE file(s) to standard outputMake connection on serial communications deviceSerial device nameModem type for use with -l deviceModem name as in SET MODEM TYPE commandCONNECT after transferring filesParityOne of the following: even, odd, mark, none, spaceQuiet (suppress most messages)RECEIVE file(s)SEND file(s)One or more file specificationsXON Turnaround character for half-duplex connectionsWindow sizeNumber, 1 to 32Incoming files Write over existing filesBe a Kermit SERVERAlternative initialization fileFile specificationForce foreground behaviorN  瀈>v ) \ ǀBuۀ  A t䀈,_߀,t  ' _ ߀  Z ڀ  E %s [%s] 6ʀҀeeF6ƀej1E~Glogin"W3"| Pno-initfileserver-only"" "+"2"<"B "K "W3D"u 3P""""""Filename?Wildcards not allowed list of cd message file namesREAD.MEName of disk and/or directorylogin timeout, seconds?Value must be between 0 and 7200 Alternate init file specificationd〈^(# HYހExtended option errorNo commands given for -Cinvalid argument bundlingmissing delay valuebad delay valueconflicting actionsinvalid argument bundling after -s-.No files for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedinvalid argument bundling after -gmissing filename for -ginvalid argument bundling after -amissing name in -ainvalid argument bundling after -ymissing filename in -yinvalid argument bundling after -l or -jcommunication line device name missing/dev/ttycan't open deviceon_openmissing bpsunsupported transmission rateinvalid argument bundling after -mmodem type missingunknown modem typeinvalid argument bundling after -emissing lengthUnsupported packet lengthmissing or bad window sizemissing parityinvalid paritymissing usernameusername too longinvalid command-line option, type "kermit -h" for help 2倈 }2倈2倈/2倈2倈2倈2倈2倈2倈"0/2倈2倈2倈2倈2倈2倈2倈2倈"1 !x"V2倈&2ۀ)[2倈2倈11؀2倈"€2ˀ"""d"y2倈0P2倈2倈(Ȁ2倈2倈2倈2倈2倈2倈2倈((+'߀2倈-#&'/2倈#),'퀈2倈0l/ #y$1k2倈./̀"€(ր11(1<1<1<1<1<1<1<1(131(1<1<1<1(Extended options not configuredmissing realmmissing cert=, key=, crlfile=, crldir=, or cipher=invalid command-line option, type "telnet -h" for help3t6Z3t6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z36Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z5/36Z6Z6Z6Z6Z45 6Z6Z6Z6Z6Z6Z6Z5Ҁ6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z3倈6Z6Z36Z5<6Z36Z6Z5B46Z6Z6Z6Z6Z6Z6Z6Z6Z6Z6Z5User Interface 8.0.247, 10 Nov 2001@binary-patternssend-listtext-patterns@@@@/off/onAPAU/redirectAt /binary/command/noecho/nowait/pipe/text/transparentAAAAAAAA@ !#(.:@^_asg_assign_decrement_define_evaluate_forward_getargs_increment_putargs_undefineaboutaddanswerapcarrayasciiasgaskaskqassassertassignassociatebackbeepbinarybugbrowsebyeccautiouscdcdupcgetchcheckchmodckermitclclearcloseclscommentconnectcwddatedcldebugdeclaredecrementdefinedeletedialdirectorydoeechoeightbitelseenableenderaseevaluateexexecexitextended-optionsffailfastfifinfindfinishfoforforwardfunctionggegetgetcgotogrephhehangupHELPiifiksdinincrementinputintrointroductionkermitlearnliLICENSElineoutlocallogloginlogoutminputmgetmkdirmmovemovempausemputmsmsendmsleepnewsnolocalnopushoopenoutputpausepdialpoppromptpsendptypupurgepushputpwdqqueryquitrrasgrassignrcdrcduprcopyrcwdrdeleterdirectoryreadreceiveredrediredialredoregetreinputremremoremoteremoveresreseresendresetretretrievereturnrexitrhelprhostrkermitrloginrmdirrmkdirrobustrpwdrqueryrrrrenamerrmdirrsetrspacertyperunrwhossavescscrscreenscriptsearchsendserversetsexpressionshshiftshowsortspacestastatstatisticsstatusstopsucceedsupportsuspendswitchtaketapitexttracetranslatetransmitundclundeclareundefineversionvoidwaitwermitwherewhilewrwriwritwritewrite-linewritelnxifxlatexmitzCAC*CCC.CACCXCXCCYCCCTDDUDD$?D*|D.qD5_D9D?sDE7DI5DM6DR7DVD]7DdDnDskDxtDDDDDDDDAD\D\DD~DDDDBD*DDDDGDDGD;EE E(EE"2E% E' E,E5<E:EA0EEEKhET EWE\ EaEr EtEyE~ E EE EHEHEiEE E E EgE/EEEE+EEE-EEE9EEEF~F FFFF"}F(F,F2F9dF@FEFKmFQlFV]F]PFbPFePFk]FrFwF{FFDFFFrF0FFfFAFCFF@FF3FFFFFFFFFFFGGEGGSG SG%SG,G1nG78G?GCGHGOGVeGZeG_eGfGlCGpGyCGGGGGGGGGGGGGGGGG@GGGG)G)GH)H HHHH!H- H0H6 H;H@!HF"HJ"HO"HZHa1HfHnHvN@H~H$HHsHHH%HHHzH?HH>H~HHIHAHAHAHAHaIaIJII%INA@!#(.;:@^{nookyesTlToTrcommandT@alarmask-timerattributesbbabackgroundbatchbaudbellblock-checkbufferscarrier-watchcaseclecleaclear-channelclearchannelclose-on-disconnectcmdconconsolecontrol-charactercountddedefaultdelaydestinationdidiadisconnectduplexeofescape-characterf-ack-bugf-ack-pathfileflflagflow-controlhandshakehintsiksincompletellinelocal-echomacromodemoptionsparityportprefixingprotocolq8flagqnx-port-lockquietrecrecvreliablerepeatretry-limitserserialsession-logsleepspeedstartup-filestop-bitsstreamingteltelnettelopttemp-directoryterminaltransferwildcard-expansionwindow-sizexferTKTrT"T3CT3CT3@T3ATTITU 2U.U!7DkDdU&dU*dDdU/dU=dUJoU^6T6UbUf6UnU'UUDU4UUTU0U0E0UoUU\UEKxE\EUsUyUU U^U EfV V wE V|E V E V!V#V(@F,NV3+V9FDV?pFhVGVNVSMV]LF?VfqVm{V{?V G V VaVVHAHV#VnH#V1H!VhVVOVmVbHv<@H(VCVCVjVPW !W%H/HhW;W0$W<%I/@icleolmove-toD\@\Fascopyhelphostrename\xDED]DD\{DE EE%EEE\\\FF\ GHH@@connectionscxpacketssession]]]]@append-filedebug-logerrorpacket-logsys$outputttrtratrantranstransatransactransacttransactitransactiotransactiontransaction-logtransactions]^^ U^GV^^&^(^+^/^4^:^A^I^R^\^g^s^bothdevicedevice-and-inputdevice-bufferdial-statusinput-bufferkeyboard-bufferTD5@_____ __@@G@@ !read!writeconnectioncx-logpread-filewrite-file``]`'`\'V#'`^VN'`V`@ argargumentsargsarrayscharacter-setscomcommcommunicationscontrol-prefixingdouble/ignoreescapefeaturesfunctionsglobalshistoryignore/doublelogsmacrosnetworkparameterspatternsprinterscriptsstacktcptriggervariablesT'ataxaaTD<aU^"aaaT"`>a]>UUUEa*aE\ Ea;aUU@aaaCa*EFE2b 4bV9bV??F5b!b,6b5!VSV]b= @(H H!DbEHZ V7bKBV1V1V:W ^( ^+ ^/ ^4 WAH bO3bWW<AI @B_F"GHallmailprinttypewhoe\xDED]DD\{DE EE:E\EE\eFEFe\GpGHH H@ e e eDxH/after/array/as-name/b/before/c/calibrate/delete/dotfiles/except/filter/filenames/image/larger-than/listfile/move-to/nobackupfiles/nodotfiles/not-after/not-before/pathnames/print/protocol/quiet/recover/recursive/rename-to/since/smaller-than/starting-at/subdirectories/typeg4g;gBgKgNAgV gY A @gdglgvg~Hgggggggggggghh h h!h, h3 hA hN A A!h^ $/listg4gNAgdgvgggjgggggghh h!h, h3 hA A A!h^ /quietly/triggerkDkM@/brief/verbosekk/count/head/match/more/nopage/number/output/page/prefix/tail/widthkkkkkk kkkkk@ assignmentscommand-levelell TYPE /PAGE/NOPAGE(no options set)/WIDTH:Switch?This switch does not take an argument Column at which to truncate?Sorry, this option can not be set abortaoaytbreakcanceldmarkdonteceleorgaipnopsaksbsesuspwillwontmmmmmmE"mmmUmmmmmmmmmmauthcom-port-controlcomport-controlencryptforward-xlflownawsnew-environmentpragma-heartbeatpragma-logonpragma-sspisend-locationsgastart-tlsttypexdisplay-locationn%Dxn,n,E'n&o1F/o !F2oo'o'o8oEmoQo_oc.omos#@o@_xif_for_whi_swi_array_x_Filename, or switchFile(s) to sendCommand?This switch does not take arguments ?This switch requires an argument ?Sorry, system command access is disabled ?Sorry, no SEND /COMMAND or CSEND when SEND FILTER selected Command, or switchPattern?Pattern required ?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending%s ?Destination required?New name requiredSize in bytes0File date-time?Date-time required ?Sorry, sending files as mail is disabled e-mail address?address required ?Sorry, sending files for printing is disabled Print optionsName to send under?name required 0-based positionFile-transfer protocol?name of protocol required Filter program to send through?Filter must contain a replacement variable for filename. absoluteconvertednumber of Kbytes to send1024Name of file containing list of filenames?Filename required ?Wildcards not allowed Array name (a single letter will do)?Bad array: %s ?No such array: %s ?Unexpected switch value - %d ?Sorry, %s works only with Kermit protocol CSENDSEND /COMMAND?Sorry, no /RECOVER or /START if SEND FILTER selected ?%s - "%s" No files matchFile not found?Unexpected function code: %d ?Sorry, a command to send from is required ?Sorry, /DELETE conflicts with /MOVE or /RENAME ?Sorry, /MOVE-TO not available to guests ?Directory "%s" not found ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?/RENAME for file group must contain variables such as \v(filename) ?Sorry, /BINARY required ?Sorry, wildcards not permitted with /START ?Sorry, this command needs 32-bit integers ?Sorry, SEND /START works only with Kermit protocol Sorry, /RECOVER is possible only with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON Sorry, you can only send one file at a time with XMODEM protocol Names of files to send, separated by spaces?MSEND list too long e-mail address (optional)e-mail address (required)printer options (optional) Optional as-name template containing replacement variables like \v(filename)Optional name to send it withCALIBRATION?Failure to open %s ?Filename required but not given ?Read access denied - "%s" ?Invalid switch combination ?As-name for file group must contain variables such as \v(filename) ?/STARTING-AT may not be used with multiple files. ?Bad array range - [%d:%d] ?A Kermit Server is not available to process this command. ?Start a RECEIVE command to complement this command. ?File deletion not allowed for guests. >ɀ>>AC'B B D>>ZAGY>ɀ=瀈>GF>ɀ>ɀB B H6IJ[@;@;JK'>>>LvMM?No switches match - "%s" String (enclose in braces if it contains spaces)?String required ?Too many patterns - %d is the maximum ?Sorry, REMOVE SEND-LIST not implemented yet. ?Sorry, ADD SEND-LIST does not work with external protocols File specification to add?A file specification is required WARNING - \v(filespec) buffer overflow type of file transfer As-name template containing replacement variables such as \v(filename)Name to send it withSorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list nodedestroyequatelinkresizeD\{DD}} } }HH6H;H@ Array name?Array name required ?Bad array name - "%s" ?Segment notation not allowed in array declarations ?Memory allocation error Initial value for \&[]=Carriage return to confirm?Declare failed Array initialization error: %s %s ?Bad array reference - "%s" New size?New size required ?Array not declared - "%s" ?Array segments not allowed for this operation ?Sorry, \&@[] is read-only Name of source arrayName of destination array?Partial arrays can not be destroyed ?Failed - destroy "\&%c[]" Value?Array %s is not declared Array name not currently in useName of existing array?Array already exists: \&%c[] ?Sorry, whole arrays only: %s ?Array is not declared: \&%c[] ?Links to links not allowed: \&%c[] Variable name?Variable name required Integer arithmetic expressionTELNET commandTELNET optionff%02x%02x XXTELOPTELNET SENT SAKUNKNOWNff%02x ـVkGpattern, or first few characters of a previous command*?Sorry, command recall can't be used now. ?Sorry - "%s" not found Trace object; Or switchTrace objectTRACE %s ONOFFOptional message?Command stack overflow: %d [%d] +P: "(prompt)" (Recursive command prompt; use END or RETURN to return...) ?Access to system disabled ?Connections disabled ?Sorry, DEFINE/ASSIGN disabled label?GOTO: Label name required: "%s" "%s" ?No macros defined Macro?Macro name required optional argumentsbraced list of commandson_unknown_command?Not a command or macro name: "%s" ?Not a command or macro name. ..tmp:%03d?LABEL: Label name required: "%s" Continuation of S-ExpressionS-Expression ("help sexp" for details)?SEXP too long - %d max ?Unbalanced S-Expression: "%s" %s ?Invalid S-Expression: "%s" TextApplication Program Command textText to be echoed"%s"%s%c_%s%c\?Too long ?No connection - use EXIT to quit. ?Sorry, BYE only works with Kermit protocol ?A Kermit Server is not available to process this command %cText of comment line?Sorry, changing directories is disabled "CONNECTION", or log or file to close?You must say which file or log ?Connection was not open ?Sorry, DIRECTORY is disabled Optional return valueText to be outputexit status codeOptional EXIT messageSorry, FINISH only works with Kermit protocol ?Sorry, reception of files is disabled Seconds to wait for input, or time of day hh:mm:ss?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. List of targetsMaterial to be input?INPUT timed out ?MINPUT timed out ?REINPUT failed What to log?Type of log required ?Already logged in ?No connection. expect-send expect-send ...?Sorry, CRECEIVE works only with Kermit protocol Sorry, REMOTE commands only work with Kermit protocol Remote Kermit server command?You must specify a command for the remote server ?Sorry, sending files is disabled Add to which list?Remove from which list?File to partially send?Sorry, wildcards not permitted in this command starting position (byte number)?Sorry, no PSEND while SEND FILTER selected Sorry, PSEND works only with Kermit protocol Sorry, SERVER only works with Kermit protocol optionkeymap?You must specify an option to save ?More fields required Parameter?You must specify a parameter to set ?Sorry, host command access is disabled Command to overlay C-Kermit or switchCommand to overlay C-Kermit?Command required ArgumentSystem command to execute?Sorry, SPACE command disabled Confirm for current disk, or specify a disk device or directoryCarriage return, or optionMessage to print?Sorry, IKSD can not be suspended ?Sorry, access to system is disabled ?Take files nested too deeply \v(home)Commands from file?A file name is required ?Wildcards not allowed in command file name ?Can't execute a directory - "%s" Optional arguments_file[%s](%d)take %sFile to transmit?Only a single file may be transmitted %s, for%s Numeric: %ld THIS IS A TEST VERSION, NOT FOR PRODUCTION USE. Patches: %s kermit command-line arguments, -h for helpkermit date and/or time, or carriage return for current?%s File most recently... Sent: %s (none) Stored as: %s Received: %s If the full path is not shown, then the file is probably in your current directory or your download directory (if any - SHOW FILE to find out). SUCCESSFAILURENumber of arguments to shift1?Sorry, DELETE is disabled screen actionRow (1-based)Column (1-based)?Row and Column must be 1 or greater Array operation?Sorry, not implemented yet - "%s" Rest of commandSorry, "%s" not configured in this version of Kermit. ۀGG䀈GӀ䀈ۀ-?]}}nvޓ޼䀈ޢǀـޯǀCONNECT Command for UNIX:fork(), 8.0.109, 10 Nov 2001av5bERROR: Failure to kill pid %ld: %s, errno=%d (Back at %s) local UNIX system Ҁ:ր|2*J?setuid error - fatal Communications disconnect Connection closed due to telnet policy Connection closed by peer Remote Logout set proto %s, %s, set proto %sserverreceiveWARNING: Old CONNECT fork seems to be active. Attempting to remove it...ERROR: Failure to kill pid %d: %s, errno=%d Sorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated Sorry, can't open Connecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. . ESCAPE CHARACTER IS DISABLED debugtimestamped-texttextbinarySession Log: %s, %s Debugging Display...) ---------------------------------------------------- Sorry, can't condition console terminal Sorry, can't reopen Sorry, Can't condition communication line ?Carrier required but not detected. *********************************** Hint: To CONNECT to a serial device that is not presenting the Carrier Detect signal, first tell C-Kermit to: SET CARRIER-WATCH OFF *********************************** Can't make pipeCan't make port fork Communications disconnect (Back at %s) Can't send characterWARNING: Failure to kill fork, pid %d: %s, errno=%d (Back at %s) ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK U to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. ƀ–<\mԀB ---------------------------------------------------- Press C to return to the C-Kermit prompt, or:Command>---------------------------------------------------- Hanging up HostDevice: Speed %ld Terminal echo: %slocalremote Terminal bytesize: %d Command bytesize: %d Parity: %s Autodownload: %sonoff Session log: (none) Elapsed time: %sError resuming CONNECT session 选 0 ր0选րAl Dial Command, 8.0.152, 10 Nov 2001DIAL succeededModem type not specifiedCommunication device not specifiedCommunication device can't be openedSpeed not specifiedPre-DIAL hangup failedInternal errorDevice input/output errorDIAL TIMEOUT expiredInterrupted by userModem not readyPartial dial OKDial directory lookup errorHangup OKNo response from modemModem command errorFailure to initialize modemPhone busyNo carrierNo dialtoneIncoming callNo answerDisconnectedAnswered by voiceAccess denied / forbidden callBlacklistedDelayedFax connectionDigital lineTAPI dialing failure8G`Ӏ–%5EakȀԀ–쀓 *6>MZ 1313233352353354358394445464749#'+.147:Any CCITT / ITU-T V.25bis conformant modem,:VALCRN%s CIC DIC ( ȀÀ΀ӀHayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 l#L+ǀ̀Ӏـ߀倓 `@JUnknown%s (dummy) Any ITU-T V.25ter/V.250 conformant modemATQ0E1V1X4&C1&D2 AT+IFC=2,2 AT+IFC=1,1 AT+IFC=0,0 AT+ES=3,0,2;+EB=1,0,30 AT+ES=0 AT+DS=3,0 AT+DS=0,0 #L+3F() %s %s T=DIAL H=%s D=%s N=%s O=%s LOGDIAL BUFFER OVERFLOW%s WARNING - speed change to %ld failed. Speed changed to %ld. PT@W;!$ i À ڀ 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6  K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_DIAL_METHODK_TF_AREACODE011800888877866199610119990000K_AREACODEK_PBX_OCPK_PBX_ICPK_PBX_XCH%s Failure: DIALANSWER%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. Interrupted. "%c" Call not completed. Call did not come in. Error initializing modem. unknown 选yĀu DIAL command + phone number too long! atd%c%sSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... ATQ0V1 No response from modem. , retrying%s... again No response from modem, retrying%s... WARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - Trouble enabling compression ATM1L%d%cATM0%cWARNING - I don't know how to enable autoanswer for this modem. ATS2=%dS7=%d ATS7=%d%cNUMBER TOO LONG! Dialing: %s... CNXINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callPROGRAM ERROR - No response handler for modem type %d WARNING: Carrier seems to have dropped... %sall complete: %s. Partial cC %sall complete: "%s". %sall complete. $w$w$$Sorry, DIAL memory buffer can't be allocated Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. %sSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again Waiting for phone call... %srying: %s... Ret Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) ************************* Interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. (Use SET HINTS OFF to suppress future hints.) ************************* %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). OK OK ERROR ERROR at at AT AT Local phone is ringing! No Carrier. Modem Command Error. No Dialtone. Busy. No Answer. RELIABLE LAPM COMPRESSEDBBBπBC)CVCnCCC选CCONNECT Can't change speed to %ld Speed changed to %ld RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXWAIT - CONNECTINGWAIT-CONNECTINGDELAYEDBLACKLISTEDCOMPRESSIONPROTOCOLDIAL LOCKEDRINGRING1RING2RING3ERRORCARRIERDATADIGITAL LINEDATETIMENAMENMBRMESG Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup errorScript Command, 8.0.031, 20 Apr 2000P^QsQsQsQsPGQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsQsPPPQsQsQsQsQsQsQsQsQsOԀQsQsP0O뀉PuPQsQsPրPEOTBREAK\b\B{BREAK}Sorry, can't open Executing SCRIPT through %s, speed %ld. Sorry, Can't condition communication line Script successful. Sorry, script failed Network support, 8.0.255, 8 Dec 2001Telnet support, 8.0.240, 17 Nov 2001EOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBWILLWONTDODONTIAC#&*047:>ADGJOTW\BINARYECHORCPSUPPRESS-GO-AHEADNAMESTATUSTIMING-MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND-ASCIILOGOUTBYTE-MACRODATA-ENTRY-TERMINALSUPDUPSUPDUP-OUTPUTSEND-LOCATIONTERMINAL-TYPEEND-OF-RECORDTACACS-UIDOUTPUT-MARKINGTTYLOC3270-REGIMEX.3-PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTIONNEW-ENVIRONMENTTN3270ExauthCHARSETremote-serial-portCOM-PORT-CONTROLsuppress-local-echoSTART-TLSKERMITsend-urlFORWARD-Xstderrpragma-logonsspi-logonpragma-heartbeatibm-sakunknownĀրۀ–  '.;BMahv„’ «º̀Հڀဓ瀓/7=EXi}ÇÎ×áèõрREFUSEDACCEPTEDREQUESTEDREQUIREDȀЀـ0SYNCHEWRPLNEXTXONXOFFFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOL047:>A %)-27=CINRV[NULLKERBEROS_V4KERBEROS_V5SPXMINKSRPRSASSLIANA_8IANA_9LOKISSAKEA_SJKEA_SJ_INTEGDSSNTLMGSSAPI-KRB5倓  %)0=AFCLIENT_TO_SERVER|ONE_WAYSERVER_TO_CLIENT|ONE_WAYCLIENT_TO_SERVER|MUTUALSERVER_TO_CLIENT|MUTUALCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|ONE_WAY|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|CRED_FWDCLIENT_TO_SERVER|MUTUAL|CRED_FWDSERVER_TO_CLIENT|MUTUAL|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|ONE_WAY|ENCRYPT_START_TLSSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_START_TLSCLIENT_TO_SERVER|MUTUAL|ENCRYPT_START_TLSSERVER_TO_CLIENT|MUTUAL|ENCRYPT_START_TLSCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_START_TLS|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_START_TLS|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_START_TLS|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_START_TLS|CRED_FWDƜƵ΀怓,ZLJǴր:qȨހDtɣҀ(R|ʵ&^˒ƀISSUPPORTREPLYSTARTENDREQUEST-STARTREQUEST-ENDENC-KEYIDDEC-KEYID̰̳̻ǀˀـ倓ANYDES_CFB64DES_OFB64DES3_CFB64DES3_OFB64UNKNOWN-5UNKNOWN-6UNKNOWN-7CAST5_40_CFB64CAST5_40_OFB64CAST128_CFB64CAST128_OFB64$(2 Negotiations.. ?Connection closed by peer. ?Telnet Option negotiation error. ?Connection closed by peer. ?Telnet Protocol Timeout - connection closed ************************* The Telnet %s is not sending required responses. clientserver You can continue to wait or you can cancel with Ctrl-C. In case the Telnet server never responds as required, you can try connecting to this host with TELNET /NOWAIT. Use SET HINTS OFF to suppress further hints. (OK) fɀfgf/fNfkfgfTELNET negotiation loop SAK TELNET SENT TELNET SENT SB FOLLOWS IAC SE SEND IAC SE IS IAC SEINFOSEND%02x USERVAR VAR VALUE ESC IAC %c IAC SE} }'}@}]}_}]:0.0iks_wait() me_iks_req_startiks_wait() me_iks_req_stopdu666Հpre-encryptend of telnet negotiationstn_ini - waiting to see if telnet negotiations were sent׀ˀ׀׀ˀˀˀˀ %s%02x | %s %s%cTELNET SENT SB KERMIT SOP STOPREQ-STARTREQ-STOPRESP-STARTRESP-STOPTELNET SENT SB kermit  8888"-TELNET Subnegotiation error - used DONT instead of SE!TELNET Subnegotiation prematurely brokenSCREENOFFSIGNATUREFB64_IVFB64_IV_OKFB64_IV_BADFB64_CHALLENGEFB64_RESPONSENTLM_AUTHAUTHNTLM_CHALLENGEREJECTNTLM_RESPONSEACCEPTNTLM_ACCEPTCHALLENGERESPONSENTLM_REJECTFORWARDFORWARD_ACCEPTFORWARD_REJECTTLS_VERIFYEXPPARAMSOPENONSET-BAUDRATE=FOLLOWSCLOSERESTART-ANYSET-DATASIZEDATARESTART-XONSET-PARITYOPTIONSSOPSET-STOPSIZEOPTION_DATASET-CONTROLNOTIFY-LINESTATENOTIFY-MODEMSTATEFLOWCONTROL-SUSPENDFLOWCONTROL-RESUMESET-LINESTATE-MASKSET-MODEMSTATE-MASKPURGE-DATAS_SIGNATURES_SET-BAUDRATES_SET-DATASIZES_SET-PARITYS_SET-STOPSIZES_SET-CONTROLS_NOTIFY-LINESTATES_NOTIFY-MODEMSTATES_FLOWCONTROL-SUSPENDS_FLOWCONTROL-RESUMES_SET-LINESTATE-MASKS_SET-MODEMSTATE-MASKS_PURGE-DATATELNET RCVD SB SE IAC DONTÀ{ǀ Kπ0KfҀ퀉6Md{倉ހ@i6bꀉꀉ߀.+}򀉲̀|ꀉۀҀ$m怉>ZQ\ggQgggggggggFƀՀ䀉󀉶>uuu_juuuuuTuuIu3TELNET RCVD UNKNOWN ()TELNET RCVD [Yes] LINES=COLUMNS=Peer refuses TELNET DO negotiations - terminating connection%s Peer refuses TELNET WILL TELNET DO (implied by receipt of SB - protocol error ignored)TELNET WILL (implied by receipt of SB - protocol error ignored)TERMTERM=~|zxvtrpnljXVTRV耉XTELNET SENT SB NAWS Unicode support 8.0.114, 23 Jul 2000No PTY supportFTP Client, 8.0.140, 8 Dec 2001:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 1991)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                     /dev/ttyDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/shPATH:/bin:/usr/binshdpwd 2>/dev/nullr/etc/utmp/etc/passwdrr8@Jdt€Ԁ䀓 ,8NZfxˀ߀&3IXd{ր %B]lŀ݀.;QfoxĀ— /=YhqzĀ߀:_XError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock situation detected/avoidedNo record locks availableError 47Error 48Error 49Bad exchange descriptorBad request descriptorMessage tables fullAnode table overflowBad request codeInvalid slotFile locking deadlockBad font file formatError 58Error 59Not a stream deviceNo data availableTimer expiredOut of stream resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorError 72Error 73Multihop attemptedError 75Error 76Not a data messageError 78Error 79Name not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in more shared libraries than system limitCan not exec a shared library directly/bin/shsh-c&&뀊&뀊&뀊&׀&&׀&׀&׀&׀&׀&&׀&׀&׀&׀&׀&&׀&׀&GGGKKKnKv=PK~=>ހ>ހ>ހ>ހ?=?=?=?~?~?(?(?=?=?=KKKnKvKABTAGC0KKKnKvGрGGhlW`/Lw/K:/JMFw/GMT TZ/etc/utmp/dev/ ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASSascii/lib/chrclass/@:'i _;U?3RE)?9p8)5D}[ % /-I /w5b6,6)d>a<M*N5[!kj@g#*)3)5T?=D=)3+DZ^?* n#%9XVY'A H0n:?vr'"Q"`(d+42M;C~:<q(Ff"7&>nG 978 5q5& 1Z$.H+tj']!6$J !w5%_^LKzaN } dP@ff&f&hQ!G+ A D )K m5\W?Y U?}F^ z!%ph]( Z(J9H/9!Y,lllmT@(#)/lib/crt1.o.sl 1.3 4.1 04/24/86 61859 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/termio.h.sl 1.2 4.1 09/02/86 34662 AT&T-SF@(#)/usr/include/sys/termio.h.sl 1.2 3.1 04/16/86 26218 AT&T-SF@(#)/usr/include/sys/ioctl.h.sl 1.1 3.0 09/25/85 47484 @(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/sys/dir.h.sl 1.1 3.0 09/25/85 13771 @(#)/usr/include/sys/fs/s5dir.h.sl 1.2 3.0 11/06/85 10453 @(#)/usr/include/pwd.h.sl 1.2 4.1 09/02/86 48003 AT&T-SF@(#)/usr/include/time.h.sl 1.4 4.1 09/02/86 40023 AT&T-SF@(#)/usr/include/sys/stat.h.sl 1.3 3.0 12/19/85 41824 @(#)/usr/include/sys/file.h.sl 1.3 3.1 04/16/86 9268 AT&T-SF@(#)/usr/include/fcntl.h.sl 1.2 4.1 09/02/86 59104 AT&T-SF@(#)/usr/include/sys/fcntl.h.sl 1.4 3.1 09/04/86 54191 AT&T-SF@(#)/usr/include/utmp.h.sl 1.2 4.1 09/02/86 55530 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/math.h.sl 1.2 4.1 09/02/86 5939 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/sys/utsname.h.sl 1.1 3.0 09/25/85 37228 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/errno.h.sl 1.2 4.1 09/02/86 61183 AT&T-SF@(#)/usr/include/sys/errno.h.sl 1.4 3.1 06/02/86 54087 AT&T-SF@(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/signal.h.sl 1.2 4.1 09/02/86 3755 AT&T-SF@(#)/usr/include/sys/signal.h.sl 1.4 3.0 12/06/85 45123 @(#)/usr/include/setjmp.h.sl 1.2 4.1 09/02/86 47075 AT&T-SF@(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/usr/include/stdio.h.sl 1.2 4.1 09/02/86 51639 AT&T-SF@(#)/usr/include/ctype.h.sl 1.5 4.1 09/02/86 57465 AT&T-SF@(#)/usr/include/sys/types.h.sl 1.3 3.1 06/02/86 48113 AT&T-SF@(#)/usr/include/sys/param.h.sl 1.5 3.2 09/02/87 26039 AT&T-SF@(#)/usr/include/sys/fs/s5param.h.sl 1.3 3.0 11/06/85 48148 @(#)/lib/libc.a/atol.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/chdir.o.sl 1.1 4.0 01/16/86 37805 AT&T-SF@(#)/lib/libc.a/chroot.o.sl 1.1 4.0 01/16/86 26301 AT&T-SF@(#)/lib/libc.a/crypt.o.sl 1.3 4.1 07/16/86 47988 AT&T-SF@(#)/lib/libc.a/ctermid.o.sl 1.1 4.0 01/16/86 37297 AT&T-SF@(#)/lib/libc.a/ctime.o.sl 1.6 4.1 07/16/86 57583 AT&T-SF@(#)/lib/libc.a/chmod.o.sl 1.1 4.0 01/16/86 37853 AT&T-SF@(#)/lib/libc.a/dup.o.sl 1.1 4.0 01/16/86 25981 AT&T-SF@(#)/lib/libc.a/dup2.o.sl 1.4 4.1 08/29/86 20110 AT&T-SF@(#)/lib/libc.a/execvp.o.sl 1.3 4.1 06/15/86 40277 AT&T-SF@(#)/lib/libc.a/fread.o.sl 1.5 4.1 08/06/86 6427 AT&T-SF@(#)/lib/libc.a/getcwd.o.sl 1.4 4.1 08/29/86 6283 AT&T-SF@(#)/lib/libc.a/getegid.o.sl 1.1 4.0 01/16/86 17860 AT&T-SF@(#)/lib/libc.a/geteuid.o.sl 1.1 4.0 01/16/86 20740 AT&T-SF@(#)/lib/libc.a/getgid.o.sl 1.1 4.0 01/16/86 54806 AT&T-SF@(#)/lib/libc.a/atoi.o.sl 1.4 4.1 04/24/86 53759 AT&T-SF@(#)/lib/libc.a/fseek.o.sl 1.1 4.0 01/16/86 26876 AT&T-SF@(#)/lib/libc.a/getlogin.o.sl 1.4 4.1 07/16/86 64898 AT&T-SF@(#)/lib/libc.a/fputs.o.sl 1.1 4.0 01/16/86 50668 AT&T-SF@(#)/lib/libc.a/getppid.o.sl 1.1 4.0 01/16/86 19716 AT&T-SF@(#)/lib/libc.a/getpwnam.o.sl 1.2 4.1 07/16/86 54032 AT&T-SF@(#)/lib/libc.a/getpwuid.o.sl 1.1 4.0 01/16/86 58506 AT&T-SF@(#)/lib/libc.a/getpwent.o.sl 1.2 4.1 08/06/86 55465 AT&T-SF@(#)/lib/libc.a/fgets.o.sl 1.2 4.1 07/16/86 57555 AT&T-SF@(#)/lib/libc.a/getuid.o.sl 1.1 4.0 01/16/86 35351 AT&T-SF@(#)/lib/libc.a/link.o.sl 1.1 4.0 01/16/86 37757 AT&T-SF@(#)/lib/libc.a/creat.o.sl 1.1 4.0 01/16/86 37790 AT&T-SF@(#)/lib/libc.a/ftdtol.o.sl 1.3 4.1 07/16/86 64035 AT&T-SF@(#)/lib/libc.a/errlst.o.sl 1.1 4.0 01/16/86 43171 AT&T-SF@(#)/lib/libc.a/popen.o.sl 1.4 4.1 08/29/86 11124 AT&T-SF@(#)/lib/libc.a/fcntl.o.sl 1.1 4.0 01/16/86 26317 AT&T-SF@(#)/lib/libc.a/fdopen.o.sl 1.2 4.1 06/15/86 26778 AT&T-SF@(#)/lib/libc.a/pipe.o.sl 1.1 4.0 01/16/86 17378 AT&T-SF@(#)/lib/libc.a/putenv.o.sl 1.1 4.0 01/16/86 11077 AT&T-SF@(#)/lib/libc.a/memccpy.o.sl 1.1 4.0 01/16/86 59532 AT&T-SF@(#)/lib/libc.a/rand.o.sl 1.3 4.1 07/16/86 9415 AT&T-SF@(#)/lib/libc.a/rew.o.sl 1.1 4.0 01/16/86 35152 AT&T-SF@(#)/lib/libc.a/scanf.o.sl 1.1 4.0 01/16/86 41570 AT&T-SF@(#)/lib/libc.a/doscan.o.sl 1.7 4.1 07/16/86 60596 AT&T-SF@(#)/lib/libc.a/atof.o.sl 1.6 4.1 07/16/86 7683 AT&T-SF@(#)/lib/libc.a/fdtos.o.sl 1.1 4.0 01/16/86 43457 AT&T-SF@(#)/lib/libc.a/filbuf.o.sl 1.1 4.0 01/16/86 51875 AT&T-SF@(#)/lib/libc.a/ptod.o.sl 1.4 4.1 08/29/86 34562 AT&T-SF@(#)/lib/libc.a/setbuf.o.sl 1.1 4.0 01/16/86 40863 AT&T-SF@(#)/lib/libc.a/setgid.o.sl 1.1 4.0 01/16/86 5833 AT&T-SF@(#)/lib/libc.a/setuid.o.sl 1.1 4.0 01/16/86 22228 AT&T-SF@(#)/lib/libc.a/sleep.o.sl 1.1 4.0 01/16/86 27946 AT&T-SF@(#)/lib/libc.a/alarm.o.sl 1.1 4.0 01/16/86 47639 AT&T-SF@(#)/lib/libc.a/pause.o.sl 1.1 4.0 01/16/86 26337 AT&T-SF@(#)/lib/libc.a/setjmp.o.sl 1.1 4.0 01/16/86 38006 AT&T-SF@(#)/lib/libc.a/sprintf.o.sl 1.1 4.0 01/16/86 19303 AT&T-SF@(#)/lib/libc.a/strchr.o.sl 1.1 4.0 01/16/86 52023 AT&T-SF@(#)/lib/libc.a/strcmp.o.sl 1.2 4.1 07/16/86 44085 AT&T-SF@(#)/lib/libc.a/strncpy.o.sl 1.2 4.1 06/15/86 14163 AT&T-SF@(#)/lib/libc.a/faddd.o.sl 1.1 4.0 01/16/86 59022 AT&T-SF@(#)/lib/libc.a/fcmpd.o.sl 1.1 4.0 01/16/86 40105 AT&T-SF@(#)/lib/libc.a/fdivd.o.sl 1.1 4.0 01/16/86 10630 AT&T-SF@(#)/lib/libc.a/fltod.o.sl 1.1 4.0 01/16/86 18580 AT&T-SF@(#)/lib/libc.a/fnegd.o.sl 1.1 4.0 01/16/86 37593 AT&T-SF@(#)/lib/libc.a/ldexp.o.sl 1.1 4.0 01/16/86 15998 AT&T-SF@(#)/lib/libc.a/fmuld.o.sl 1.3 4.1 07/16/86 50506 AT&T-SF@(#)/lib/libc.a/dround.o.sl 1.1 4.0 01/16/86 62856 AT&T-SF@(#)/lib/libc.a/dspecial.o.sl 1.1 4.0 01/16/86 7979 AT&T-SF@(#)/lib/libc.a/fpstart1.o.sl 1.2 4.1 06/15/86 19738 AT&T-SF@(#)/lib/libc.a/strtol.o.sl 1.6 4.1 07/16/86 31550 AT&T-SF@(#)/lib/libc.a/execl.o.sl 1.1 4.0 01/16/86 47265 AT&T-SF@(#)/lib/libc.a/execv.o.sl 1.1 4.0 01/16/86 65461 AT&T-SF@(#)/lib/libc.a/execve.o.sl 1.1 4.0 01/16/86 17110 AT&T-SF@(#)/lib/libc.a/exit.o.sl 1.1 4.0 01/16/86 52308 AT&T-SF@(#)/lib/libc.a/fork.o.sl 1.1 4.0 01/16/86 8429 AT&T-SF@(#)/lib/libc.a/strncat.o.sl 1.2 4.1 06/15/86 23221 AT&T-SF@(#)/lib/libc.a/time.o.sl 1.1 4.0 01/16/86 39659 AT&T-SF@(#)/lib/libc.a/time_comm.o.sl 1.8 4.1 01/30/87 25579 AT&T-SF@(#)/lib/libc.a/times.o.sl 1.1 4.0 01/16/86 26013 AT&T-SF@(#)/lib/libc.a/fopen.o.sl 1.2 4.1 08/29/86 10450 AT&T-SF@(#)/lib/libc.a/findiop.o.sl 1.1 4.0 01/16/86 36044 AT&T-SF@(#)/lib/libc.a/access.o.sl 1.1 4.0 01/16/86 25853 AT&T-SF@(#)/lib/libc.a/strlen.o.sl 1.1 4.0 01/16/86 64518 AT&T-SF@(#)/lib/libc.a/tolower.o.sl 1.4 4.1 04/24/86 57420 AT&T-SF@(#)/lib/libc.a/toupper.o.sl 1.4 4.1 04/24/86 57548 AT&T-SF@(#)/lib/libc.a/ttyslot.o.sl 1.2 4.1 06/15/86 20093 AT&T-SF@(#)/lib/libc.a/strncmp.o.sl 1.2 4.1 06/15/86 28844 AT&T-SF@(#)/lib/libc.a/strrchr.o.sl 1.1 4.0 01/16/86 63356 AT&T-SF@(#)/lib/libc.a/ttyname.o.sl 1.2 4.1 06/15/86 39588 AT&T-SF@(#)/lib/libc.a/fstat.o.sl 1.1 4.0 01/16/86 22233 AT&T-SF@(#)/lib/libc.a/lseek.o.sl 1.1 4.0 01/16/86 26177 AT&T-SF@(#)/lib/libc.a/stat.o.sl 1.1 4.0 01/16/86 22223 AT&T-SF@(#)/lib/libc.a/strcat.o.sl 1.1 4.0 01/16/86 27798 AT&T-SF@(#)/lib/libc.a/umask.o.sl 1.1 4.0 01/16/86 26285 AT&T-SF@(#)/lib/libc.a/uname.o.sl 1.1 4.0 01/16/86 24881 AT&T-SF@(#)/lib/libc.a/ungetc.o.sl 1.2 4.1 07/16/86 60367 AT&T-SF@(#)/lib/libc.a/unlink.o.sl 1.1 4.0 01/16/86 37773 AT&T-SF@(#)/lib/libc.a/utime.o.sl 1.1 4.0 01/16/86 26353 AT&T-SF@(#)/lib/libc.a/vfprintf.o.sl 1.1 4.0 01/16/86 31733 AT&T-SF@(#)/lib/libc.a/vprintf.o.sl 1.1 4.0 01/16/86 34757 AT&T-SF@(#)/lib/libc.a/vsprintf.o.sl 1.1 4.0 01/16/86 9222 AT&T-SF@(#)/lib/libc.a/doprnt.o.sl 1.1 4.0 01/16/86 32739 AT&T-SF@(#)/lib/libc.a/ctype.o.sl 1.3 4.1 08/29/86 37429 AT&T-SF@(#)/lib/libc.a/ecvt.o.sl 1.2 4.1 07/16/86 62646 AT&T-SF@(#)/lib/libc.a/dtop.o.sl 1.2 4.1 06/15/86 45240 AT&T-SF@(#)/lib/libc.a/biglitpow.o.sl 1.3 4.1 07/16/86 58018 AT&T-SF@(#)/lib/libc.a/frexp.o.sl 1.1 4.0 01/16/86 14207 AT&T-SF@(#)/lib/libc.a/fwrite.o.sl 1.5 4.1 08/06/86 53377 AT&T-SF@(#)/lib/libc.a/flsbuf.o.sl 1.2 4.1 06/15/86 45043 AT&T-SF@(#)/lib/libc.a/close.o.sl 1.1 4.0 01/16/86 43481 AT&T-SF@(#)/lib/libc.a/data.o.sl 1.1 4.0 01/16/86 48837 AT&T-SF@(#)/lib/libc.a/getenv.o.sl 1.1 4.0 01/16/86 12739 AT&T-SF@(#)/lib/libc.a/isatty.o.sl 1.2 4.1 06/15/86 29812 AT&T-SF@(#)/lib/libc.a/ioctl.o.sl 1.1 4.0 01/16/86 26189 AT&T-SF@(#)/lib/libc.a/ltostr.o.sl 1.3 4.1 07/16/86 47790 AT&T-SF@(#)/lib/libc.a/m32_data.o.sl 1.2 4.1 08/29/86 49169 AT&T-SF@(#)/lib/libc.a/malloc.o.sl 1.3 4.1 07/16/86 52312 AT&T-SF@(#)/lib/libc.a/memchr.o.sl 1.1 4.0 01/16/86 43452 AT&T-SF@(#)/lib/libc.a/memcpy.o.sl 1.1 4.0 01/16/86 41010 AT&T-SF@(#)/lib/libc.a/memset.o.sl 1.1 4.0 01/16/86 31300 AT&T-SF@(#)/lib/libc.a/open.o.sl 1.1 4.0 01/16/86 10730 AT&T-SF@(#)/lib/libc.a/read.o.sl 1.1 4.0 01/16/86 10714 AT&T-SF@(#)/lib/libc.a/sbrk.o.sl 1.1 4.0 01/16/86 30288 AT&T-SF@(#)/lib/libc.a/strcpy.o.sl 1.1 4.0 01/16/86 10565 AT&T-SF@(#)/lib/libc.a/wait.o.sl 1.1 4.0 01/16/86 31301 AT&T-SF@(#)/lib/libc.a/write.o.sl 1.1 4.0 01/16/86 10722 AT&T-SF@(#)/lib/libc.a/signal.o.sl 1.5 4.1 08/29/86 60416 AT&T-SF@(#)/lib/libc.a/fpstart.o.sl 1.1 4.0 01/16/86 31329 AT&T-SF@(#)/lib/libc.a/getflth0.o.sl 1.1 4.0 01/16/86 27494 AT&T-SF@(#)/lib/libc.a/getflts0.o.sl 1.2 4.1 07/16/86 32658 AT&T-SF@(#)/lib/libc.a/fpsetmask.o.sl 1.1 4.0 01/16/86 38940 AT&T-SF@(#)/lib/libc.a/kill.o.sl 1.1 4.0 01/16/86 5824 AT&T-SF@(#)/lib/libc.a/getpid.o.sl 1.1 4.0 01/16/86 18967 AT&T-SF@(#)/lib/libc.a/cerror.o.sl 1.1 4.0 01/16/86 56106 AT&T-SF@(#)/lib/crtn.o.sl 1.1 4.0 01/15/86 0 AT&T-SF