L8g S `nH @.textHH`H .data @ @ b@.bss$C$Cn.fka000pL".fka040@@HB.commentu$.libg D@`|C,@h|C@(C@C@$C @,C$@XC(@C,@C4@0@D8@ @@ @@CÐET @R] S(@P#2 Pd]jUPjj j0 Ejjjir j!jir$@ uj j0 XÐU WVSEE}} uEuYE PYЅ+9u] ]}tEE?}tWKPu\WKPu E}u E@[^_ÐM}~T;]sM}tWCPuWCPu{ E}uE@E[^_ÐE+E9E~3[^_UWV}3t?u3^_WYPWh@j =/t=~t =.uVh@h@jӽ^_ÐUuYÐUPWVuu @^_Ð3%Vk@ uk@^_ÐG;=t @|Ӌ^_ÐUPWVut,3 Vk@u^_G;=t @|۸^_ÐU} tE 8uE }tE8uE}tE8uE}tE8uE}tE8uE} tE 8uE E@@~@@@@@~@@@@@~+@@@=@t@@@@@~@@$@@@~@@@@@~@@@@@~@@@@@~@@@@@~@@@u @@Pu@@Ppu@@PVu@@P<u@@P"u @@PÐUWVS] E9tu8t0YE[^_ÐSY|FPSYtSW3E8t0YEt~!FPYUtWE0WY[^_UPWVS}u ]u@@CEFE}uEug3[^_À}uEuS3[^_E)CtEPPYEE)CtEPPYEEU;} [^_ÐEU;~ [^_ÐOQ3[^_ÐUe=@u h@ >Y=(@tj$YÐU=(@tj$YÐU萆5@h@h@j蔸j腕YT@=T@tEe=@5@h@h@jQUh@g=YhN@\=Yjj"ÐUP=P@tX5P@hc@{E}~7jju jYT@=T@td= B藥5@h{@ho@j訷=8Ct@h8CXYj耔YT@=T@t@d㐐UP@jh@h|@jCÐUjh8Ch@j&h8CXYj YT@=T@tc9@@Uh@;Yh@;Yjj趵ÐUWE@@@@E=E=$x @}u 3E, f}0G@G | f}0G@G|@@f U0G@f E0G@<@= t$<@<@f U0G@f E0G@fJH@fJG@f.I@fVG@fRG@fVH@fRH@9@uNfPG@fJG@f6G@flG@fjG@fhG@fPH@fJH@f6H@flH@fjH@fhH@f.I@_ÐfUfE0G@G |fUfE0G@G|fEf.I@_UW}ǣhCdCE `ClCjY} h@7YQh"@h@h@h @h@h@jph@@h=@h4@h.@h+@h(@jHh[@hX@hO@hI@hF@hC@j hv@hs@hj@hd@ha@h^@jjjjjh@hy@j'T@x} h@VYjdh̛C 5P@h|CBX@@\@8@t@D@5l@*Yh@=@tLjjh@h|C}2h@/8Yh|C|8Y@h@h|C:!4@hZ#hZ#f} h@腕Y5@IY8CjYWh@h@j߲;BRh hT hC讜 5@h@h@j褲=8Cth, h hCo 8Cz@Wh@h@jYT@X@=$@tjFY=T@t4=@tX@P3Y臱h< h hC =$@u=(@u =X@t=0@u5@j跰=P@u膟jh9@h@j蛱h h hCo u_ÐUhdYC=CthKYC=CujhE@h:@j%3ÐUPWVuVYƍWU ;u G^_ÐO3^_ÐUjr6Y=@t5@j@jjjh@4ÐUCÐUEPhhTjI }fEftWfEftNEt@Ex@5t@hm@h]@j!5x@h~@hn@jÐ3UPWjh@h@j8tVth@hxCEth@hxC+th@hxCjLYjj@=@u"@jh@h@jEL=@u#jh@h@j$@!jh2@h@j@5@j>jY/jj%jjjj jj "3_ÐU3ÐU8WVSu ]5@hC@h3@jnuShD@j[5@h^@hW@jA6hd@h_@j+jh~@he@jjh@h@jjh@h@jjh@h@jӭh@=@~ j hx@SC t5@Y 3[^_ÐG)Cuu|SY@5@Sh@jYj Shx@ @@@El@|@@3[^_Ðh|jGC@jYt jYu 3|@5|@h@h@j螬El@@@}h,j@u1YEPh@h@jFh@/Yt @*S=p@t3 Pu5Y@j1Y=@t5@j7@jjuh@h@j诫5@h@h @j蕫5@h @h@j{,S=p@t3 Pu4Y@5@Sh!@j7=@}c5Cju=L@ u*SY5L@Sh.@j[^_Ð=@t [^_Ð[^_Ð5@YuhhG@S,tVShQ@hxC jShn@j脪5@Y@5Cj[^_Ðj Shx@ >EEh@Su'@5@Sh@jjYEujYEujY}tjaBYE"}tjKBYE j=BYEj uEP juh@jk5@ BYE}tOE8j EPu u3@5@uh@j @EPYjEPh@jب5@vAYEj EPuK u3@5@uh@j荨5@h@h@js=@uQ=|@u.jh@h@jK5@Y@5@h@h@j@=@SYEuSh@jݧ5@'Y@5Cj}uhCh@j薧V0hCLYE0}~uh/@Z=CtNhJYEȃ}t:hC5`'@hE@uu`Y}tuYE[^_Ð[^_Ð@>t Ƌ@h@hT5@ @Phm@hK@j覦h@hT5@m h @hT5@U jj5@ tsjj5@ %Pj5@ } hn@Y=@t!f @h@hT5@ jS/P@Y=@@=p@u3Ph@uh&@h&@j褥}t Ef` EfH3f%@f%@h@hT5@: [@5@h@h@j75@h@h@j6h@h@j5@hCh@j5Cj43[^_ÐU=p@t3 PuL.ÐUW5@h@h@j膤=@=@@=@trjh@h@jC=p@t;=Ct2,hCY}hCh@0C8-3th@hxCq=@h,j"@jX)YPh@h@j詣h@'Yt7jh'@h@j聣jh?@h(@jf5@h[@h@@jG5@Yj(Y=@t5@jl@jjT}-hx@h\@hxCj jh@h{@jʢ=@@jh@h@j裢3_ÐUWV=@| =@}3^_þjh@h@j`h @hT5@' |jj5@ } ^_Ðf$@fEЁRh@h@jjh@h@j Pj5@9 f$@ jh@h@j计jhT5@x h @hT5@` }Wj5@ ^_h,!Yjh@h@jBjhx@*PYjh @h@jfEf$@h @hT5@ |Wj5@E } ^_Ð^_ÐUPW=@} _Ð=@t3_Ðh@hT5@^ Wh9@h!@jh}5L@hF@h:@jJ@_UWVSujVhG@jt@>t;jV)~hj EPW- Shd@hN@jݟ} [^_E uEPhe@EP ؅}EWYEuhs@hh@j}E[^_ÐUWVSDžPt@p@C!j/uEtE@EPh@EP EPPh@hCeSPh@VPJjhCh@jɞjVPh@j豞q'h$VP}g5L@VPh@jv=L@uPYh@yPYVPYn'[^_Sh@EP j EPV SEPh@jVEYh$VP.3hCVPu3p@=p@ghCZYE=N}uh$@h@jeL@ju<EPh1@h%@j65L@hD@h2@j}}c=L@uZuhChE@j=x@uuhCh`@ hCYEPhCh@j赜d}} =L@t}uOVPEYuh@h@jz%[^_uh@h@jT=p@uG=eVPY_%=p@t 3[^_Ð[^_ÐU=p@t;=Ct2$hCY}hCh@C$3ÐUP3҃} t}t}uÐUWVSu =@uh@h@jgVh @h@jRuh @h @j;E`@d@E@=`@t h@5h@h$ @h @j5@h3 @h% @jњ=@t5@Yu 3[^_Ðt t5@=@E PZYVhB @h4 @jkt#=p@t=p@u=l@t3Ph@uh&@h&@j$}t Ef` EfH3@=D@u'f @h@j5D@ =D@u#f%@h@j5D@ d=D@ uf%@@%f @:=D@t=D@t =D@uf%@h@j5D@ f%@f%@f%@f @f @f%@f%@f%@f @@@=@u@h@hT5@ } [^_Ð@3[^_ÐU=@}t }t}uh@ju f%@E}uf @h@jj{ "}uf%@h@jjW h@hT5@ }Ð3UWVS} u5@hN @hC @j辗5@h[ @hO @j褗Vhg @h\ @j菗Whr @hh @jz=@=@t=;5@u5;=@u-@9p@u jh @hs @j13[^_Ð=@t/5@Yujh @h @j3[^_Ðjh @h @jٖ=@t}ƹ EPYt$=p@t=p@u=l@t 3Ph @uh&@h&@jt}t Ef` EfH3Et tuh @jWu auf @h @jWU A uf% @@%f  @uh @jW f% @f%@f @f% @ f%@f%@f @@@h @hT5@M } [^_Ð5@=@@5@h @h @j/3[^_ÐU WVS]Sh @h @j5@h @h @j5@h!@h @j͔=@| =@u3[^_ÐX3E=xtn=tQ=t4b=tA9E/E"EEE = E=t+=EE=<E=xt)G=t.=uoE hE ]E L=uAE :=t=u(E !E=u E3Wh!@h!@juh!@h!@ju"jh*!@h!@j[^_Ðuxt|h @hT5@ |`f%$@fEf $@f%@f @f%@f @f%@f @h @hT5@6 } [^_Ð[^_ÐU WV5@@#Wh3!@h+!@j5@^_UWV5@hA!@h4!@jّ=@}=8@Wh]!@hB!@Ch @hT5@z } ^_Ð=$@Why!@h^!@jiWh!@hz!@jT=$@3}2vKnnf^VN,FX>6.` &%KVh!@h!@j衐^_UL@@=@t5@h!@h!@ja=@i5L@h!@h!@j>=@u6=@t-=L@t$=L@th!@YjaYÐ=@| @@3@%UPWhh@5@ Wh!@h!@j蛏_ÐU@@5@h!@h!@jb=@} Ðjh!@h!@j9jhT5@ 3ÐU@@ÐU3ÐU WV@5@h!@h!@jʎ5@h "@h"@j谎5@h"@h "@j薎=@} @=@~=@u @}T}uNjjE}u 3uh+"@h"@j$Wh?"@h,"@jjYtjYt3VhS"@h@"@j֍~uu 3x@5x@hc"@hT"@j融^_ÐUjYuj5x@hs"@hd"@je5@h~"@ht"@jK=x@tK=@uB5@h"@h"@jjjjjj^jjRÐ5@h"@h"@j݌uj'u h"@h"@j蹌} uE =@tu jj=t@tt@ÐUÐUjh"@h"@jVjjh5jjjjjzjjnÐUWVuufEfEjjEP Wh"@h"@jʋ~Etu=@t^_5@h#@h"@j艋=@~=@}3^_Ð^_ÐU5@FYÐUWVS]Sh#@h#@j5} 3[^_Ðjh#@h#@j3E G# h@ ~3;}/ @} E@@@@%}}Vh2#@h#@j襊u~E 8}[^_ÐU WVS} =@} [^_ÐWh:#@h3#@jJjuh;#@j6}+PhK#@hB#@j Wu5@ ;u ShT#@hL#@jމE[^_Ð}$5L@ha#@hU#@j赉[^_Sho#@hb#@j薉E+~jd Y~ NM}E[^_ø[^_ÐUPWe=@jY=@t5@ju@jj]-~ GPYEPh}#@hp#@j؈=@u5@h#@h~#@j赈_Ðh,j@j)Y}3h@ Y5jEP5@ =}fj Y=@t5@j@jjwW Y5L@h#@h#@j_Ðj Y=@t5@j)@jjWK Y3_ÐUWVEEEE=@} ^_Ðu h#@h#@j\uh#@h#@jEE}}E}t5h,jt@u YEPh#@h#@jh@R Yt]jh#@h#@j҆jd Y=@t5@j@jj^_ÐEEEPh#@h#@jd=`@th@3EPh#@h#@j. @}@@@@%=@t/Vh#@h#@j؅5L@h $@h#@j辅u*=L@u!~Wh$@h $@j藅WW=@Jjh?$@h$@jcjY"}u%U;uE}tEG# h@ uHE@%- %E}~ 3EuhM$@h@$@jӄuu#}uE@%- %EMuF}u@kE_UR @EEuh[$@hN$@j\=@=@t{#h@;@ukE@E;@|c}t;j Y=@t5@jW@jj?h\$@hxC^^_E}uVhs$@hd$@j詃i}^E@;R}t}B%U;/%U;t$uh$@ht$@jDWh$@h$@EPh$@h$@jE8d@d@us=`@ujWEPu `@~F5`@h$@h$@j˂juh$@j跂h@E`@}t;j!Y=@t5@j@jjWuh$@jA^_ËE H;jY=@t5@je@jjM^_ÐEU$E9}|juh$@jŁ+UW=@}_Ã}~ =@~= @} @@@@%#h@_h,j@uYEh@Yt + @}{@@@@%jY=@t5@j0@jjuE)E}}Eu8Y}_Ð#h@_ÐUWVS]5@h$@h$@ja=@| |~ [^_ÐSh%@h$@j*ù34jhT5@ }h%@Y[^_ÐG;|3[^_UhGYUh7YUuh%@h%@jujEP 3ÐUjY@ÐUPWjY+@Wh&%@h%@jI}3_Ð_ÐUPj˾YEEP YUjE0h'%@jÐUPW=x@u j˽Yu@_Ã=@~3_ÐjhH%@h4%@j~jhI%@辽}3h4@hTWb |.h\@hTWK |hH@hTW4 } _Ð~W蒼Y@_ÐUPW5@h]%@hR%@j~5x@hl%@h^%@j}=@}=x@u=@5@hy%@hm%@j}5@h%@hz%@j}=@t=@| =@|EjUYt9jh%@h%@jY}5@h%@h%@j?}=x@t3_ÐE@@b@Ph%@h%@j}f%b@f b@e@Ph%@h%@j|e@@f@i@j@h\@hTj Wh%@h%@j|_ÐUjZYu3Ðkjh%@h%@jT|E@@f%N@f H@f%H@f%J@Q@@R@U@V@hH@hTjʺ ÐU5@h%@h%@j{=@| j蛺Yu3Ðjh&@h%@j{@jh&@h&@jy{h4@hTjD UjEPj ÐUuu j ÐUPu譺YPujغ ÐUPWVu34Y} ^_ÐG8u3^_ÐUuYjh&@j~ ÐU=@uj艹Yt@5@h-&@h&@jwz=x@u =@}3ÐjEYÐU WVu \jhU&@h?&@j!zh,ji@VYPhg&@hV&@jyh@LYtjEPj j[Y=@t5@j@jjSWhw&@hh&@juy5L@h&@hx&@j[y=L@u~=t@tuC~E%^_Ð5L@h>&@h.&@j y=L@u9=t@tt@@^_ÐjEPj u^_ÐUEp@5p@h&@h&@jxp@Uu h&@h&@jyx} t Ef` EfH3ÐU=@tÐÐU}ujj },h&@Y5L@h&@h&@jwjh&@h&@jw3ÐUPf@f@f@vf@@@;u f@@@;u f@f@fuf@fu f@ÐU@=t@PjYt Ð@=t6@PYt$@=t@P!YÐ3UPW3@=t@PJYt@=t@PYt_UÐUPWu uk}_UWV3iu j@;t@;u>u @;t@;u ^_ÐU@UjRY=@t5@j@jj޴ÐUWV3=@uh&@舴Y3^_suXtjYj5@~j5@nuYt 3PYu3^_Ðjj6Ejj'EjEPV ;th&@ҳYTEu3fEtfEPh'@衳!h'@至Yj VGuj裳uj薳@P Y^_Uj,u u ÐUj,u u ÐUj,u u$ ÐUjjP農PCY3ÐUWV}u WVh<@js4'@h<@h<@jsW}|} |E<'@u3Yt 3^_Ð|Cu!jVh<@j.s'@3^_ÐuOjHYt/h=@hxC膱jh`=@h1=@jr3^_Ð'@XC^_Ðha=@VB'@4'@Vhc=@jr<'@uhk=@ Y '@` σ<'@t ^_Ð3^_ÐUW}Wu hr=@jBr}tIEph=@hy=@j"rEph=@h=@jrEph=@h=@jjh=@h=@jqtWu h=@jqW}|} |E<'@u3Yt3_ÅtuG'@hCt4'@h=@h=@j\qCCxC_Ðh=@EP貰}t0Exu'h=@EP蒰jh=@h=@jpjEPh=@jpEPu Y'@<'@u5L@h>@h=@jp.uj4'@ٯjh>@h>@jypCCxC<'@t_3_ÐUWVu}|} |E<'@u3Y=}3^_Ã}u=C~ 33='@tuY>EhC9'@tXC9'@t4'@ YE'@'@u!Wh.>@h>@jso^_Ð} VhQ>@h/>@jNo^_Ðjha>@hR>@j-o^_ÐUWV}u4 |C|tCtC%oE 0^_Ð'@}4'@ͬY'@P@E}u ^_ÐE Uҁ3^_ÐU WVS} u3V}|} |E<'@u3Y=} [^_ÐEy=@tEEEPV} uhh>@hb>@jmB=@t@9Eu)} t} u } t GNJUGEMu[^_ÐUE4'@uju ÐUPL@'@@ tjhv>@hi>@jKmÐ'@` 5'@hj5C踫|C5|Ch>@hw>@jm'@@ t9jh>@h>@jl5L@h>@h>@jlÐ=|CuO'@@ tjh>@h>@jlÐjh>@h>@jilÐCtC |CtCtC%ÐUu}|} |E<'@u3Y=|[} tE 8u3Ð}u&u cYPu E'@@ P聫 ËE4'@u >=uÐ3Uu uR|E}u!jh>@E'@@ P ÐE4'@h>@ة=u Ð3Uuu E'@@ PϪ ;EuEÐÐUW}u,jE P'@@ P蕪 =tg_Ð'@}4'@E P軨'@P@E =u'@@ t_Ð3_Ð3_ÐUPWCxC5Ch>@h>@j.j=Cu3_Ð=C}C_Ð5'@kY5C5C'@@ P虩 ;Cu,5Ch ?@h>@jiC3_Ð5L@h#?@h?@jiWh;?@h$?@jtiC_ÐU}|} | ÐE<'@u3ÐÐU0W}W表Y= uhjVX؅}5L@Vh?@ SVh?@jgV蛥Y} [^_Ð3[^_ÐUu菦YÐUWVS}E3Et} u[^_ÐWh?@h?@jfu _= ~E}u =!|;)Ct M)CtMFCGt;x'@|N=!};u wE uh?@u z0}u)u )Ct PYF>uju h?@je[^_U WVS]3jSh @@jeuE @@[^_Ð*@=~uCjSh@@jUe(=/u *@3GF=}A9uE *@j0h7@@je[^_ÐUWVSE3juhD@@jd*@}t=/uE3۾*@Y)CtPYF7=~t =#uXF=.u _F FG?ut.} *@=.uXGh*@W譣ju hJ@@jd[^_ÐU WV}jWhQ@@jctX@@tuTjWhY@@jcWYujVhb@@jcVYu ^_Ð3^_ÐUPhk@@ubYh@@u'@'@CCxC|~u VhC@jT[^_ÐEHiQEG|~u VhC@jT[^_ÐiEG|;~u VhC@j[T[^_Ð,CEk<EG|;~u VhD@jT[^_Ð]-|= w| $3@EPYE}u [^_ÐEPYx tm| E[^_Ð>EGƊEEP輑Y؋y>)Cuu Vh>C@jZS[^_ÐG|u VhQC@j6SGK>)CtG)Cu u VheC@jR[^_Ð|u VhxC@jRjhC@hC@jRE3 NJ>TG|EPŐYSEPhC@j|R}!ShC@hC@j_R[^_Ðùuùduùu 3E썃NimEOEԍd)EԍEEEU=/tNJ>X;@G;}|ƇX;@uOPhY;@2Y؅t;VhP9@shT:@PhT:@υT:@[^_ÐVhP9@ŅVhT:@跅T:@[^_ÐUWt}b_Ðth9F@YhrYjuheF@hbF@hZF@hhF@WYh@Y3_ÐEPY;uE_UW$unEpF@tjYhxF@*YE}u3P'YE}t E@ 8u EE E@ EEEEu _ÐjjVEjjGEEPYE;t}uuj uj}to3_ÐEE=/uEEEu}t Eujh~F@uujuhF@uujY_U =(@uYE=d}twhYEPYuuot 3EuqYEEÐE=*t=?u ÐEEEu3ÐU0WVut>u3^_ÐEPVFWVhF@j[Cu#5L@hF@hF@j=/uǣd<@\<@[^_ÐO3[^_ÐUWVS}uETM@uY3=CXI@EEXI@CdJ@@j5@"E9XI@s5ChkM@hUM@5ChM@hlM@j?=CEXI@dJ@[^_ÐUS]4C4C4C3[ÐUS]=Bt'z@z@=}z@z@z@PY3[ÐUS]# @Pj}*0@jhM@hM@j>[Ð3[ÐU xJ@xJ@UÐU WVS}u =,@u=0@u =4@t ^=xJ@@,;@uF=@t=xJ@xJ@%- %@XCxJ@xJ@%؃=pJ@t 3E=@t.;@u&uExJ@xJ@%EED@;uWxJ@xJ@%%E}@r}_v}?u25@%%EETC %E} r }}uPC=@=pJ@tE#% EE=tJ@uW=pJ@t}uH}utJ@}upJ@}upJ@ntJ@ ]=@u @=@u)=@t 0=@t u @؁# @xCxC# @C@C=| 3E}}%5L@hM@hM@j;[^_ÐHC=$G@tR=@uI=h@u@ÈE3 G@E%U[@3[@ G@3£ G@ @=@,)PY} [^_Ð @=@١xJ@xJ@%3[^_ÐUPW}=|C|-tC%;t3_ÐA|_ÐU(WVShJ@E-E܃}\~ }`}E\}\~=@uE\E+|@E}\~m=dJ@&=Cu=Cu HCdJ@|J@=CtHXI@XI@dJ@CjhM@hM@j93[^_Ð=Ctk\I@E}2dJ@CjhM@hM@j93[^_ÐHCEPh N@hM@j`9 |C|tCtC%E}\dJ@C}u"jh"N@hN@j8,@jh5N@h#N@j83[^_ÐHCEPhFN@h6N@j8=$G@tD=z@u;3 G@E%U؁[@3[@ G@3£ G@ @"5 @hTN@hGN@j>8PhcN@hUN@j&8Y=dJ@uO|J@uF5 G@huN@hdN@j75HChN@hvN@j7C3[^_Ð=@E|J@EGEu|J@=dJ@u+@C[^_Ð@=CtOXI@XI@EdJ@dJ@},@=Ct\I@E| |C|tCtC%_E|HC=$G@tL=z@uCE%3 G@E%U؁[@3[@ G@3£ G@E# @E3EEEEE=@=@u=@tkE@;t\U;uQ=dJ@uH@@@=^n=@^u]@@ %E塔@XC@6=@~+@@@@ %E塔@XC@=@=@t~@;up=@t8=pJ@t/=@t G@GH@OGpJ@f=JG@tGH@MGTC  GPC %Eéto=@tN=pJ@u>hYE}u =@uENpJ@=@t@EEe=@t\@EEM=@tD=pJ@t;jwYE}u =@uEOpJ@=@t@E=@t}t }t}uEP%fYt O@O@P@5$@h$P@hP@jD,jh8Ch%P@j.,}B=@t VS[YVjjj 0$jVSjV5xCtY3[^_Ã=@u=@u=\@~ 5\@ZY5xCtYjS~YEPlYjuh2P@jj=@tWP@^P@PhEP@jjhdP@hcP@jjh8CheP@j:+[^_ÐUW5@h{P@hnP@j+@pYPhP@hP@j*+RR6jYP5@EPkN_ÐUPW=xCWhP@hP@jw*~WqsYjVY_ÐU WVCxCpJ@@4Cjh50C @uhP@5@i@=~u#5@YtV5@Ni5@jjj!j5@hP@j)j5`@hP@j)j5@hP@j=`@t5`@8t+j5`@hP@jG)5`@5@h`@P@5@hY=~ @ƀ=@EP5@CjuhP@j(}uhP@hxCCh2EuhP@hxC$huhxChhxC5@g=@thxC5@5@hxCgjhxChP@j2(hxCYWhQ@hQ@j(hxC۾Y=t3|C5|ChxChQ@j'h$Q@hxCCgt=@u =|Cu5@hxCh.Q@j'@==5$J@jhJQ@hT@ju DžKT@u DžST@hP^ h8CP^5@hjT@h[T@j-=@t25@P5@P~^@jh8ChkT@jjPhqT@jh8C7Yt"=@u!=L@~5L@Y}3_Ðjh`I@hyT@jm`I@R/Y5@5C5@tXFPB=@tCh8C5@jFj2PjjjhT@5xCjjDžDž8Ch\Yt(hh8Ce t jhT@jt [YjPhT@j=@t5@hT@hT@jFjhT@hT@ji-h`I@5@jXjjh`I@hT@j:0C@0CPYdJ@HCBB k@"@5@hT@hT@jv_ÐU WV5dJ@hT@hT@jI5`J@hT@hT@j/=dJ@u `J@=`J@t05lChT@hT@j@9lCuk^_5ChU@hT@j5CHVhU@hU@jE5@h$U@hU@j}3^_Ã=,@u =0@t:= @p`J@5,@h;U@h%U@j83^_Ð5@hHU@h@WhgU@h[U@j} ^_áx@@; N^_ÐUpJ@}tIEt@uj5@jZ> @jhU@hhU@jn4ChU@j5@jZ=4@3ÐU5@6_Y}!5@hU@hU@ju@YÐUPCЅ}5@hU@hU@5@hU@hU@jauYÐU8C}ÐhU@j5@jB<4@30@,@W3ÐUWVS= @^~ C~ @@ %Cj5T@M;@ %Cp@@ %C8@5@%C@@@ %CH@C@-|0=w)|%$J@=8@t@&&@5@hU@hU@j 5@hU@hU@j=@u CN @CClJ@=t@u 3t B t@@0C=@t*=@t @CL@@CC =@t@3E=@t @3 E=@t @3 E=@t @3 E=@t @3U ЍB %C=@t$@@ %C=@^~ @H @ @_@ %C @B %CC0C_C_C_=@t 3 E=@t 3 E=@t 3U ЍB %C=@u"5l@VUY؅~#GS wGƀC!GƀC0ƇC=@t/jhChU@jhC%UYPhChChCUC[^_ÐGFC>u두UWVS]jShU@jAK=C|C- %P@E=@t;=@}=@ }Pǣ@@@=\@u%=C|C- %X@} X@ǣP@5\@5P@7P@l@4@=C|9C- %l@=C|C5@%4@4@=l@t0E4@P4YU̒CEl@9E|܃=C|3tC- % <@<@=r<@=v<@ =C|C# ~?| _~ }#D@=C| C3@=@Yu @:=@ ~ =@?|=@_~=@} @ @5@h V@hU@j5@hV@h V@j5@h%V@hV@j5@h3V@h&V@j@t-=t2=ut@9@t =@YuID@I=8@t@=lJ@t =lJ@&u.@@&3@t @@=@u@@N=C|*C=Bu  {0|~=t@@=C |C E=@tf@=YuEL@;uR@FE= ~=?|E=_~)=}"@E@ @@3@@@=@t @ =C C - %Wh?V@h4V@j#@t=@t 3@#@t=@t 3@#@t=@t 3@#@t=@t 3@5@hLV@h@V@j5@hYV@hMV@j5@hfV@hZV@j=@t-#@t=@t=@t 3@5@hsV@hgV@j5@hV@htV@j|5@hV@hV@jb F3- t95C}VhV@hV@j-5@hV@hV@j=@t{F9C~pF- %k_V ‹WhV@hV@j=@;}E@=@ } @P@@=@t=@~ @5@hV@hV@jL5@hV@hV@j25\@5P@0P@=@95CF- %WhV@hV@j  ~# @#~ @# ǣ(@$@9(@~ $@(@=(@} (@=(@~"@@9(@~ (@@@WhW@hV@j> D(@Wh W@hW@j @5(@hW@hW@j =(@~c5xj@5(@5@Y ;=@}?=@=@t=@~ @5@hF-0k V0fF-0k V0f-0k V0k V0k V0fF -0k V 0fF -0k V 0fF-0k V0f8fDžfDžfDžfDžfDžfDžPY؍PBYЋ,=L@DžY@DžY@=L@t=L@t =L@u Dž Y@=L@uIY@JY@P5L@=L@uFY@GY@P5L@=L@u@Y@BY@P5L@h Y@hJ@A( L@L@hJ@AYL@J@L@L@L@9L@}L@L@J@[^_Ð[^_ÐO;t =/u=/uG~?L@L@WSPPPPPhX@;L@WhX@PPPPPhX@hJ@@$L@hJ@@YL@U WVS]uLY@jShMY@j;tSP\@*hTY@PC@P9@YL@L@L@PhXY@hJ@? L@hJ@?YL@PDYL@5L@h~Y@hpY@j/$@@hY@h`I@?dJ@C\I@@WhY@hY@j[^_ÐUWVSfDžfDžfDžfDžfDžfDžL@9L@=L@~X L@PYuL@~[^_ÐPY؍P>YЋ=L@uo=L@u Y@Y@P5L@=L@uY@Y@P5L@hY@hJ@> L@L@hJ@>YL@J@L@L@L@9L@}L@L@J@[^_Ð[^_ÐO;t =/u=/uG~CL@L@WPYt Y@Y@PhY@hJ@J=WhY@hJ@3= L@hJ@:=YL@5UE8u3ÐuP=L@L@PhZ@hJ@< L@hJ@9YWuhZ@jjVhZ@j===p=/=tx======t/=;VS8Y@ @[^_Ð=yV,8Y@[^_Ð=tQ=t(^=?V7Y @@[^_V7Y@@[^_ÐV7Y@@[^_Ð=V7Y@@[^_Ð=t)C=Vc7Y@@[^_ÐVG7Y(@$@[^_Ð=mV 7Y0@,@[^_Ð=:tu3=6tP=-t#q=,"V6Y@[^_V6Y+Љ@[^_ÐV6Y8@[^_ÐV6Y@[^_Ð=.Vd6Yu @u @=@[^_Ð=8t%;=7dV6Y@[^_ÐV5Y@[^_Ð=9)V5Y@[^_Ð=/=t(=;V5Y@[^_ÐV5YE}}}~Et@[^_=Bt@[^_ÐV75YE}p}c5\@u]T@[^_Ð=5V4Y@ @=@@#~ @@#= @^~  @^5|j@5 @5@ @[^_Ð=t=_=Vo4YE}}_E@[^_V?4YE}||EL@[^_Ð=uaV4YE}uE}}} >E$@@5|j@5 @5@ @[^_Ð3[^_ÐUW}=@urWhZ@hZ@jZu hZ@hZ@jCuhZ@hZ@j,GE ;E~E} -WhZ@hZ@j_ÐUW35@hZ@hZ@j=@=T@ET@jhT@hZ@j5l@u 4uh[@u3th[@u3uWh&[@h[@jAt@@_ÐUPCCiP@CiP@CiP@C3CCB@|P@,[@U WVSP@,[@=P@F=`@u [^_Ð=0@%}E CE} ~E H?CE} ~E H?CE}~#}~}+}u+uWh\@h\@50@h\@h\@ju h\@h\@j[^_ÐE CE} ~ E H?CEE CE}~6}~0}+}u+uWh]@h\@jV}*+jh]@h]@j1[^_i}i5CCCu=CCE=C~ C+C=CC+E+U‰E+C=CC5Ch"]@h]@jz=C} CMC=CCC5Ch/]@h#]@j.5Ch<]@h0]@jkCC@,[@=4@ },[@@,[@=4@@},[@@,[@d@9,[@} d@,[@=h@~h@9,[@~2h@,[@&=h@ukP@9,[@~ kP@,[@5,[@hI]@h=]@jI3[^_ÐU$WVSET@PhW]@hJ]@j5@@hb]@hX]@j5@hk]@hc]@j 5lCY 5lCh_@h^@jh_@Yh_@5@/E lC9Cu?=`@t5C5@@5Ch=_@h-_@j; 5Cha_@h>_@jCxCEPhz_@hb_@j}}D5Ch_@h{_@jh_@Yh_@5@;.EL 5 @5lC5C 9 EPh_@h_@jy}u 5CY5Cq8Y; }} 5CW8Y5Ch `@h_@j'=C}W5Ch!`@h`@j5lCY h"`@Yh4`@5@V-Eg 5lChI`@h?`@j5lCVhP`@hJ`@jf@5@c[^_Ðhj@kthWf@hPf@jkhj@Ѓz uJ=@@t9u]Y8@hXf@5@j%jhj@kD[^_Ð3[^_ÐQUChj@kt hj@ktFPhuf@haf@j8@hvf@5@j%jhj@ktujS hj@kD[^_ÐUWVu脐Y5@5C5@jEj=@@<9j9Y=@=z@} z@ @ȴB^_ÐUu Y}Ð5@5C5@EP3ÐU5\@ҏY} Ð} t5@5C5@jH)5@5C5@}tJRPz3ÐUPE@;uE\@D\@\@UEPhf@hf@jc\@UE@@;=\@\@\@-D\@=^}qE\@U\@\@hD\@YEtEPhD\@hf@j\@}tQ}u ÐÐ\@.=\@t%\@\@-D\@=^\@3ÐU}ti=\@u \@\@E\@;u;\@\@u4\@\@jhf@hf@jÐ\@\@3ÐUWVSE}}uO Y؃|yG@;ujG- %|VG= uKGE=St E=Iu0F;|)FEE@PwYU ;t 3[^_ÐNJUE=Su [^_ø[^_ÐU WVS5@hf@hf@jȺ} z[^_ÐEPhf@hf@j}} [^_Ð=@t@lj@kU,C,CE,C0CCC=L@tP@@@E5L@@PEP5,[@lj@kUDHP5,CkD`@98@t <@`@8@Vhf@hf@juY}Z5@hf@hf@j5@h g@hf@j=@t =@t[^_Ð[^_Ð=@@th g@5lC h g@5@jTjdh g@jjr? =D@ujAYT[^_Ð5@@C8C4@},CG- %Ep@#~ Q[^_Ð,C0ء,C0,CEPYS;tVhh@hg@juYhh@5Cjr Q[^_Ð3,CEPYU ;j,CEPh(h@jAE- %PhBh@h6h@j,CEP-YPhMh@hCh@juYhNh@jjr h^h@5@j%jQ[^_E- %U ‹ء,CEPY;}EuE,CFM ,C0,CEPxYU ;N,C0j,CEPhmh@j!Shh@h{h@j ,CEP?YPhh@hh@juYhh@jjr hh@5@j%j߽Q[^_ÐE- % U  U ‰E58@,CEP9E}EuU,CFM ,CFM ,C0,CEP:YU ;,C0j,CEPhh@jE- %Phh@hh@j58@,CEP/Phh@hh@ju Yhh@jjr hh@5@j%j艼Q[^_E- %HU J ‹ء,CEPfY;}EuA,CFM ,C0,CEPYU ;t\N,C0Sh i@hh@ju Yh i@jjr hi@5@j%j跻Q[^_Ð5ChYi@hDi@jiCxCtI8@5Chhi@hZi@j8hii@5Cjr7 S" Ylj@kUDCCCCUxClj@kU CLlj@kUMLlj@kU 0CLu5CEPjƺE[^_Ð,CDC;]|D,C0}u&=x@uEjh'h@hh@jCEH|=w |$\@u( Yh)i@jjr% h9i@5@j%j"Q[^_ÐU=@E8} }'RB<REPhui@EP(+B<Ru EPhi@EPEPj:U|ujU} @ÐUEPBYjhi@hi@j聫juhi@jm90C=0C~n0C+4CPhi@hi@j35LChi@hi@j5@Chi@hi@j5DChj@hi@j5@h,j@hj@j˪=@~AkLC =@E PhGj@h-j@j蔪=4@ /.4@jhIj@hHj@jkÐUHCLC=4@u5=,@u,=0@u#=z@t5HChZj@hJj@jÐU WVSuhk@hk@j蛿u hl@hk@j脿}P} P=hj@uhWYhj@u hl@辡Y3hj@kDG |=lj@uhYlj@u h l@{Y3lj@kDG |=@u'E @dPY@=@(@=@u"jQY@=@@=j@t5j@Yj@EE p(EE X(VhMl@h>l@jHSh]l@hNl@j3;tOjhol@h^l@j2Vhl@hpl@ju3rGVYj@tVhl@hl@j軽kEMM ؋ƹË} [^_ÍGxj@j@pj@5xj@hl@hl@jc+-|j@j@ǣtj@5|j@hl@hl@j/3[^_ÐUWVS]Shl@hl@ju hl@hl@jj hl@hl@jټ } [^_Ðk 9E } [^_ÐE M34kEEEp@ @ @@G;|ɋ[^_ÐUWC5hj@5pj@5xj@u }Whm@hl@j`Whm@hm@j3xCCB@|3 $CB |ECD@_UWC5lj@5tj@5|j@u]}Wh.m@hm@jfXWhEm@h/m@jN3xCB@|3CB |ECD@_UW}WhMm@hFm@j| W|Y| W!Y}_É= @=@t=@t3_ÐUPWVu|?~Vh^m@hNm@jt^_Vhom@h_m@jV5Chm@hpm@j<=Cu ^_Ð=C} ^_Ð3<$C$C Chj@khj@kt5lC5Ch;o@h$Ch$CjHG3^_Ðhj@kthj@kthj@kthj@kt hj@kthj@k44$CWhn@h$Cu(h$CjF_UWV=@u@hPo@j G|hao@j G|3[lj@k4 Y=H~o@o@Plj@k4ho@h$Ch$CjFjG;= @|=5lC5Cho@h$Ch$CjE,3^_Ðlj@ktlj@ktlj@ktlj@kt lj@ktlj@k44CWho@h$C(h$CjSEUWVSdPXY| B} [^_3=(@tA@F.@FMčI 3EȊ8@F G;}|= @@F"=@t&@F"@FB@F8T@F#@FA@FM@FJ@F*@F!@FA}r}h=@tMp~A@F#@FK 3t8@F G;|=@@0!dho@F@P- @ƍ@P8Y؍F@S C@01uho@F@P @ƍ@PY؍F@S C=@t[=@tR@0(5@ho@F@Pz @ƍ@PY؍F@S C=ĒCu =ȒCty=@tp@F+hC8Y@!%@F =ĒCt@FP@FM3@FC GCu=@u$@F+@F!@FR@F@@F @05@Y؃=@_}\ @-+|@;~@ho@j5@jASho@ho@j諭5@hp@ho@j%5@S5@jAPS5@hp@jj3[^_U= k@u p@ÐUB=Nt p@ÐE= ~,E k@m!E;k@w j@p@ЋÐU W}PWhp@jլ=NuDWbYj@j5j@hp@j訬j5j@hp@j_Ð=@=1GEE- %EPhp@hp@j>EkE UE0‰EEMuhq@hp@j}~EL@5L@hq@hq@jի=L@~5L@>jY}3_Ã=r@j E=Rue9Yk@5k@uhXr@jr=k@} k@=k@@@@jNJCTk@G;} |ƇTk@;}+؃=$@5E @dTk@׉P`!dk@׊ C G;}|dk@;}+؃=,@E dk@Pt׉PpUMAxAs@AAs@A ADs@A@ALs@AHAds@A`Ats@ApAs@AA s@AA(s@A$A0s@A,A4A< s@A8AT!s@APA\"s@AXAl#s@Ahǁ$s@ǁ3ÐUW} =@juh%s@jw7hPs@hCs@jawwhQs@jLw wh\s@j7wwhks@j"ww hts@j w$w(h}s@jw,w0hs@jw4hs@hs@j̟w8w^g~>(z@=P@(5\@5X@ܶP@b(=@n>=z@s>Eb>@@z@`@@@z@ a<>@@z@ a>z@ z@z@z@jI^hY=@==z@=~a=@@z@`@@@z@ >7at=z@ z@z@z@jIgY@=@==z@ =`=@@z@`@@@z@ `<z@ z@z@z@jIgY=@g<=z@l<>`{<@@z@`@@@z@ _4<z@z@CjIfY=@;=z@;_;@@z@`@@@z@ rk_;z@z@KjIfY=@O;=z@T;&_c;@@z@`@@@z@ ^;z@z@GjIzeY|z@=@:=z@:^:@@z@`@@@z@ Mz@E5z@h@h@j%^b:@@z@`@ @@z@ 5z@h@h @j踏Ez@EE=@u ]9=@t$|@Ex@Ex@|@h@艾Y=@t@E|@Ex@h&@jjj AȴB3^_Ð=z@ uc=@tZ= @uQh5@Y\29@@z@`@D@@z@ =z@ =@t @u~=@u @uihE@蓽Y=@|8=z@8S\8@@z@`@S@@z@ =8B=Bj58BhT@jʍb*z@twj5z@hi@j襍58B)Yt:jh@h}@jh5z@hC Bjh@h@jE@@50C]Yt@x@=x@u x@|@z@ ^n z@E50CrwYlC=z@t2Z75\@z@PNEz@Dz@= u3T@Ph@h@ja5z@5z@=E}h@oYhт@謉YȴB=@C6=z@H6ZW6@@z@`@@@z@ 3 lC@@z@z@ElC=z@t2Y55\@z@P Ez@(z@= u5z@5z@E}h@GYh @脈YȴB=@5=z@ 5X/5@@z@`@&@@z@ lC5lCY@@z@z@~5z@5z@?b50CtY/qPյYwZ==@t[= @uRh'@@YXW4@@z@`@6@@z@ j<Y}`=@3=z@3W3@@z@`@7@@z@ mz@\=@ts= @ujh8@`Y=@I3=z@N3 W]3@@z@`@G@@z@ =@t @u=@u @ujhH@̷Y=@2=z@2V2@@z@`@d@@z@ L=@t @u=@u @ujhe@8Y=@!2=z@&2U52@@z@`@@@z@ j:Y}`=@1=z@1U1@@z@`@@@z@ MH@z@2=@t[= @uRh@4YUK1@@z@`@@@z@ j9Y}`=@0=z@0T0@@z@`@@@z@ az@P@4Cjh50CG jFYjFY@8@T@=@tf= @u]T@=ItOh@YS0@@z@`@@@z@ @@z@=P@}5\@5X@ҧP@z@ Rh@fY=@O/=z@T/&Sc/@@z@`@ƃ@@z@ =@t[= @uRhǃ@YR.@@z@`@փ@@z@ =@t @u=@u @ujh׃@lY=@U.=z@Z.,Ri.@@z@`@@@z@ @4Cjh50C$E jBDY@@h@5@胇h@趲Y=@-=z@-vQ-@@z@`@@@z@ 6=@t@=@u@h@Y=@-=z@-P-@@z@`@@@z@ h@讱Y=@,=z@,nP,@@z@`@:@@z@ .%t9t h;@8Y=@!,=z@&,O5,@@z@`@Y@@z@ EEE=@tWE@xt@@- %E},} ,@@EE+hЄ@άY@@z@ D=@t@=@u@EP@@P<u@@POtdh?@Y=@'=z@'K'@@z@`@M@@z@ =z@ s@@P6|YXhN@sY=@\'=z@a'3Kp'@@z@`@c@@z@ =@t @u=@u @ujhd@Y=@&=z@&J&@@z@`@{@@z@ `=@t@=@u@EP@@PXu@@Pktdh|@Y=@&=z@&I&@@z@`@@@z@ =z@ @@P}Yth@菪Y=@x%=z@}%OI%@@z@`@@@z@ =@t @u=@u @ujh@Y=@$=z@$H$@@z@`@@@z@ |h@jjjsr3^_Ð=@t @u=@u @ujh@HY=@1$=z@6$HE$@@z@`@@@z@ 7h@jjjqVwjh̅@h@jwyj% Y^_Ð5t@rYc hͅ@~Y=@g#=z@l#>G{#@@z@`@݅@@z@ =@t @u=@u @ujhޅ@Y=@"=z@"F"@@z@`@@@z@ h@@- %@@- %@@PP蔷 Ƅ@@PPb Ƅ@@- %@@PP Ƅ@@PP Ƅ=@t@=@u@EPPOEPP<uPQuuP;tdh@Y=@ =z@ D @@z@`@@@z@ =z@ _PPAth@\Y觠=@= =z@B DQ @@z@`@@@z@ h@Y=@=z@C@@z@`@2@@z@ j=@t @u=@u @ujh3@TY=@==z@BCQ@@z@`@G@@z@ @@PtyYt2 hH@ңY=@=z@B@@z@`@e@@z@ R=@t @u=@u @ujhf@@@z@`@Ն@@z@ Q=@t @u=@u @ujhֆ@2 }{}~ @(@PY=@=z@:@@z@`@7@@z@ hv@:,Y=~j5@Y=@|=z@S:@@z@`@8@@z@ hv@eYtz@h9@ Y=@=z@9@@z@`@J@@z@ E=SQ=@t@=@u @ukhK@aY=@J=z@O!9^@@z@`@b@@z@ @@- %EE@U@E@P@@P[}hc@豙Y=@=z@h8@@z@`@x@@z@ (hy@>Y=@'=z@,7;@@z@`@@@z@ =@t @u=@u @ujh@記Y=@=z@h7@@z@`@@@z@ (ȴB@z@@jBYl@z@@^_h@Y=@=z@6@@z@`@‡@@z@ v=Btz@v@z@v@jhȂ50C) =0Ct0C8t hÇ@*Y= @t=h@th-YGȴB=@=z@5@@z@`@ć@@z@ @h8C=Yu5,G@茖Y5,G@jjj f_=@a=z@f85u@@z@`@Ň@@z@ =0Cu  G@h8C&Y5@[Yh$CY5(@蘫Y}dhƇ@ɕY=@=z@4@@z@`@؇@@z@ z@?@襐h$CsY5(@Y}dhه@,Y=@=z@3)@@z@`@@@z@ =Btz@v@z@v@z@z@th$C50CĹu5CސYK5C͐Y5C蹷YPjjj4]=4@th@虐Yz@,G@@=@tY=h@t<=l@t5t@jz@Gh$C5t@z@-h$CYz@h$Ch8Cyz@=z@j=Bt ȂP50C% }dh@VY=@?=z@D2S@@z@`@@@z@ Kz@5,G@ݒY=@ =z@ 1 @@z@`@@@z@ ]ˍ@B=Bt/hC YEBuhCh@jb=@ =z@ 0. @@z@`@/@@z@ =,@u =4@th0@ Y=0@th2@Yrj=Bt ȂP50C# h4@VY=8@u3P`Y=@% =z@* /9 @@z@`@G@@z@ +,G@H@=4@t z@|=@t[=h@t>=l@t5t@j z@Ih$C5t@Dz@-h$CYz@h$Ch8Cz@=z@th$Ch8CE=}j5,G@ Y=@ =z@ . @@z@`@Z@@z@ z@wh$Ch8C<z@-f=[S$z@h[@RY=@; =z@@ .O @@z@`@l@@z@ hm@Y=@ =z@ - @@z@`@}@@z@ fh~@jjj `W=@[ =z@` 2-o @@z@`@@@z@ =z@}kh@Y=@=z@,@@z@`@@@z@ }=Bt h@uY׈z@S50CHYt@x@=x@u x@|@=@=@t =@uwh@Yḧ@V[Y=@=z@+ @@z@`@@@z@ z@5@z@=l=z@u*jΟYhO@@Yz@ z@HC50C蟭Y}*4@7hP@@Yz@ |5(@QY}dhR@肉Y=@k=z@pB(@@z@`@d@@z@ =z@=t`=z@u*jžYhe@?Yz@ z@50C艾Y=z@=uȴB3^_Ð=z@vjKY=,@u =0@thf@hh@N?Yz@ 5=,@u=0@u 3ȴB=ȴBt.= k@~%= k@#t= k@t= k@?t ȴB,@=ȴBt*=H@t!jh8Chi@jBh8CYL5@7Ytz@phs@膇Y=@o=z@tF&@@z@`@@@z@ s@>z@ 5z@h@h@jW=@=z@%@@z@`@@@z@ kE@=@t@8t@EE8u0CEE8uE@uTYȴB5z@h@h@jV@z@@腿j"YL@z@@=̴Bu=x@t=@u h@9Yz@ @=Bt/hC]YEBuhCh͉@jGV=@tn=z@uwI$@@z@`@@@z@ h@Yz@ @=@u 3^_Ð=z@tz@3^_Ð#} ^_Ð@@z@`@@@z@ xEUM TEE9E|DEE8E- %E}} ~EEUM TEE9E|DEE8tIE- %E}~0} *EEUM TEE9E|DjEPhZ@jzTjEPhc@jeTjEPhl@jPT}uC= @tj5@hu@j>h@h@Y @ @=@tA=@t8EP5@XuKEP5@Bu5 @)=@t EP5@u  @= @t*j5@h@j=h@Y2jEPh@j=hÄ@~Y U@@@@@@@@ÐU|W5z@h@h@jR=@t+=4@}"=h@uh@jjj J_ÐE5@5d@EPh|C}<5@h|Ch;@jaRhV@jjj vJȴB_Ð}~E@5@h|Chf@jR=@t=h@u 4@58@5D@WK } hy@jjj IȴB_Ã=@(T@=s=@t@@@@E}E8DžDžDžhCu􍅐P蒐 h@P舐=`@t Dž PzY|I|ƄP =@Dž@T@=st"=vuK=@tv@@,=@t@@@@u Dž@8tRT@=suC@@붡`@PP P!Y_Ð@|@h@詎_Ð=@uT@=x@5x@hϊ@h@j;O5@h݊@hЊ@j!O=@u=x@uvjh@hފ@jN=@u5x@ Yh@Y>h@Yh|CYh7@Y=H@tjBY @=@%=@=x@ T@=vu)hL@Yh@tYh@iYT@=su*h@HYhՋ@=Yh֋@2YT@=gt8T@=rt*T@=htT@=jtT@=cuVh@Yh%@YT@=rtT@=jtT@=hu &@=@PYn5z@h@hd@jCMK=@t(=@u=x@uh@>Yh@3Y=@uh?Y5h@jjj E@_ÐU=@t @u(=@u @uh@{YÐ5z@h@h@jyLz@ ti5@hʌ@h@jSLz@t3@5@hߌ@hˌ@jLz@t3@@4Cjh50CU `@@\@@5@/Y$@@@}t @r~5\@5X@ nP@3ÐÐUE#E t Ð3UDWVSEEEEu踊YE}tU9E |K}}E}uEȎ@}uEɎ@EEE PۉYEtz3k[^_ÐEuuEk 4躐 u;Ek Du+k UċME܉Ek 4Y;}~}C;] |E܉E }tzB@PGYEtfEBEu跉YEu諉YUЍBEB}E}}EE }EE }tE33NEk Du=uk 4uhΎ@׈E@EB;~b0tECE ;|}t uY}uY[^_3E8 G;=B|3EÉEE 9E}vEE̋EEȋEċUEԋEUB;usFŮĒ҈uN;usFUԊEԄ҈uN;usFUȊEȄ҈uEH;}N G;}mEBHEԋEM= tE@uhʎ@衇E@EB;~,/ECE;UWVSu9E |"] ùظ;| EP[^_ÐƋUӋE}"u4`|֋ˉ+}܋ƋӋM EE +9E|놐UHWVSDžDžDžDžDž}}3[^_Ð}}E} uE ֎@}uE׎@EEPYDžPYPPY@P躅Yuh؎@ąYDž P4;~E99EuB@PYBu fYuWYЍBB} DžEEtDžPh@tDžuDž^PYuPu h@5@B;~+DžE9|t UYDž#<t 4,Y9|уt Y[^_Ð3 8 G;=B|3;]E EB;sF҈uN;sF҈uN;sF҈uዅH;}N G;6BH= tꋅ@h @P@B;~$)uDž+Dž9zh @YDžUh訁YCh萁YCChpYCtdh\YCtPhHY@t=X@uh@}YX@u hK@w YX@\@ C X@\@ CLX@\@ T@LX@\@ P@L X@\@ D@LX@\@ H@LX@\@ L@L5C|Y@PA|Yt5CW|X@\@| Y5C|Y@P{Yt5CWr|X@\@|$X@\@D(5C9|Y@P{Yt5CW|X@\@|,5C{Y@Pb{Yt5CW{X@\@|0t~5@{Y@P#{Yt5@W{X@\@|4t?5 @x{Y@PzYt5 @WX{X@\@|8u _Ð5@Y3_ÐU5\@hl@he@j;=\@} ÐX@\@CX@\@DCX@\@DT@X@\@D P@X@\@DD@X@\@DH@X@\@DL@X@\@| tShX@\@t 5C-z X@\@t yYX@\@D X@\@|$tShX@\@t$5Cy X@\@t$xYX@\@D$X@\@|,tShX@\@t,5C]y X@\@t,IxYX@\@D,X@\@|0tShX@\@t05Cx X@\@t0wYX@\@D0X@\@|4tShX@\@t45@x X@\@t4ywYX@\@D4X@\@|8tShX@\@t85 @%x X@\@t8wYX@\@D8 \@5\@ht@hm@j?8\@ÐUU= u B€8uÐUW} tuhu@w_ÐjEPu uWh@h@j7}_áCE={u5C$wY~ CD8Eu_8Yt.uuYUE0h@h@jV73_ÐEP5Y=~-E80h@h@j!7E 3_Ã}t,CET@hT@EPuU CEjuhÏ@j6u7Yt-utYUE0h@h̏@j63_ÐEP4Y=~)E80h@h@ja6EuQ3_Ã}tFu^YEP7Yt/u`tYUE0h@h@j63_Ð_UWVEuE@E@jEPu u} ^_ÐWuh@j5E={u,uuYEEUJ=}uEUJEjuh@j[5}t>CET@hT@EPuU } ^_ÐCEWuh%@j5uYt$jVX0}h-@sY^_ÐCEjuh=@j4ulYtuhE@s^_Ðjuhb@jw4uYt'juhj@jV4EU^_Ðh@ust@h+@j!E?@@CC=t) EH@5@0h@@jw!uhR@hG@j`!@@5@5ChS@j:!Whd@ha@j%!-U= JB$@he@`YI@ =@uEU }CET@jE0h@j hT@EPE0U } [^_Ð5C_Y@EC5@0h@j@ ES_YH=@u_E 8t;u h@/_C@u Y@ hC|AlClC5C>_YEPu 5Ce t3 hC}hhCj]lClCE EEPh@y^u]YC@j5Ch@j OEuh@*^Yuhɕ@^5C5$@h͕@] hhCC]Y cWhӕ@][^_3N[^_3= t쐐Ujuh@uuu u*ÐUjuh@uuu uÐU$WVSu]YE@3@5Ch@h@j5Ch@h@jC=u&ju<}h@\Y[^_ u hF@h2@j5ChO@hG@j{WhT@hP@jf5@V5ChU@jJ-= $4@hc@;\YǣC[^_Ð=@u'jue}h~@ \Y[^_Ð}trCET@hT@EP5CU $j5Ch@jj5C}h@[Y[^_ÐEPu 5Cu=t#=}aEM} # hC}hhCjZlClC5ChÖ@Z}  hChhCjY[^_Ð=@u~Euh@ZuYju}h@wZY[^_ÐC@5@5Ch@j}CET@hT@EP5CU ]j5C?}@h@YY[^_Ð} x hC|XlClC]EPu 5CuS5Ch/@j[tu2 hC}hhCjQXlClCCjEkU tE#Et3E@ElClC5Ch:@X}tbCET@hT@EP5CU } [^_Ðj5C}he@{XY[^_ÐEPu 5Cu؃uQ} t4 hC}hhCj&WlClCh@XYC[^_ÐEuh@WYuh@Wjh˗@hʗ@5Cu u7Cu3}uEPh̗@W}~uhݗ@zW5C5$@h@aW hhCVYWh@:WC[^_ÐEUC;u[^_ÐEE9E|̓}uW} t: hC}hhCjUlClC5ChԖ@VC[^_Ð=CuC[^_ÐC[^_kE UЋEkM D9Bu/jEkU tE#Et3uE܉E E܋E 9E|kE UЋ@EPhS@UuYC@j5ChW@j[^_UPMAtC;utÐ3UWV5Ch4@h&@j5j5Ch5@j@3@=CtcjhC@chhCjShD@TY^_Ð~5Ch_@T^_3^_Ðu hC|lClCttp~5Cht@T^_h@oTY5C5$@h@XT hhCSY-|= w| $h@W5@ӐU=P@u8CC5ChΘ@h@jP@C3U(WVS3EEEE=P@j5H@hϘ@j`H@H@= tj5H@}h@OSY[^_Ðh5H@5CS P@CC5C5Ch@jC[^_ÐL@H@5C5Ch@j5D@5D@h%@j5H@5H@h)@jp*33D@Eui=@tE}u@5L@h8@h-@j=L@uE@E=[^_Ð@!Et$} t} uD@\D@D@3}\u}u=@t} uE } u}t E E};t}#u!=@u=@tED@E}} D@D@Ut0 hC}hhCEPPlClCU=@uH@H@={u }D@L@j5H@ }9h9@PY5H@QYP5H@hR@jw[^_ÐC@3[^_Ð}{uE}}uM=@t @} t } /AEP hC}hhCEP OlClCUȈYE3} ~/}?t)}t#tD@\D@E@tu܊EP u5Ch@jk}u @u} tD@D@UC9D@ hC}hhCj*NlClChh @OC[^_ D@H@9D@v D@@= tݡD@@= t͡D@=@t =@I@H@9D@vdD@@=-tD@@={uD\D@@={uD@ D@@ D@D@=@~#D@,D@D@D@}t EED@L@j5H@ }75H@%NYP5H@he@jhx@MY[^_@=0@=,@x5CMYd,@H9<@@@8t@@0LY@@E}=@}? hC}hhCEPKlClCUD@j5H@}85H@LYP5H@h@jY h@qLY[^_ÐC[^_Ã}}uhD@j5H@w}85H@~LYP5H@hΙ@j h@KY[^_ÐC[^_ hClClCW}t } C9D@v{=@t h4@KY D@D@={uMD@=}uED@= uH@={u}u @D@ hC}hhCjIlClC@@CH@CD@CL@CP@D@C3Ɉ D@9H@'}}C9D@+ hC}hhCjBIlClC@@CH@CD@CL@CP@D@C3Ɉ C[^_Ð}u*D@5$@h@ICEu=,@}t }=8@}" hCzlClC@@8@<t/5C@@8@4}Iu=8@~" 8@@@8@<Y hClClCo=,@}8@@;<@~ hClClC"8@@@8@<tO5C@@8@4Hu/8@@;<@~ hC|OlClC8@@@8@<} }Cu?u D@ hC}hhCjFrlClC_@"jEP @@UB@@M܉Eܡ<@9E| <@<@<@8@,@98@|h@GGYS5CGY@PGY@@ 8@@@8@<t5C@@8@4SGC[^_Ã=@t h4@FYD@D@ D@;Cw@@CH@CD@CL@CP@D@C3Ɉ @C[^_ D@C9D@rSD@= tB=@t h4@FYD@뾐=@t h4@EYD@ D@C9D@rD@= uD@@C[^_Ð hC}4hhCE)CWt E^PMD,E)CWtE^lClCE܊E܄EuhhCbDY=@t h4@DYD@D@ D@;Cwѡ@@8@45C E5C5$@h@D 8@C[^_Ð=@t h4@vDYD@D@ D@;Cwѡ@@8@45CD5C5$@h@(D C[^_UPWM3D@D@AGtC9D@r֡D@ D@D@D@L@_ÐUWVS}@CWCY=~ [^_;u@ESuC}} t-WCYENjU= uM}E@G= t3[={uF=}uN}3u.= t = u} t%= t= tCG@?u@[^_UU)Cu3ÐB:uÐUP XC}hXCRAYÐ\C\CUÐU hC}hhCEP)AÐlClCUÐU=@t h4@BYÐU=@t$}  hC}hhCj@ÐlClC hC}hhCj @lC lC hC}hhCju@lClC hC}2hhCE)CWtE^P-@ÐE)CWtE^lClCÐ hC}hhCEP?álClCUÐUWVSE9E8u*=1 =0G=\{uGEE=8F=4tx=2to~=3tf=6tV=5tM=7t>w=XtP=Dt( =9t Y=Ot!O=ot=du$`@hH@YÐḥ@zYÐh@jYÐh'OA2YÐhOA"YÐhOAYÐ5@YÐh&PAYÐhPAYÐh@YÐhQAYÐh@Y=X@uRA X@HBP5X@X@5@%PhRA4:3hRAbYÐhSARYÐhSABYÐh@ZYÐhTA"YÐh]TAYÐh@*YÐhTAYÐh(UAYÐh@YÐh@YÐh`UAYÐhUAYÐhTVAYÐh|@YÐh=WArYÐhWAbYÐh3XARYÐhXABYÐh@ZYÐhYA"YÐhYAYÐheZAYÐhL@YÐ5@YÐhZAYÐh([AYÐh[AYÐEp50@h\AM8h@Yh-\ArYÐh@YÐh@zYÐh,@jYÐh@ZYÐhT\A"YÐh\AYÐhO]AYÐh@YÐh@@ YÐh]AYÐ5ȝ@YÐ5̝@YÐh^AYÐh@YÐh^AYÐh6_ArYÐhؤ@YÐh@zYÐh_ABYÐhI`A2YÐh`A"YÐh@:YÐ5BhaAh`A5BhBEPYÐhaAYÐ5@YÐhaAYÐ5@YÐ5@YÐ5ĝ@YÐ5Н@qYÐhbAbYÐ5BhbAhwbA5BhHBPEPhbAhbAjuEYÐ=@t#NE5ChbAh@YÐhbAYÐhocAYÐhcAYÐh#dAYÐhidAYÐheA~YÐh,@YÐheA^YÐh`@vYÐht@fYÐhcfA.YÐhP@FYÐhfAYÐht@&YÐhfAYÐh0@YÐh@YÐh3gAYÐhrgAYÐhgAYÐhgAYÐhhA~YÐhBhAnYÐhehA^YÐhhANYÐhiA>YÐ{E}EÐ5ChdiA3ȴB3ÐUP?}ÐuhiA33UWVS]E}E[^_C~&=t@~=x@~t@Bx@BhiA@3YE34hiA$34}3YEE38= uEG;}|EE衘B-9E~'ÍV8tru 3[^_ÐEF8xhiA2Y3[^_ÐUPW}uhԝ@Y_Ð}_Ð}_ËHw=Vld$x@hp@Y_Ðh@Y_ÐhШ@vY_ÐhX@fY_ÐhA.Y_Ðh@FY_ÐhAY_Ðh@&Y_Ðh @Y_ÐhYAY_ÐhAY_ÐhşAY_ÐhAY_Ðh@Y_ÐhsAY_ÐhߠA~Y_Ðh@Y_Ðh @Y_Ðh:ANY_ÐhA>Y_ÐhXA.Y_Ðh@FY_Ðh@6Y_Ðht@&Y_Ðh4@Y_Ðh8AY_Ðh@Y_Ð5P@hAy0=X@u)5P@h A]0h;AP0YhϤAE0Y3_Ðh@Y_ÐhT@Y_ÐhARY_Ðh̪@jY_ÐhA2Y_Ðh(@JY_ÐhAY_ÐheAY_ÐhAY_Ðh@ Y_Ðh@Y_Ðh@Y_ÐhP@Y_Ðh@Y_ÐhAY_Ðh@Y_Ðh@Y_ÐhoAbY_ÐhP@zY_ÐhABY_ÐhgA2Y_ÐhϩA"Y_Ð5Ch+A.3_UPW}uh@Y_Ð}_Ð8= $@hHAY_ÐhAY_ÐhVAY_ÐhAvY_ÐhuAfY_ÐhɭAVY_ÐhOAFY_ÐhA6Y_Ðh A&Y_ÐhAY_Ðh?AY_Ðhԭ@Y_ÐhAY_Ðh4AY_ÐhAY_ÐhAY_Ðh۲AY_Ð}_5ChMAA-_ÐUlWVS]Džu,CEECDž us @EE8CDž3t_EEEPEPhAٲ 5BPjEPEPh&AhA輹2[^_ÐE5BEPh6Ah'APE}}}u 3<3}th7A%,Y[^_Ðu'uSYuuhOA+[^_54Chu} t%xtp,Y~ @Eƅu+YE}~EUJPuhfAjCu+Y@P++YօDuhpA>+Y3ut+VthAjuz5h@hAhAj=h@~Wkh@f@tFkh@@;t-kh@@ƅPt*VthAj]F;hA^*3|t t)YDG;|U;}}E<t 4)Y;} D3UG;|˅u5,Cu5 @ȴB[^_Ð|t t:)YDG;|E[^_Ð|t t)YDG;|[^_UlEEE5BEPhAhAЃ u)Y= ~j uhA!) ÐuEPh)5BEPh AhAЃu3)Y= ~j uh A( ÐuEP)5BEPh+Ah#ALЃtN|Du(Y= ~j uh,AX( ÐuEP(}ÐEPh@Z.EPh@I.EPh@8.=@t3@ @U=H@t*=h@t D@9d@} D@ÐCud@H %CtAp 9CuD@ÐU W5BhFAhEA5ԴAhA}_Ðu$5BEPj hiAhKA̯Ѕ| ~}_ÐWoY@E@_U WVhhB警unY35@`Yj账YjhlAhkA54BhB}*u.u hmAV&Y5@ Y |hBY^_ÐUW5BhAhA5$AhAQ|5C58CC&c}_5C*&YPhA5C, ud=شBt+=@t AAPhA% =@t=x@u hA]%Y+@ȴB_ÍEP5$A58ChA=شBt,tAAPkE AhA$ %t =x@ukE AhA$+ǣȴB_ÐU5BEPhAu 3}ÐurYEPu*ȴBÐU WEd@5d@hAhAj5PAhAhAj9E|=PAtPA _Ðd@H<%CWh!AhAjtBGp%CGp%CGpt3CC =d@~QPh"A#=PAwh0C)w$h4C)w(h8Cz)w,h<Cj)wThtCZ)wXhxCJ)wLh|C:)wPhC*)wÐ}u54ChC"Ð54ChC ÐhiAhChAhChAh0ChAhChAh@Ch AhChVAhC}hAhCihAh4CUhAh8CAhAY5BhAhAjhA)EJEJECȴBÐ5BhAhAjh,AԹEpEE CȴBÐ5BEPj hOAh'AEh?uuhEBZ{Ð5BEPj hyAhQA蹟EhuuhEB{Ðh|AhDCEF=DC95DCY%hAYDC=(u hAoYDC=/u hAUY=DCt 5DCYDCÐhDAzYȴBÐ5BhAhAjhAPEqEqE@AȴBÐhAhHCE}8=HCr5HCYuLhAYHC=+u h@AeY=HCt 5HCYHCÐh]A5HC=TCuh_AhTCE=LCuhaAhLC*=TAuTjYXAtheA5XA!TAjY\AthiA5\ATA=lC[hmAhlCahoA5HCuQhsAP~:=TCuh|AhTCj=LCh~AhLCK`=TCu$jYTCthA5TCB=LCjYLChA5LC hAhLChAhPChAhTChAhXChAh\Ch Ah`CqhQAhdC]hAhhCIhEBvYȴBÐE6hAhlCE5Bh Ah A5ԴAhAE}t15BhAhA5AhشAŴE}EÐE}~ELAEHAȴBÐ5BhAhAjhxA`E}EÐEEEBȴBÐh AYÐEU=%uE@E=su EE9E|ыE9Euj%hdAzÐ=<Ct5<CY<C}~!E@PY<Cu5<CȴBÐ5BEPhAhAìE|I}tCuHYEȃ}~1E@PYUDtuEtE}|}u E\EE|t tYEE9E|EËE=@uhgAjY%=@uhkARY hqACYhzA8Y=Ct CGpE}uhAYEt hAYEt hAYEt hAYEt hAYEt hAYE t hAYE@t hAzYEt hAfYEt hARYhAGY=C~CGlE}~uhA hA Y=CtAAPhA =Ct4A7APhA =CtWAZAPh;A =CtuA}APh^A} hAp Y=Cu hA\ YD=CuhAF Y.=CuhA. Y=C u hA Y=CtAAPhA =CtCG8EVhA E)CWtEPhA h A Y=0Ct *PhHAy =0Ct0CGPKY=4Ct *PhcA9 =4Ct4CG$PGKY=8Ct *Ph~A =8Ct8CG(PKY=<Ct *PhA =<Ct<CG,PJY=tCt *PhAy =tCttCGTPJY=xCt *PhA9 =xCtxCGXPGJY=|Ct *PhA =|Ct|CGLPJY=@t @؋B;~VU3ۃ=Ct *PhA =CtCGPPIYC؋B;~3ۃ=Ct *Ph A% =CtCG\P3IYC؋B;~藱3ۃ=Ct *Ph;A =CtCG`PHYC؋B;~763ۃ=Ct *PhVAe =CtCGYjhA,@=@t3ȴB[^_@ȴB[^_Ð====0tz=@=E5Bh]Ah\A5AhAEE= =9h@WVYȴB[^_jY[^_Ð[^_Ð5BhTAhSAjhAtE8蕜EET@ȴB[^_ÐhT@UYȴB[^_ÐjhYA54C hX@54CVȴB[^_Ð5BEPj hoAh^AEzEjuuh@UȴB[^_5BhqAhpA5 AhA茓Eh譛E@EBȴB[^_Ð== = m=+.=B===<=# =(v=<K=A(5BhAhAjhA贒ExEhB1TYȴB[^_Ðu 8XY[^_Ð5BhsAhrA5AhATEuEED@=D@ufVH@fRH@fVG@fRG@=D@ u3H@5D@hAh|AjbȴB[^_Ð5BhAhA5AhA蠑Ed}uQ5BEPj hAhAwE}| }~}thAY[^_ÐgE}W~3L@EP@ȴB[^_Ð5BhAhAjhAؐEEt3=0̴BLCR>RYȴB[^_ÐhB&RYȴB[^_Ð5BhAhA5AhhAXEyEE8@t@Y@GjEP5BhA2Eu;YEPFmYȴB[^_Ð5BEPj hAhAvE}}Ehuuh@qQE$@9@hAYȴB3[^_Ð5@h2A54C! } t-h9A54Ch5AjS貐T@T@[^_ÐEȴB[^_Ð5Bh;Ah:A5PAh AȎEE=$$TA4CPCjh} ~}?| }_~-}}'}uEP@EL@h,AY[^_ÐEEEP!YE@ PYiEE@PYk<EE@PYEE9E}EQE)E}}EE}~#EE9EthA[Y[^_ÐuDY[^_Ð5BhAhAjhhAtE|T虉Eu"YȴB[^_Ð5Bh-AhAjhA E} E[^_Ð EjYjEPh9Ah4A#}E}uŢYE[^_u财YuY=?~h:AVY[^_ÐEt=t"=uhܳAuhp@ uhAk5BhLAhKAjhDA8E} E[^_ÐSE}t3AȴB[^_Ð5BEPhpAhTAsvE}u EqA }Q݇EAuh@Ay=@At [^_Ð3[^_Ð蟇E5ChrAȴB3[^_EE= tE= tu58C=E8CE=|u3|@t>EE= u 3EE= u 3U uƒ=|@u*u5Y}uhSA%[^_Ð=x@t5x@zYx@uRYE}~qE@PYx@=x@uhhAY[^_Ðu5x@j5x@hAjk5x@hAhAjQȴB[^_ÐEf u0G@f PF|Et=t [^_ÐB5BEPj hA}uAMAPcEB}}}tu5YEj5ChAj{jhA5Cv t2jhA5C] tjhA5CD u!ԄE|BY@3[^_ÐEh .j$|AEl=|AthTBY3Z |C|tCtC%"EPhiBh[BjV}}= @!E=@EP螰YPY}hjB-Y3=Bt 5B0Y=BtJ=T@t!E#@PcYyKEԃ}EEI} E}u'=BtBPگY8CME }tj 软Y8CMI ;tj 蠯Y8CME =BtE }EPjY8CME }=Bta=8@tXEtOj(Y8CME EP Y8CME jY8CME EPԮY8CME }x}} t }8CEܡ8CUuuhBjuu~}hBY3E=T@tF=Bt==8@u =@u+E܉E E؀ E؋E؀8uuY=Bt 5B YE t} uEd=Bt =T@tZ}~~=BtuEBdj] YE|1=8@teEPYE}}EEPEYPfYE܀8uVjj[Y@[^_j YE}:=8@teE#@PY|RE؋E9E|j YE|3=Bt4=T@u+=8@teEPY} 3E 9EuUWVEE=$A5BEPhBhBU^5BEPhBhBU>5BEPhBhBgU5BEPh/BhBGUЅu5uh[BI^_uh<B0^_Ð54ChuI t~tv[Y~FEu58C=8CE5BhBh{BjhdA l| .t}^_ÐE=wn|j$AWu@^_ÐWuK@^_ÐWu@^_ÐWu@^_Ð^_ÐUPjYEu3Ð} tbAAAAAAAAAhAjjuj@=@~uhhC hC@ÐUPjYEu3Ð} tbAAAAAAAAAhAjjuj:@=@~auhhCj50@hBjrjhB5L@jrEP YjhBujr hC@ÐUPjYEu3Ð} tbAAAAAA AAAhAjjuj&@=@~uhhC hC@ÐUPjY} tbAA A$A,A0A4A8AYjhBuj` hC@ÐUPEt=uBBBÐU hB-Y=h@th|ChBZh|ChBE}hBY-=4@"uhBYuhBhBY=@thBhBY=h@uPhBu=l@u h'BVY=l@u h0BBY=l@u:=\`Cuh9B%Y$=\`CuhFBY hUBY=l@ u h^BY=l@u hBY=\`Cu hBY=@tL=8@tE}u=@u EuhBt hBcY8@PaYPhBHhB;Y=T@thBhBYhBY=D@ uhBY=D@ uhBY=D@uhBY=D@uhBY=D@u+=h@tB BBPvYU=D@u=h@uָBܐ=D@u=h@t BB붐5D@h#B!h&BY=L@t5P@h4B h8BY=@=h@=@u E>B0=@u EBB=@u EEB EJBuhRB=@u+=@t5@h_B\ hqBKY=p@t=CthChB)X@5@%P5X@hB UhBYU=d@} =@tUP}tE8u\hBiE=~5=}. hC}hhCP膿(lClCUEPhBjEEEuhBNYÐU W5 ChB2=,C)=CtCBPhB=h%BYEE4C@Ph:Bӿ E,C9E|hCB蹿Y= CuhSB西Y-= Cuh[B莿Y= Cu hcBvY=EBtBBPhkBU=CtBBP=Ct BBPhB 5EB5EBhB hBY=C~5Ch BپhBǾY=EBtEB5BPhB襾=@At=@Au~B BBP=DAt vBzBPh<BY =@Ct@CBPhB5=hCthCBPhB=HCtHCBPhB=HAt=HAuB B#BPh B蹽=HAt#=LAt+B1BPh'B荽=DCtDC_BPh9BihfB\Y=EBu hvBHYS=EBuhB2Y==EBuhBY%=EBuhBY hBY=TCtTCBPhBѼ=XCtXCBPhB譼=LCtLC BPhB艼=PCtPCE BPh" BehL BXY=TAu hl BDY!34XAhs B,G;=TA|=lCt lC=TCtTC BPhw B=\Ct\C BPh Bɻ=`Ct`C BPh B襻=dCtdC BPh B聻3_U=@u 9 BC BPh BQhJ BDY@t=uEe BE` B El Buhn B =@u Er B=@u Ez B E Buh Bɺ=@t B BPh B襺=@t B BPh B聺h BtYEh Bh BVPh Bh BBu E6蚮YE}}3EuhmBheBjnE)ƋU4TYPƋU4hnBjnƋUBU<uuh~BhqBjn5BhBhBjunEXAEEDE}|HC̴B<uWE3E)CtEPDYUEE8uϋE@EЋ҉UuSEhCBE=@tduYEPhBhBjm}}XA3[^_EtAuhBhBjTmuYEPhBhBj*m}ME#@EB}EEu!}2EBlClCUBBB9lCrlCBlC=BtPAPAUPA=@t(=дBu E= tTATAUTA}t EHC̴B<u E)CtEPCYEEPhBhBjkExE|;PhBhBjkE;;t-}+OE;;uWE+NjRS! uGԊ;u E%E|E@EЋҋk}uE@hC}u=PA~hPA5PAPA=TA~-5TAhTAj } @TA=@t1\EEt%uhBhBjjE}~EE;E|}=BE+E;B=PA~hPA5PAPA=TA~-5TAhTAj } @TA}~ XAE[^_Ðj}YEMuXAijYYEMuOU WVSu EVYEPVhBjmiB9E~3[^_ÐE3HC̴B<unE@P/YE}uh(BCYE[^_ÐEE.E)CtEP$YUEF>u͋EulCCEBB;rBHC̴B<u E)CtEPYEEPhFBh9Bjhh>PhTBhGBjOhE>;t-}+OE>;uWE+NjRV譧 uGԊ>u E ;lC&HC̴B<u}t uoYE[^_UPWVuE \At =\Au ^_ÐVYu\A3^_ÐO\A\A>>h\AV^_ÐUWVSE3333t2=E)Ct]C=~A33Ƈ`A33E)CtzGU`AbGU`ASE=.u!}Fu3GU`A3%u~Ƈ`A`A[^_Ð3`AEEEƇ`Au~ `A[^_ÐUB[^_ÐU`WVSu] }uEVBVuhWBjfj3h^BjeEP5`AuhhAgE܃}} eB[^_Ð=@ E 5Bu5tCLT ~tCk DBE3 u輍YE3 EĉEPѤYEEB} EpCEuYPh5BhpCi 3EpCEuY3uHYEEȉEP8YE}} 9B[^_Ð}} :B[^_ËE+EE}u3EE~Tu轌YEP7eYt=uYHE}}E}uEE+EHE}}EHC̴B4}u3Puuu|EPh;BhpC= EpC E>B3EpC|Lu)YEuYE}3 uYEE+E@E}| }t}uuuբEĉEu萋YEP dYtIuRYE}|+}}"EpCEEUEEpCE@B EAB3EBBuFY~&EpCEE%PhCBu 3iEpCuYPhFBuա 3ZEĉEEpCu蜊YE}t1u̠Yu计Y@PYEuu蒡EĉEuYYEubYubYtsuYEuYEE=t=t&=u'E}UE9E}EEE9EEpCuhIBuؠ ELB3 ~ u觉YMBE}t1uПYu負Y@PYEuu薠EȉE~ uXYNBE~ulYt uF]Yt%}u/~*uGYtu!]YuEOB] EpCuYE}u7~u諞Y~ u葞YE-~ utYEE+@E}}E E9E EEHEE EĉEEpC EPBu-YEP`YW uYE}A EpCEuY! E EpCEPu3) pCu襇YEu EpChuu ? u_Y- uuuu u'}tuuu[ EEEEEEUEEMuEEEUE҈u3|t tYG;|EpCpC[^_Ð|t tޒYG;| |t t’YG;||t t覒YG;|E)CtEPYU EUEEE8uE3|t t>YG;|EpCE[^_Ð|t tYG;|EE9}}EEUE҈uEEpC3|t tʑYG;|E)CtEP`YU EUEEE8uE3|t tbYG;|EĉEE,E-pC=| EQBEEUEE9}|EE9E|E3|t tYG;||t tҐYG;|EEUEE9E|(EEUEE9E|Wuu膑 }E3|t tjYG;|'|t tNYG;|}|t t2YG;|aEEĉE EU;u EEE8uك}u#E@Ph[BhpC袐 EpCEEE8u3|t t袏YG;||t t膏YG;|E%EEEUAEE%EEEUAE8uEEpC3|t t YG;|9EEUET|u E`BED)CtEtkYUDEUƒ80|EUƒ89 El01EUƒ8A|hEUƒ8FTEl7E}CEEUM шE8EEpC3!EaB𐐐|t t֍YG;|EȉEEUE;u EE8u܃}uEEUEE8t}tEEpC3|t tVYG;|EȉEEEHC̴B<u E)CtEPYEEHHC̴B<u E)CtEPYEEU;u EEEEu}tEEUEE8?EEpC3|t tfYG;|EEEU;uE EE8u݋E8taMpC9EsREEEU;uEEE8u݋E8tE8uhuhpCÌ EpC|t t誋YG;|E)CtR}u,EE)Ct3EP%YE#E)CtEPYEËEEUÈEEEuE3|t tYG;||t tYG;||t tҊYG;|}tE[^_ønB[^_ÐEEEE8uuhpBhpCY 3|t trYG;|pC[^_Ã|t tRYG;|ރ|t t:YG;}|uhBhBjKB[^_Ã|t tYG;}~鸿B[^_ÐEE= tZUWEPY}t EuxB_ÿNjU:4AG|E@= u 0 E@NAE@ OA3j44AE@P> tG |ރ u?MALA,G } 01LAǹ B0MAPAHA_ÐUWVSEE\CEPEPum } .E\CEP5dAuhhAK=d@~d@H%C3=`$lA B4TChyBh\C \C[^_5hCh|Bh\Cވ \C[^_ÐDC̴B4hBh\C貈 \C[^_ÐEPY}5E(E@\CE@ ]C^C E@_CE@`CE@aCbC E Ph\C8\C[^_Ð?[^_ÐC[^_Ð=̛Ct ̛C[^_ÐhBh\C\C[^_hBh\Cч\C[^_3E EPY}t1Et(E EPY}t Eu3[^_ËE@ PYiEE@PYk<EE@PYEPhBh\C \C[^_Ð5@hBh\C \C[^_Ð58@hBh\C† \C[^_Ð54@hBh\C螆 \C[^_ÐPhBh\Cz \C[^_ÐB[^_ÐBB[^_Ð5BhBh\C6 \C[^_Ð迴E}}*hBh\C +juh\C! uhBh\C݅ \C[^_Ð=ȴBu3PhBh\C譅 \C[^_ÐE|CE[^_ÐB[^_Ð B@TCE}uEBE[^_Ð5HChBh\CF \C[^_Ð5LChBh\C" \C[^_ÐB[^_Ð5̴BhBh\C \C[^_ÐEP;Y}t EtE \C=@tBBPh\C蠄\C[^_Ð`Ck̴B <u hBk̴B `CЃ:uhBh\CQVk̴B `CЃ:uhBҐhBʐ=@} B[^_Ð@#BEPl `CU4EPEhC9E|E|~&=t@~=x@~t@Bx@BL<BDB_ÐU=DBu=@BtBBÐ8CXC=Bt5B5XCk[8C=<Bt65<B5XCkXC=/uhF#B5XCk5B5XC}kj58ChH#Bj+hT#B58CcjC@@C58C2kY@PjY@TCt58C@4TCjh58C5Bj ̴BHC̴BLC̴BDC̴BJDC ̴BPC̴BJPC ̴BHC̴BJHC ̴BTC̴BJTC ̴BLC̴BJLC ̴B5̴Bh^#BhV#Bj*`Ck̴B `Ck̴B @L`Ck̴B Dj58Ch_#Bj1*5BhBihBiYE}sEHE%EB=/uEƀBÐM}ÐUWVS}33ۉ}u h|#Bhi#Bj)3Nj BTC={uF=}uN=(uC=)uK=,u+'# BTCjWh}#Bj():AG BTC B= t>= t>uOWh$Bh$BjC&GjVh$Bj)&;E=;t=#u&;u'C= t C= uK CEu;vK= t = u ;r;wjVh$Bj%V+eYEE +E=}9uuh$Bj%uh$BdVdY[^_Ð}~ƋUJ3EM EEC҈uM}uuEPh0%Bh%Bj%EPhB%Bh1%Bj$}~E=}uM؃}uE=-t={uE={u\Ez}tE }u EEUEEuFYjuh`%Bjh$VbY3[^_ÐE=-u ME EE,EM uhM%BhC%Bj$jh_%BhN%Bj$uu Vxb u-jh2$Bh!$Bj#VsbYE[^_Ã}t EB@CV+cYHEPVh3$Bj#}}E=Bt4=ԴBt+V}t EB@CPhC$Bjb u}OEE= tE= t}U$WVS]z@ H@=̴BuX@P襤Y=Bt/hC詾YEBuhChn%Bj"̴BE5 Bh%Bh%Bjq"uh%Bh%BjZ"5@h%Bh%Bj@"5̴Bh%Bh%Bj&"Sh%Bh%Bj"T@ĒCȒCCB5@j CI5Chy'B`ȴBj5Ch'Bj!=ԴBu=@} h'BY=BtJ=̴BuA5C`YE@P@`YE}th5Cu`EEHEL=@~>@4C@'B] HC̴B<tHC̴B̴BHCЃ:~Y=@t(=T@tEPj} @}~OEPl3YPY=@t(=T@tEPj§} @5lBhpB|NCEuj\2YPtY=lB~5lBhpBb| [^_Ð=شBt hO)BVQY3[^_ÐUW3=Bu=@=@t=x@t5x@hd)Bh])Bj5L@50@he)BP hq)BPYh)BPY=@uT=x@uKE@t=uE)B E)B}tuh)B{Ph)BnPY_ÐU WVSu ]VYEt}} [^_Ð3qVk 4PtCuVk 4}P u3Et#uVÍWk 4RP t[^_Ð}t [^_GEH;|uVËUJk 4P u EH[^_Ð[^_ÐUWVS]u Yt}} [^_Ð35k 4OY;u"Vu k 4O u [^_ÐG;}|Ƹ[^_UWVSu E3S4h*Bj]G4BOYWh,*Bh*BjSh?*Bh-*Bjuuh@*Bjv}} [^_ÐE@PSNYE}u0uhO*BdNjuhj*Bj+[^_ÐE34uzNG8uuzNYSuh*Bj;]uuu?&jh*Bh*Bjh*BMYu4MY[^_ÐU$WVSuEVMYEPVh*BjY} uEuh*Bh*Bu MYEPu h*Bj}G}==\uF=%VnYFE}} E:E@PLYE}uh*BLY[^_Ðu uM}t juh+B jh(+Bh+Bji E=0=9= B}+UxC5 BhT+Bh7+Bj" k B(xCUM0 5 Bhm+BhU+Bj CEUM0 [E=!=~)CtEP֣YEEUxCjh|+Bhn+Bju 3[^_Ð=&EPEPV7 yuu:} [^_ÐVYm_ECEu [^_Ð}~:E@PJYEuVh}+BJ[^_u uEKEE܋UM 3[^_ÐjVh+Bj V Y5BV5tC =~VY}5BVh+BjG 3G}&tCk <ttCk 4VJсu!Wh+Bh+Bj [^_ÐWVh+Bj tCk <tbBVtCSk tCk  tCSk DtCk D tCSk fDtCk fD K;E@PZIYE}uVh+BmI[^_ÐVuItCk M }~lE@P IYE}uHVh+BItCk <t tCk 4vHYtCk [^_Ðu u5IEtCk MLtCk fDB[^_ÐUWVSuu(jSh$,BjQ SGYjVh,Bj1 =\uF=%FE= B~FE=0|;=94k B(xCU0k B(xCU0$E=!|7=~0xCxC,jh:,Bh/,Bjy3[^_Ð=&EPEPV3 } [^_Ðm_ECEu [^_ÐEpC9E~ [^_ÐEU<t8j4hI,Bj}tEU4jFYEUjh_,BhT,Bj5BV5tCP E}uVhn,BjzE[^_ÐtCkU <t"tCkU 4EYtCkU tCkU |t$tCkU tEYtCkU D}WtCWk tCk  tCWk DtCk D tCWk fDtCk fD G;=B| BtCkB tCkB DtCkB fD3[^_UWB32tCk tCk DtCk fDG|3&TC3k(DŽxCA |G@|3xCG~|3CpCG;|_ÐU 5̴Bh,Bh{,Bj=̴B~U̴BCEtB.Extp0 E0YE@E}u5̴BkY=̴B}%̴B@ B$k̴B `CЃ:5@h,Bh,Bj=@~U@4C CY@YÐ=@h>-B@Y3hC@jYÐ=@hW-B^@Y3hC@jԐYÐ=@hq-B*@Y3jh-Bh-BjIhC@j芐YÐ}u  EPRY=} ÐuLYÐuh-B?3U}t-Bø-BÐU58@50@h-Bp? =<@t5<@h.BT?h.BG?Y=4@t5,@h.B-?5L@5H@5L@w?YP5L@5H@n? t(.B3.BP> 5L'@5H'@5L'@0?YP5L'@5H'@'? 8.BP> 5v@hH.B>5G@hM.B}>5B5@hR.Bd> 5|Ch[.BQ>5Ch`.B>>5|ZChe.B+>hj.B>YÐC.BfUEhl.B=YEh.B=YEh.B=YEh.B=YEh.B=YEh.B=YEh/B=YEhD/B=YEhY/B=YEht/Bx=YEuh/Ba=YEh/BS=YEh/BEP 77h/BEP6h/BEP6h/BEP6h/BEP6h/BEP6h/BEPv6h/BEP]6h/BEPD6ojh/B58C< 58CEP6@hh/B58Cp< 58CEP5jh 0B58CA< 58CEP5hh0B58C< 58CEP5j@h!0B58C; 58CEPS5~hh*0B58C; 58CEP!5Lj h90B58C; 58CEP4j hE0B58CP; 58CEP4j@hP0B58C!; 58CEP4hh\0B58C: 58CEPb4jdhg0B58C: 58CEP34^j hs0B58C: 58CEP4/hh~0B58C_: 58CEP3h0BEP3h0BEP3h0BEP3h0BEPn3h0BEPU3h0BEP<3gh0BEP#3Nh0BEP 35h0BEP2h0BEP2h0BEP2h0BEP2h0BEP2h0BEPt2h0BEP[2h0BEPB2tqh 1BEP-2t\h1BEP2tGh1BEP2t2h'1BEP1tjEP1t h11B8YUÐUPW}bE= r=t=v=sEPh41B7, hC}hhCEP6lClCUGEu_ÐUuh:1Bf7@CUEEt>E%E} ~}|uhL1B'7Ðuha1B7ÐEt?E%E} ~}|uhs1B6Ðuh1B6Ð~&=t@~=x@~t@Bx@Bu@h6B'.Yjh6Bh6Bh6B5`AhhA脣h6B-Y 33 3B!P = B~5 Bh'7B-3w hQ7B-Y3 33 u=@ 5@YPh7B`-=@t5@5@h7B>- h7B/-Y5@h7B- h7B -Ygh7B,Yh7B,Yh7B,Yt [qi P!YPh8B,5BYPh18B,TC̴B4YPhK8Bz,5BYPhe8B`,LC̴B4YPh8B>,HC̴B<t 8B8BPh8B,5Bh8B+5BOYPh8B+5Bh8B+PC̴B<t49B99BPh9B+=XA}hA9B+Y"XA4B5XAhy9Bm+ 50Bh9BZ+5BYPh9B@+hh9B.+hh9B+=@t:B&:BPh:B*h+:B*Y=T@t p:Bv:BPh\:B*h}:B*YBu h:B+EB5\'@-Y |@4B=X@u;B X@HBP5X@X@5@%Ph;B$*h;B *YXE}h;B)Y+}"uh;B)YuhBs'hh>Ba'hh3>BO'5BhR>B<'j@hg>B-'j h>B'5@oYPh>B'=Bth$BhBh>B& nh>B&Y[=@uh>B&Y>@(h>B&Y[^_ÐW58CtCk 4& u#tCk ttCk 4|F;5B| G;=B| [^_ÐtCk ttCk 4}А<8Ct48CVh6B% C؋B;~fQ3F;5 @|Ak pAk hAYEk hAh6Bm%k lA+ k lAt$k lA4tk lAB|k lAO E |uh6B%C؋B;~dAH;z3G;=dA,fBuEp]YPE0h>Bx"E@ E}uȴB[^_ÐEEPh6B="E8uh6B("YE)CWtEEEE(EPh6BEP*" EP<"YE衜BH9E|h6B!YECEPh6B!EE8uh6B!YyUP=@t'h|Ch?Bi!OPhl?BV!h)?BG!YސU WVSu 3}6uho?B!Buo!YXv?B}(uG})uO}3},u[uW hC}hhCj,lC,lC hC}hhCj-lC-lCE hC}hhCEPUlClCU} u>hhCY hC}hhCj 8lC lC"C؋BJ;~h hC}hhCj-lC-lC hC}hhCj lC lChhCYB}*B-9B~tgBFEb hC}hhCj 1lC lCB@BB;~ u [^_ÐB3[^_ÐF= tB=U5@YPh?B=@5@YPh?B5@YPh?Br5@YPh?BX5@YPh?B>5 @YPh?B$5@uYPh?B 5$@[YPh @B5,@AYPh@B3ÐUMAt U ;uU ;uÐ3U\BB)Cu䡤B=-=(b=#-= t EÐ=!=%=$tw=&thw=*t\ =)tSb=+tHW=@t<=<t3 =/t*9=>t /=|t =^t =~uBBÐB)CtE EE=̴Bu=BuBPhJ@B,BBwÐB)CtBPtY BUEBB)CuEB)CtBPsY B=ht=ot&=qt=tt(=xu.EBEBEBEEBnE-0E} ~m'E9E|8B=̴Bu=BuEPh,@BNÐEBEBEEuUWU }3_Ð}}6E؉Et&tMt EEEu_UPB=^u-BEB5Bu`BÐUEBBo=BuBWE=BBCE=BB.E#BB-%|= w| $BB=*t.B=/t B=%tB=&tÐBEBBEE냐UPWMI_UÐUWVS} u3ۅ}؋}؋tu[^_ÐC%ׁ t&tt;}u}+t ttu̅tuNj[^_Ð˸[^_ÐUBEsBBEE=#tZ=+t3=-t<=<tm=>tz=@tG=|u|E BBlEBB\E+BBLE3BB<5BuB$E BࣰBE BBBPhk@BnÐU<ÐUxB"B=Et'=̴Bu=Bu hs@BYBBÐUW}u @B_ÐBEBBcB=Et'=̴Bu=Bu hs@BfYBBпCRh@BW =Bt @B_Ð_ÐUB=NuBBhBÐB=(uNMBB=)tÃ=̴Bu=Bu h@BYB뚐=̴Bu=Buh@BYҐUTB=!uB5BMYBÐUPB=-tB=~udBEBB=!udB5BYB}-u B BУBÐB=!uB5BYBU WVS] E=?~ =[}E E=_=zm_ECtZEpCE3<t4YG;}~E4CYECpCtECPYu [^_E4CpC3 G;~3[^_ÐU4WVSE U3E8=]tGuY;|~uh@BH[^_Ðhu_P _E_=\u`=&uEE=&t _Ph@B[^_ÐE@E=?~E=[}EUR PUE=_|=zE@=[t_PhABn[^_ËE UEXE3#=[uE=]uMtFCG}u=]t!_Ph%AB[^_ÐN= t= tFF= t= t덅EEEPEPV豗 PYt>tVPPYu!PhRABA[^_ÐP5YE}4=Cu hAB YPhAB[^_ÐEU3[^_ÐUP}@uE`U_|% jhEBhyBhxBEB5EB5EBhyBj袂=EBt5EBZY0@6u hyBY=EB}hB谀YEB[^_ÐEBu)hB菀YV(YȴB[^_Ð5EBVEB5EBVhyBjahBuEEB3EBEB=-tEB=.tܡEB8u EBTP5HC=LCEeBE==  >OjEPjV|uD}BG|uuuuuh}BS u hV t>q\h4}BsYE} t u YtSYtVYE[^_ÐUdWVSEEE}=,C|udYE=ehYPEEuBEEEEE4C#Yt WY3EEB=Ct}uE4Ch<}BLE}uEE3EjuhWI}*}u?YEE?W:Y@PYWSjEPjS}E=;uE}E=+uE}E==tnjhL}Bu( tXjhQ}Bu tBjhV}Bu t,jh\}Bu tjha}Bu utSHYu}tC}u}t7he}BYh}BYh}BYtWY[^_Ð}EE=@AuWh)~BMh^~BsY@AE}t^EHPuEH4C }Eh{~BYh~BYEEME=@Au h~BYEt jEPj jEPjW}uYE=~E9Er}t 9Ecuuu5 J}@uYE=)E@PYu hBuSW=uB~(h5uBh(B uB uBuBEB=uBuq=uBt 5uB YE@P_YuBu,hKBsYtWYuB[^_ÐEEu5uBCuY;Euuu5uB t}uPEE},C9E}(h:}BE4C-EFtW(Y=uBu4}t.} ouBBPuhnB~ [^_áuB[^_ÐEXCXC XCjhEBhJBh7B*pEB} EB_Ð5EBY=hXChEBr}hKBNY3_Ð5BhaB5tCƀ EB=EB}QhBhgB5BhmB5tC荀 EB}hsBYȴB3_Ðj58ChBj蔑`Ck̴B tW5EB- ȴB_ÐUPWhB~YhBnYGhBbYGhFBVYGhoBJYhB?YhB4YGB;~wi3h7BYhBYGB;~w23hBYGGB;~_w3hBYhӇBYGGB;~'w3hBlYGGB;~v3h@B?YGGB;~ vtw3hfBYGB;~ vtO3hBYGGB;~ |vt&3hֈBYGB;~Vvu3_Ðh BY_ÐUWVS}3EujB?u [^_ÐjWhkBj-)CG-0)Ctk G-0ȃ=:G)CG-0)Ctk G-0؃<d=:uUG)CtHG-0E)CtkE G-0E}<= ~?t [^_Ðik<EVh~BhsBj[^_U0WV}B>u)5BhEBj hBhBUEBSu'5BhEBj hԉBhBsUEB%5BhEBj hBh։BLUEBB=EB=EB5CY}h B=Y^_ÐE܉E؍EP YE؍@ P*YiEЋE؍@PYk<EЋE؍@PYEЉE;}ƀQ+uԃ=EB} EB=t=>t=],vEB}SEEB5BhDBh7B5DDBhDBmEB=EBt=EB}4EB^_Ð~?5EB;5EBt1hEB,Y^_ÐEB EB념^_Ð]}EB iEBP YȴB^_EBt jCYg>uK=EBtB)E}}ȴB3^_ËE#EB;EBuȴB^_jYEB EBu>u ȴB=EBu3ȴB3^_ÐU5BhEBhEBhBhB WEB}"=EBhBYÐ=EBthBYÐ5EB58C58CY8CЍREB5BhEBhBhڊBETEB}%=EBuhBGYÐEBÐ5EB5EBsEB} EBÐj58ChBjЉj5EBhBj蹉5EB58C.}"5EB58ChB ÐȴBÐU= B}!5 Bh2BnȴB3á8CXCE EPhXCu^N =~8CEjuhPBj5 BhmBh]BDj BHk(xCh}Bj迈jU Y5 BhBhBj蓈= B BHk(xCk̴B `CЃ:urjhnB BHk(xC WjhsB BHk(xC 1jhxB BHk(xC  F5 BhBhBjˇuIYE}E@PYE B@h܎B5C豽jhEBhBhގB'H} 5EB5XC能XC`@3hhB<hBY=ԴBtF5By B@k(xCEPj BhܪhsG WhtBhcBjx5 BhBhuBjx B4TChBhBjxTu%= B~ B BTCTC[^_ÐUhWVS]} u3EEu hBhBj8x5̴BhBhBjx5 BhΐBhBjx5@hېBhϐBjwjShܐBjwSXYE=:t3EEËUJӋM M}:ËUBUuShBj~wC=.tC= tCu"Sh BxȴB3[^_Ð=̴B7h#BJYȴB3[^_Ðk̴B `CЃ:uX} /u BTC BTCV]Y+E@EPVhWBjvEE;k̴B `CЃ:E} /@4CY@C@4Ch 58C贴 @C58CF= t= t=:5PC3&PC=!} PCPCGPC8u9}~EPSV費 t+}t1}PEPhבB臻 u E@C@ }uC5̴BhBhBj,u}~ouShB03[^_ÐE[^_Ã=̴BShB3[^_Ð={uE=}uM}t }6=,u E }t=  =:}uEE3-G=2.E=!|!E=,tEEEU҈uȋEuSheBjtWEPhvBjs}t!HC̴B<tEPSM9}~EPEPS迹 E}tB}t%}PEPhB菹 tEEFE9EE9EuM5̴BhBhBjBs}t 3[^_Ðm+ShB=3[^_ÐjVhBjr B4TC[^_UP}u )BÐE={u(uDYHEEU=}u EEEÐUW3u Y=} _ÐE=\wE@E}dEE)CtEP YEE=%E=&u4E@=[jjjuh*BsEE=$t=Vt=MuE@=(u 3ENE=FuBjjjuh,BEt%jjuuh.BEtE}t]E 8CXCEPhXCuk6 58C螰YEP58Ch0Bjp}~ 3_ÐU4WVEB3C5Bh8Bh7B5EBhDB>RPC}8=PCuh9B訯Y^_Ð5CMqYt0PC'=PC'uN5C|Yt2-=PCu5ChNBDPC^_Ð3 PC= $vB5EBC WhqBhiBjoCd 3WhzBhrBjoC? =ȴBt3WhBh{BjZoC =ȴBu3WhBhBj"oC jEPhBhBIE}}^_ÐE=\u u3Y*5Bu5tCL^ =~ 3WuhBjnC6 n=PCu=ԴBt =ԴBt3C DC̴B ~3}IuDC̴BWhBhBjmC 5BEPhԒB=PCuBŒBPHE}'}=CuhՒB軬Y^_Ã=PCu3uSY=~3WhBhBjVmpu)YWhBhBj3muKE 8CXCEPhXCuR2 8CEPe)YWh"BhBjlC5BEPh?Bh#BGE}!}h@B«Y^_ÐuYEPYE} ~hPB茫Y^_Ð8CXCu5XCȫ5BEPhBhgBGE}} hB/Y^_uYEPwYEEE@= ~hBY^_ÐXCE@PCu5PC*u5XChBjku5PChBjvkHC̴B<t&5PC5XCЪEPhݓBhГB8E9E~EEP5PC5XC' EPhBhޓBjjPC=t= t!= u$}~}u }|3Co5BEPh BhBEE}uh B覩Y^_Ð}tuh.Bh!BjVj8CXCu5XC迩j5XCh/Bj$jjh;B5XC uDC̴BEjhAB5XC u 8@ExjhIB5XCʯ u BTCEM5XCujYt5XC躧YE*5XC͑YVHjYxV莧YE5BEPhmBhNB(DE}uhnBKY^_Ã}u蓨Y=5XC|YE8CE@PCu5PCUj5PChBjhjhB5PC赮 uDC̴BEjhB5PC肮 u 8@ExjhB5PC^ u BTCEM5PC iYt5PCNYE*5PCaYVhY V"YE5PChBhBjgE9E} =PC t"E9Eu =PCtE9E~=PC u3uhBhBj|guh”BhBjegWh̔BhÔBjPgC5BEPhBh͔BBE}u=Cu&hB-Y^_Ð}} E^_ÐuuhBjf8CXCu5XCCj5XCh Bjf5XCzgYWh'BhBjfC35BEPEPh3Bh(B2|}_Ð[F}_ËE8_ÐUW}WhߡBhءBj{\uhB莛Y_Ãu35C=CuBBPhBY _Ð|3}~"E9E ~uh B._ÐE}_ËEU _UWV%BB5BEPj uV#B} 5CYHE!CU= u CM}uۅCEtPCxuE}v}tuhBE^_DE U^_áC=^CxC@EE)Ct u YE}>v4}`s.ADE U@^_Ð5ChB聙^_5ChӢBe^_Ã}~"}tuhB@^_ÐC} ^_ÐE U^_ÐUWVS5Bh!BhB5BhXB3;} [^_Ð5Bh#Bh"Bjh@B;}[^_ÉܴBC}[^_Ãuwh/BY؅u4B;tS54BjEEuSh5BjY}} ShAB*ȴB3[^_Ð8C=(B$B@$B@}l5$BhlBEPP hsBEPhoBjS7T@T@5BhBhtB5̘BhxB6$B3>(B} (BÐ$B@@$B@}tD5@hB54C襓 hB54ChBjS<7T@T@Ð=@u @=@_@Ph@Y$B}$BÐ=@@uj RÐ5BEPhɤBhB+E} }juhʤBjVS}uhפBhYÐ54Chu EtExtp蓒Y~ E@EjuhBjRu58C^8CEvBEPK 5Bh$Bj EPhAB(Bj^5(B5$Bh,B(Ba} 4CPC5,BhYB5PCӅ h`B5PCh\BjSj)T@T@Ð(BH@ȴBÐhB;YÐ} 5Bh$Bj hyBhaB (B=(Bu$B(B\@=(By=$B}-5$BhzB趄Ð,BT@C5BhBhBjhԗB&,B},BÐ=,Btv5BEPj hBhB (B}}5$BhB5BEPj hߩBhƩB (Bl.(B,B`@$B,B\@,BX@P@=`@GEd@Eh@2=G5BhBhBjhA%(B} (BÐ-$B} $BÐ} u*+(B@@@@+(B@@@@ÐU5BhBh B5tBh B%(B(B=$B5Bh0Bh^BhB (B=(B50B观Y=2~j2h_B/50BhBtȴB5Bh$Bj hBhB (Bj5(B5$Bh,B (B,BBȴBÐhBYÐhBrYÐ5Bh$Bj hBhB$ (Bj5(B5$Bh,B(B|w,BBȴBÐhBYÐ5Bh$Bj hBBhB (Bh5(B5$Bh,B (B} (BÐ,BBȴBÐÐU=ԴBt hDBwYÐU h@l@5BEPhBhfB}Ã=t@t5t@Yt@E8~E=>tE=|thBYÐEE=>u!E=>uEp@EE= tE= tE8u/E=>uʫBӫBPhBeÐE=>u%uY}uh۫B4Ðh@E=|u3l@uht@4=@te5h@hBhBj?5p@hBhBj?5l@hBhBj}?j5t@h Bjf?UWVSh@l@p@=t@t5t@}Yt@E;#EES}~YEH23E=}t#E=>uuE=|uuN}̓}}}}SY؋E[^_Ðh@9u~u}~E9E} ul@3E=>uF=>u p@@p@G= t= t?u2E=>uu%WY}WhMB|[^_ÐWht@HO;v= t= tGSY؋E=@tw5h@hqBhbBjE=5p@hBhrBj+=5l@hBhBj=j5t@hBj<jShBj<[^_ÐULWVSUh@l@p@}[^_Ãu_5BhBhB5BhHBE}!}hB{Y[^_Ðju~[^_Ð=  $B5BEPhBh̬B EPY VuhBj;E]jShBj;hBSujCT@3+ 5BEPhBhB3} hBzY[^_ÍEPY =@t覫jEu T@ 5BEPhaBh:B EPY =@t@chcBhbBujDT@5 SH hfBheBhdBjHT@3 =@t/ 5ChgBiy[^_Ð5Bh\@hBh|Bh\@Y5\@vyYE=qcT@U5Bh\@hBhB^Ph\@7Y;5\@yY=}!hBxY[^_ÐkT@5BEPhۭBhӭB uxY@PwYEuhܭBxY[^_Ðuu]x5BEPhBhBcu1xY@PwYEuhBwY[^_Ðuuw5BEPh1BhB } EPYuwY@P wYEuh2B6wY[^_Ðuu}wuuujIT@}tunvYE}tuXvYE}tuBvYE3%C8hLBhKBhJBjIT@3=@t =@uhMBevY[^_Ð\@lB`@mB5BEPEPhBhnB7}hB vY[^_u58CRvC5BEPhڮBhB_QEP9Y=uhCvhCuY=^~hۮBuY[^_Ð$@8C\@ĒCT@s=@@s5BEPhBhBEPYhBhBujUT@<5BEPh3BhBC5uuY=}h4BtY[^_ÐEPYjTuT@5BEPhtBhOBEPYhvBhuBujWT@TodhyBhxBhwBjAT@35Bh{BhzB5ЗBhBEjEPhBh|BEPYBz@v@z@v@E%EEuEPhBjVT@[jEPhBhBE} E[^_ÐuxPs5BEPhɯBhB)EPYuxPhʯBjVZT@E5BEPhBh̯B }hBrY[^_huPhr 5BEPh5BhB }Uh6BqY[^_Ð;0=@tߢhbBuPjKuT@E5BEPhBhcB }hB0qY[^_huPq 5BEPhBhB }uuhBpY[^_Ð[|T=@thٰBuPjRT@=@tҡ[^_Ð} [^_Ð5ChڰBYp[^_ÐUEuhB3pY3ÐE PuhBj0hBhBuE PÐUP5Bh/BhB5$BhB$(B}(BÐ=(BEPY,B,}th0BoYËE@@@@@@ @@@@@ @$@(@,@0@,BÐ=(Bt =(Bu~$B=(Bu3@}t;hVB=@t RBTBPhNBjST@T@ÐȴBÐ5BhXBhWBjhA,B},BÐ$B} $BÐ(B-=$B}t:haB=,Bt]B_BPhYBjST@T@Ð,B@@_}t:hjB=,BtfBhBPhbBjST@T@Ð,B@@}t:hsB=,BtoBqBPhkBjS:T@T@Ð,B@@}t:h|B=,BtxBzBPhtBjST@T@Ð,B@ @W}t:hB=,BtBBPh}BjST@T@Ð,B@@}t:hB=,BtBBPhBjS2T@T@Ð,B @@}t:hB=,BtBBPhBjST@T@Ð,B(@$@R}t:hB=,BtBBPhBjST@T@Ð,B0@,@ÐhB[kYÐU5BhBhB5pBh(B (B(B=kc$DB5Bh$Bj hñBhB,Bj^5,B5$BhBÐ5BhűBhıBjhtB ,B5$B|`PC̴B ,B ȴBÐ5BhDZBhƱBjhB ,B$B} $BÐHC̴B ,B ȴBÐhBYÐ5Bh$Bj hBhȱB,Bj5,B5$BhBÐhhB54Ci 5Bh$Bj 54ChB+,B},B(B} (BÐB=Bt 5BhYBlC$B@PhY0BtM0BB0BlC$BB$BB$B$BB9$B~3ÐULE},uhBhYÐ}5Bh0B5P@h9B$B}$B50B54Ch4C0Bj軏YuȴB3Ã=@tFj&Y0B8t$BP@0BX@$BȴB=d@5@5d@h$B50By(B=~ȴB=(Bu#hSBZgYhlBOgYhBDgYs=(Bu50Bh²B(gU=(Bu50BhBg5=(Bu50BhBf50Bh%Bf=ȴBu8X@@5P@h|C g膕4@h@3Ð=$B~ $B@=d@}3h@50Bh|Cf-4@5@h|ChGBj '=H@tL>ȴBÐUWVSj 艶Y} tb\B`BdBhBpBtBxB|BBh\Bjjuj ؅t]EPYhQBj uj 蚺hoBj 苺hBj |hBj m3ȴB3[^_Ð!4@PhBhBj"!<@PhBhBj!D@PhBhBj 5@hBhBj 5@hBhBj 5t@hɺBhBj 5@hҺBhʺBj 5@hۺBhӺBjh 5@hBhܺBjN 5@hBhBj4 5@hBhBj 5@hBhBj 5(@hBhBj5z@hBh BjÐUW}u WhBj- %Ph%BhBj5X@h.Bh&Bjq5p@h7Bh/BjW8@Ph@Bh8Bj;@@PhIBhABjD@PhRBhJBj5@h[BhSBj5@hdBh\Bj5@hmBheBj5t@hvBhnBjGPhBhwBj5@hBhBjh5@hBhBjNNj@PhBhBj-5@hBhBj5@hBhBj5@hBhBj5@hBhBj5$@hǻBhBj5 @hٻBhȻBj_ÐUW}uڻBWjjj jWhۻBjZjWhBj@ Pj+_ÐUPWu\Y^~ E E W uE @Pu\E @_ÐUWV=DBuhA#[YDBu hB-Y=DBGU} uE B}uEB}uEBE t:Wu >Et#Vu'Et VuDB\@j5\@h Bjg^_ÐUWVS=Bt 5BZYuo[Y@PZYB=Bujh%BhBj3[^_huhC6[ EEB3EE= tE= tuZYEEUJM}EUJ= t֋EUJ= tCUECUEE= t Eu^C4XCW4XCh&BjGEuqWh8Bh.BjXC9B\CXC[^_ÐCUEE=\nEPYE=>)EE= tUPBeEt ~Ae} }^AAU@}u ^A?AAUBÐU4h:BzXYt@@EEPY=~u EPu Y Eu%hDB%XYE}tu uuX EU JÐUW=Bu_ÿhIB+XYhhCqWYj裞YE=Yt\3=Nt<= tJ = tAT= t8K=Qt?=qt =nu,hYBWY3(=yuhPBWYh\BWYQ_UuhBh~BjE=BtBXA@@@@ @j踧Yj谧Y5dATY4B=8Bt0jhBhBjhBjjjhBhBVYءjhCÐUWEP@Y}u B_ÐE8t# NjU:BG|BB_ÐUPuhмBhBj=@uDhѼB'VY 9z@u(5B-Y=Cu5ChBUÐߚhhC/UY5@uYE}} hBUYhܪhjhBhBjsz@=tp= 5ԴBhKBh3BjBX@P Y=ԴBW5B\Y=C>5ChLBUÐX@PfYjh2Bh BjÐjh_BhOBjX@P脗YÐU WVB=@tE=,$$0B^_u TYEuTYUЍR,~h`BWTuuu hwBWThBj}}@^_uhBWYT hBjKd@^_ÐuETYE0= uE0F=,~hBWSuhBWS hBjר@^_ÐuSYE0= uE0F=,~hBWSuuhBWnShBj`y@^_Ðu j:Su =SY@=,~hBW Suu hȽBWRhBj@^_ÐuRYE0= uE0u RYƍ@=,~hнBWRuu hBWnRhBj`y@^_ÐuYRYE0= uE0u 9RYƍ@=,~hBWRuuu hBWQhBj٦@^_uhBWQ hBj裦SUWVS=@=@DVh+Bh$Bjj腗YWh3Bh,Bj%=Fa===v=1=&!hPBjjj d hXBjjj H h^Bjjj , =R= = <= )=Ay3==2Z= H=C=B'=E=cs=Xl2=R=L=S=a=Zk=bX=rt%k=fB=eo[^_ÐhBjjj([@5lC;Y3[^_=l-PB3[^_=x=s=hBJY.hB:YhB*YhBY9YB=Bt΃} uE ^B}uEeBu !?Y=d~E lBu ?Y@e=|E~BBE=$B}~*}}$EPuu hBR>} |}u,E@@%Puu hBR[>}~2}})E-@%Puu hBR>M}~+}}"E%Puu hBR=uuu hBR=5Bj }z@nuhBR= 5BuhBR= hBjӑ'uuhBR^=5Bu jJ3Ðuu hBuu hBR=uuu hBR<5BjL렐uhBR< ܐU=4Bu%h L5طBDY5B5BW5BB75طB Y5B5BW5BB8@<@,@;Bt,jj5CX ShB5CYB}E8jj5C uhBT5CYrBBY5طB1Y5B5BW5BBjj5C h BY5CY5CY[^_ÊE u`jj 5CV =Btjd5ܷB5HCh+B|طBdܷB5CYjj5C 5CY5C<Yjj 5C 5CZY5CYE =$ BBHCBjj5Cp h/BY5CY5CY[^_Ðjj5C5 h;B|YܷBطB5CY5C\Y[^_Ðjj5C hJB,YܷBطB5CTY5C Y[^_Ðjj5C h_BYܷBطB5CY5CY[^_Ðjj5CE uhlBܷBطB5CY5CgY[^_Ðjj5C E8t>uhoBEP@& EPh{B"hhCj$h~BYܷBطB5CY5CY[^_jj5C] hBYܷBطB5CY5CY[^_Ðjj5C  uhBQ5CY5CCY[^_Ðjj5C hBY5CPY5CY[^_ÐDžh=@~kB =@ BEjj 5C] uhB5CYjj5C/ 5CYu5B5BhBlPk$lPhB@5CzYjj 5C 5@tYPhB5CBYjj5C 5C$Yjj5Cx 5CY5CYطBdܷBBBBBB=(G@t' hC}hhCj "lClC8B[^_Ðjj5C uhB=(G@ hClClCjj5Cq uhB5C Y5CY[^_Ð5C Yjj5C% 5C Yjj5C 5C Y5CMYطBdܷBBBBB8BB[^_Ðjj5C uhB5C Y5CY[^_Ðjj5CA hBY5C Y5C|Y[^_ÐUuh|B)!3ÐUuiY3U}uEB} uE Bu uhBP!=z@ uPhB ÍPYÐUP\@B`@BTC$@5dC`C0hBj;5@hBhBj!=dC`C@=-=@ dC`C@`C5dC`C0hBj`C==t5`C=-u;`C@EPY}4=z@ u3ÐjjOhB`C0S dC`5TChBhBj=@uI=TCct =$@t7=z@ uhBuh|B3YhBuCY3YÐ`@=TCstL=TCrtC=TCvt:=z@ uhBuh|B3YÐh6BuY3YÐ=TCrt =TCv5`@諛YtV5`@#{Yu:=z@ uhOBuh|B43YÐhnBuoY3YÐ`@BH5`@vY}8=z@ uhBuh|B3YÐhBuY3YÐ=TCvuW=@tN=@uEj Yt9=z@ uhBuh|B3YÐhBuY3YÐ=TCst=TCvt=TCrt =TCxu0=@t @=@t@@=@t @TCÐUWVS`C@5dCWh*Bj,`C dC=dC|`C=-uA=z@ u hABuh|B3Y[^_ÐhZBu跿Y3Y[^_Ð`CP@t>=z@ uhsBuh|B$3Y[^_hBu_Y3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B3Y[^_ÐhBuY3Y[^_Ð`C0YE}~E\@=z@ uhBuh|BZ3Y[^_ÐhBu蓾Y3Y[^_Ð@0@u@e$@ @^@=@@#~ @@#j$Y#=TCt?=z@ uhBuh|B3Y[^_ÐhBu׽Y3Y[^_ÐTCx =TCt?=z@ uhBuh|BE3Y[^_Ðh+BuY3Y[^_ÐhABh@Bh?BjFTC] =TCt?=z@ uhBBuh|B3Y[^_ÐhVBuY3Y[^_ÐTCv =TCt?=z@ uhjBuh|B3Y[^_Ðh~Bu軼Y3Y[^_Ð@TCv =TCt?=z@ uhBuh|B3Y[^_ÐhBuWY3Y[^_Ðt>=z@ uhBuh|B3Y[^_hBuY3Y[^_Ð$@E`C@\C =TCt?=z@ uh Buh|Bm3Y[^_ÐhBu觻Y3Y[^_Ðt>=z@ uh1Buh|B(3Y[^_hTBucY3Y[^_Ð`C dCt`C=-u@=z@ uhwBuh|B3Y[^_ÐhBuY3Y[^_Ð`C\@TCr $@ (@ =0@ =z@  jjt?=z@ uhBuh|B3Y[^_ÐhBuWY3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B3Y[^_ÐhBuY3Y[^_Ð`C`@ @B t>=z@ uhBuh|BL3Y[^_h6Bu臹Y3Y[^_Ð`C dC=dCn =z@ uhYBuh|B3Y[^_hpBu/Y3Y[^_Ðh@t@=z@ uhBuh|B3Y[^_ÐhBu߸Y3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B?3Y[^_ÐhBuwY3Y[^_Ð`C0h|Cgh'Bh|CPt 3@E=l.j5d@h@h|C&}@=z@ uh0Buh|B3Y[^_ÐhBBuϷY3Y[^_Ð54@haBhTBj55C4@t>=z@ uhbBuh|B$3Y[^_h|Bu_Y3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B3Y[^_ÐhBuY3Y[^_Ð`C0YE S0?Y=~OB4@=z@ uhBuh|BF3Y[^_ÐhBuY3Y[^_Ðt>=z@ uhBuh|B3Y[^_h Bu;Y3Y[^_Ð`C dC=dC|`C=-uA=z@ u h0Buh|B3Y[^_ÐhCBuӵY3Y[^_ÐEP54*C`C0hh&C}@=z@ uhVBuh|B63Y[^_ÐhiBuoY3Y[^_ÐPA;5CuE3PAVYEt>=z@ uh|Buh|B3Y[^_hBuY3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B_3Y[^_ÐhBu藴Y3Y[^_Ð`C0=YE} ~2@9E(E@ @}^a @^R=z@ uhBuh|B3Y[^_ÐhBuY3Y[^_Ðt>=z@ uhBuh|B3Y[^_h.Bu˳Y3Y[^_Ð`C dC=dC|`C=-uA=z@ u hHBuh|B+3Y[^_ÐhcBucY3Y[^_Ð`C0 YE} }"E$@}<@-=z@ uh~Buh|B3Y[^_ÐhBuY3Y[^_Ð@@@@8@@@t>=z@ uhBuh|B 3Y[^_hBuGY3Y[^_Ð`C dC=dC|`C=-uA=z@ u hBuh|B3Y[^_ÐhBu߱Y3Y[^_Ð`CE-e|2=w+|'$4BE8@8@=z@ uhBuh|B3Y[^_ÐhBuWY3Y[^_ÐL@P@T@D@+@x@@x@t>=z@ uh"Buh|Bp 3Y[^_h=z@ uh"Buh|Bp 3Y[^_h3Bu諮Y3Y[^_Ð}uJ=$@~A=z@ u hDBuh|B# 3Y[^_ÐhoBu[Y3Y[^_Ð5$@hBhBjuhBhBj=$@uTj Yt>=z@ uhBuh|B 3Y[^_hBu׭Y3Y[^_Ð@5@hBhBj35$@hB`C0jTCsUW}WhBhBj=B-=$$B=شBt hB Y5@j2 @=@mhB Y_Ð_ÐuhB5C ̴BHCЃ:uHC̴B C袊2Tt UjThBhBjWhBhBj5 BhBhBjWOYEPhBhBj5 BhBhBjxE_Ð5t6tEt tgu WY_ÐQu,Be/7_Ðkus農E}3E_Ð諲,B*/h0Bh/Bh.BjL hC}hhCj1lClC0u5Bh?Bh1B5Bh,B,B.0B,,Bt 830B,B(,Bs(*u/jh8BheBhPB蹥,B>0(.uo5BhBhfBjhBC,B}=,B-j3YȴB_ÐG0B,5,B3YȴB_ÐuFȴB_Ð\uZȴB_Ð5BhBhB5BhB蟨,B=,BuhB1Y_Ð=,B+-蚰0BW+5,BY0B=0Bu3ȴB_Ð;t9u WXY_Ãh5Bh8BhBhB1,B,58BYE}uEBE8tuhBaj uhC Eb'V't7tYt Xtzu WY_ÐGjh8BhBhB轠0B}!=0B.*hBY_Ðh4Bh,B58B 0B)&0B)54B,BPz0hBiYȴB3_ÃSt(trt qtou{WY,B5,Bh0Bh!Bj(tSu>=,B~5=HA~,=HAt=HAu=̴Bu5LA0Y,B,BȴB_Ãu+=4B5(=4Bu =8B([*_Ãu '_Ðt]u W2Y_Ð5Bh0Bh8BhBhB,B} =,B%hBY_Ã=0BthBY_58B58C 8B B5Bh8BhB5Bh8Bh'BhVB,B=,Btw=,Btn=,Bte=@u:=,Bu1h(BY=BthC_SYB_58B58C,B}*=BahCSYBG58CY,B=,B~8C,BJ=/t58CEEERBE|uM5Bh`BhSB5BhB,B=@thjBY_Ðeu=@thBeY_Ðeu'=@t=@thB8Y_Ðteu&=@t =@uhBY_Ð`@;B;B\@=@u5Bh0Bh8BhIBh,B@P1Y8B=8Bt55`@58BE8BPE@ B3_hB Y_ÐhBY_ÐhBY_Ð@ @=@PtmuJ$@8CXC@@=@0hBdY_ÐuK=@thBAY_Ð跖,B6T@x=@.5Bh BhB5DBh8B0,B=,BuhBY_Ã=,B5,BY0B=0Bh6BY_Ð5BhWBhMB5BhHB裍,B=,BuhXB5Y_Ð=,B/j5,B0B=0BKh~BY_Ð5Bh8BhBhBQ} _Ð=@&=4Bu =8B/58BeY,B5,BhBhBj<X@P-Y,BȴB_Ð`=@thB%YȴB3_Ã=4B=4Bu =8Bt=@uhBY_Ðh|ChB54C 5Bh8BhBB54C1,B58B4YȴB_Ð uG5BhDBhCB5BhB請,B=,BV5,B蟵Y_Ð!5Bh8BhBhOB,B=,Bu 8BB =,Bf,B8Bu 5l'@'58B5p'@hB58C58CJcY"u,B6ȴB_Ã1t 05Bh,Bj hBhBq0B| 5Bh8BhBhB蠆0BR 58B5Y8B8t58BhB1u.葦A58B50BR<5 BhBhBuNu 0B jY3_Ã$=@~hCMY_Ð0B8Bh0Bh8Bh%C;m 5BPjh,Bh8BhDCh.Ct0B} =0B% hECY_Ã=,Bth_CY_58B58C0B 58CSHYȴB_Ð%5Bh0Bh8BhChCPs,B} =,B; hCY_Ã=0BthCY_58B58CGg0B$ =4BH =4Bu =8B2 5B58ChCjsBP58CPȴB_Ð&5Bh0Bh8BhChC\r,B} =,BG hC*Y_Ã=0BthCY_58B58CSs0B0 j58Ch2Cj覥58CYȴB_Ð4u3.0B 5̴Bh7CE ?0B 58@5L@50@h]CB=4@t5,@huC&=<@t5<@hC  hCYh@@WYȴB_Ã'5Bh8BhChCI0BhCAYEut'@E}uY|58BuhC58C58C^YOAtat 5BhChC5(BhBb,B}=,B hCY 5Bh8BhChCZ0B 58B0Y8B,B=w | $HB_0B.0B"0B0B 0B 50B9Yv,BhC'Y =,Bu58BhChxCd 58BhC=̴B =,BuhChxC& hCY 58B50B6,B=,B2 hCqY" sttu:,B`su3@ȴB_Ãvu{5Bh8BhChCk,B 58B58CDd,Bh58C ,B=,Bwuw5Bh8Bh1ChCek,B58B58C,Bc58CY,B=,BNP{u;覊4B@@ȴB_Ð}u~ȴB_Ð~u{5Bh8Bh]Ch2CE~0Bh^C58C58B58CjPj@58CDž uG҉4B} 4B_Ðh8B Y58BhfCȴB_WhxChjCjҟ_ÐB,B,BB9,B|ޡBlC0B,Bt4B0B,B t C0B,B@tz=@tI@9E8t0YExt pYE@ EuYEE}uB@@0B=0Bu3ȴB_Ðk0B tCk 0B  Ck0B 0BCk0B tCk 0B T C0BB90B|5BhBhB5BhC,B}"=,BIhB,Y_Ð5Bh8Bh/BhB{0BH`Ck̴B t58B5,Bi =J_Ð8B,B=\u^,B@8BE=nt.E=Nt#=bt=Bt=lt=Lt=\u8C0B0B\8B,B8C 0B ,B0B8B,B<N8C0B0Bj58ChBj轜8C0B@8B58C'Y +J,B5,BhBhBjxh,Bh8B58Ca }ȴB3_Ð8C0B@8Bj58BhBj#58BYȴB_á0B$CE=[uCE=Pt=\~j=`}cCE=_=C=8BjhChCj4BCE=/~=|8E=|CmE=/~(E=}CDE=?E='CE=uC=4Bt+C9C}dCCCM 4BCdCCE=\uAC=4Bt{PhChCj謒dCCÐC=4Bt:C@;C},dCCCdCCCM 3ÐUPE%EjEP5C ÐUjj_jh ChCjjhCgÐUjh+ChCjƑhC!Yu(h/jj5CjhBCh,CjyUPjjuhOChCCjPjEP5Cu uh]ChPCj%E%H=$@CC=Ct 5Ch(Coj-Y=Ctj 5C=@u$̛Ct̛CoCPh^Cz@hCYjhCjhT@5C 5T@hChCj5h0j}j5CÐz@jhChCj8B=z@ujhChCjʏjhC5C C@P5dC5C 5C5dChCjjhC5C =C~/jhC5C 5C5C5Ck CCCCC5Ch(C}UP3҃=C~5C5CСCCCÐUPCCUC=Ct =CuK5ChChCjd5C5CECCCEÐ3U5ChChCj=CCCCjhChCj؍j YEPhChCj踍}CCUC,E~?+C9E~+CE5Cu E~ EC5Ch*ChCj3CCCC%E CEÐUWV 3~3dC=}dC=dC~ dC5dC5hCj dC=}<5L@h7Ch+Cj职=L@uOzu^_Ð됡hC`C dC`C`C%^_ÐU,WCjhECh8CjthFCYjjjj3jj'jjCC}} j_YjEP5C E~5CYC=@tJjhxCh]CjH5ChChyCj.5ChChCjz@iupYEEEP1YE8u:@!E=d@EPYE}u=CtEP0YE}E}}E3+EEz@ z@Mt }@|@}t3C:CPE|@hC5dCm5dC}YCj5dChBCjډ4B}u4<@PhVC@PhOCEPjEP=z@t P5YjhC5C C@P5dC5C 5ChuCh[Cj)5ChChvCjjhC5C =C~/jhC5C 5C5C5C 5z@hChCj計=@@t?}uC}uC=CtM=CtEPY=C5=8B(=C=Cu,=4Bu#jPY=@jY5C5dChCjćjyYjhC5Cb C@P5dC5CG 5ChChCjm5ChChCjSjhC5C =C~/jhC5C 5C5C5C "=4BuF@!E} u/=@Bt&u&Y=@t EPYE uY=@t EPYjfYE}}{5ChChCjq5ChChCjW_=@uhCaY}u hCYhhCYjY1uhCh Cj=@UWV3CjhChCj轅jj=@uhCYr=4@}#=h@u=@uh CYC=Cu;hJYCuh.C^YCCC=Cu;hYCuh^CYCCC=hCu'hYhCuhCY=Cu'hYCuhCY]hC`CdC=@5@h ChCj=5ChCh Cj#5Ch-ChCj 5dCh?Ch.Cj=@~zPhSCh@Cj̃=@jh|ChTCj詃j=h@t l@d@Ph@h|C}@h|ChcC5C 5CYjh|ChxCj=C=@=4Bh|ChC&=4@~54@hC =|@tU=X@uC X@HBP5X@X@5@%PhChCYh ChA CY=@t7hhChe C=дBt C CPh} Ca=@t h CKYhhCYX@PY}h C"Y5@h Ch Cj݁5@h Ch CjÁ54@h Ch Cj詁5D@54@Vh Ch CjvjYj=h@t l@d@Ph@h|C},h|Ch C5C 5CY5D@54@}h/ CY5X@hr ChZ Cj=Cu =8Bt3C4BCC5Chz Chs Cjh=C5Ch Ch{ CjD=C~ 5C腾YC=C~ 5CfYCChC#Yt2h CxY5L@h Ch CjCAKC=u/h C5Y5L@h Ch CjC=CtW=@u$̛Ct̛C CPh Ceh CXYz@C5Ch, Ch Cj=CCCCh0j#j5C5Cv 5CYCz@C5T@hJ Ch- Cjr~h(CYCC5Chg ChK Cj1~jjl5Chv Chf Cj}5Ch Chw Cj}5C+YC5CYC^_Ã=Ctojhw Chh Cj}CCEu(Cjh Chx Cj[}uh Ch Cj<}+ dC|`C`C% Euh Ch Cj|}u?5L@h Ch Cj|=L@MjaYC6@!E=Cu#PC5D*ChCPC5D*ChKPC5D*C hSPC5D*Cyh_PC5D*CXt*CfhgPC5D*C0d hpPC5D*ChwPC5D*ChPC5D*ChPC5D*CxhPC5D*C]hPC5D*CBhPC5D*Cs'hPC5D*CXthPC5D*C=V*C C=hPC5D*C< hPC5D*C! hQC5D*ChQC5D*Ch QC5D*C*C ChQC5D*Cd h!QC5D*CIuih&QC5D*C2Kh2QC5D*Ct*C Ch=QC5D*Ct*C ChBQC5D*Ct*C ChNQC5D*Cxt*C Ch\QC5D*CHhcQC5D*C-tJ` 5ChkQCA*C CH|=wʅ|$*C=*CcCt3=Ct*1=CtЃ= Cuj, C붐=C u*CE*C *jeYEE}D*CWM D*C8P=Ct%E= tPYE= uj YYC=Cu3D*C8= uFD*CW= u3=CukD*C8= uD*CW= tTD*C8= u8D*CW= u%/D*C8= tD*C8= t D*CWW5D*ChMCjRjO5D*ChxC蚑 hxC~YHEEMƀxCExC=!}}Ct4%=C= CX* CChMC5D*C\t=ClEPhMC5D*C(t*ChMC5D*Ct-*C ChMC5D*CeahMC5D*ChMC5D*Ct&hMC5D*C CLhMC5D*Cdt%hMC5D*Cݏ C h NC5D*C(t%hNC5D*C衏 ChNC5D*Ct%hNC5D*Ce Ch2NC5D*Ct%h5NC5D*C) C[hCNC5D*Ctt%hFNC5D*C ChTNC5D*C8t%hWNC5D*C豎 ChqNC5D*Ct%htNC5D*Cu ChNC5D*Ct!hNC5D*C9 CnhNC5D*Ct!hNC5D*C C6hNC5D*CPthNC5D*Cɍ C*ChNC5D*C t)hNC5D*C腍 C*CphNC5D*Ct)hNC5D*CE C*C0=C*CCzVhQChQCjfMjY=*CujY[^_Ð=*Cu#hyYjhQChQCjMHhVYjhQChQCjL=CtjY58@j54@? C=@uq=x@uh=Ct<'5@*Ct.5@*C=*CuQCQCPhQC衋 &=*CuRCRCPhQCy=D*Ct 5D*CۊYD*C=H*Ct 5H*C輊YH*C=L*Ct 5L*C蝊YL*C=*Cu 3 C[^_áCpujjL*C=*CE=Ct-=8*C~$=8*C}ICICPhZIC蝊 8*C=8*C5*ChIChICjOK=*C}jY[^_Ð=*C~ *Cj 5*ChICEPsCpEPjjx*C5*ChIChICjJ5D*CSYD*C=H*Ct 5H*C4YH*C=L*Ct 5L*CYL*C[^_ÐE}~B}~E5D*CuE}~D=Ct;5D*CY-=h@t#}} C=D*C:)E}Et*CjQYEM=?jY%ED*CMAM D*CUP=Ct%E= tPYE= uj YYD*CU= uD*CJ= t1D*CU= uD*CJ= t }O*C=C\=@Oj\YfE}5E(hMC軇YUjh2RChRCjzH5CYÐULWVS}E3RCCu C3=CE*Cd@C=C}=4B~ 4BC=C}%5ChaRC C3[^_ÐCC=C*t-=C+t$=C,t=Ct=C.t =C0u 3$C(CCH%CC=CuhRCsY C3[^_j5*ChRCj(GhYD*Cu!uhRC) C3[^_áD*ChhRChRCjF=H*Cuoh蹅YH*CuBuhRCʅ C=D*Ct 5D*C"YD*C3[^_ÐhhRChRCjZFhJYL*Cu_uhRC[ C=D*Ct 5D*C賄YD*C=H*Ct 5H*C蔄YH*C3[^_hhSChSCjEj5d@h@h|C }iEΉEh|C&Y= }1h|ChSCu *h|ChCSCuՄ h*SCu„EPY58@j54@蝩 j{Yj5Ch@h|Cs}4EΉEh|CyY= hhZSCuB{58@j54@% huSCh|ChSC诃Yh|ChSC蟃 C=D*Ct 5D*CYD*C=H*Ct 5H*C؂YH*C=L*Ct 5L*C蹂YL*C3[^_Ð=CtCC@8*C=Ct C C@pCC@tCCt**CC*CC*CCC *CCCCt=Cu CCu =Cuc5*CYE}~N*CUJ=;uC.=Ct#5*ChSC5L*CX L*C*ChYu=C~C3*CA=C}+5*C)Y*CC@ *C*CC*C=*C} *Cu'=*C} *C*C+*C*C *C<=@=x@ruhSC*Y)5*C} ~SCSCPhSC } -}#= C =h@t>Ph|ChSC迀 D#Ph|ChTC褀 =4@~54@h3TC舀 hATCwY=C~C C@lE=h@u4}~.E94@~#54@hUTC0uhTC uTCTCPhTC=*C~5*ChTChUCYh UCY4@ Ph|ChIUCj@5*Ch_UChPUCji@hNjl*Ch|yhXhNjhP*C*5l*Cj~= C t = Cu [^_3[^_ÐC@@*C'@*C;uC@*C@*C@*C8uC;u?Ujh*C)U WVCth`UCY*C^_Ð=Cu5$CY*C^_Ð*C3 H*C0 F|H*CƀjhwUChdUCj ?15*CY}*C^_VhUChxUCj>%E}=Ct EPDY3H*C׍O H*C G|H*CUEP5H*ChUCjY>E= = =T=tJhUCH*CP}thUCH*CPr}u <*C5<*CH*CPhUCj=H*C=0=4=Cu8H*C)CtH*C)C=+Ct&H*C= tH*C= uYC*CC=+Ct&H*C= tH*C= uC*C=C=Cj LYhUCH*CP |u*ChUCH*CP{*CuhUCH*CP{thUCH*CP{u <*C5<*CH*CPhUCj; *C=*C5*ChUChUCj;^_ÐUjhUChUCj;jhUChUCjx;ÐUuhVChUCjY;*CE*CE +C=H*Cu@h&zYH*Cu CÐhhVChVCj:<*Cjh:VChVCj:hhhlhXuh*C$jh^VCh;VCj: *CÐUWV35<*ChpVCh_VCjo:=<*C jXY%EPhxVChqVCj::EP=Ct%E= tP踾YE= uj 襾YYE= u *C =Ct hVCxY*C Co =Ct hVCxY*C C? =Ct h WCxY*C C =C/u+5HCqwY=1u=Cth&WCFxY=Ct h8WC.xY*C C =Ct hJWCwY*C C{ =C/u+5HCvY=)u=CthUWCwY=Ct hgWCwY*C C =Cu=C hwWC]wY hY*C =Cu/=Ct hWCwY*C C h%Y*C~ =Cu h%Y=$Ca=C#T=C/h@8OY=$Cth.=Ctփ=C/t̓=C=C#hK뱐=$Cu=C#t=C%=C=CtK=$Cu=C#t=C=C%8=C+h1=C=C%=C=$Cu=C#t=C)=Ch=Ct[=C%=Czh=C=C =C%6=C)h,Z=C;hY+=$C=C=(Ch=(C=C!=C=$Cp=$Ct*C C=(C=C=Cpl=C=CNh` T=C=Cf%=Cu h!=CP=CA=Cf=C =C=Cuh@8 Y*C=C =C/=ChY*C=$Ct*C C=C t =C/h%|Y*CT=$Cu =C#u*C C %=C t=Ct=C/t=C=C/h Y*C=$Cth,Y C=C=C=C/t=C#t#=C =C3=CEhSY*C+=C =C=C=CuhY*C=Cuh%Y*C=C uhY*C=C=C/z=C =Ct =CQh@8_Y*C7=C'=Cuh%Y*C=C 2=$Cth`"Y C=C=C=C=Ch` 蜿Y*Ct=$C=CFh"=$Cth` =Cuh A hWCoY=$C=Ct7h =$Ch Y=$Cqh%}=C =C=ChWCnYz=Ck=C^hWCnYN=$CthKQY*C)=Cuh-Y*C=C=C&hWCInY=C]=Ci=Ch@8赽Y*C=C uh葽Y*Cl=Cuc=Cu hKeY*C@=Ct=(Cu =$Ct% ~ *C=Uwͅ|$+C=*C9*CD=t|=CtahWC0mYD==Ru hWCmYD==Lu hXCmYGU=Cu hXClYhXClYEP5D*C)m^_Ð3D5F|3j脺Y%EPhVChyVCjf-EP=Ct%E= tPYE= uj ѱYYE)CFUTxjY%EEEPhVChVCj,E= t FUTEP=Ct%E= tPJYE= uj 7YYE= t uD5j5D*ChVCjh,VEPhVCjT,~GUŠT=O~D=)CtGGDjEPhVCj ,WEPhVCj+EPqkY=EPjYsU WVS=C=h@=D*CGt =Cu=Cu33ۅjhXCVj VjY= },F)Ct FP_iY;4@t^ù ~PÙPݕY}Sh&XCj04@*C=@u=x@uShCXCi=Cu;h[XC5D*C藸t$*C=Ct hmXCiY[^_ÐhxXC5D*C\u.h~XC5D*CEuhXC5D*C.t*C[^_hXC5D*ChXC5D*Ct*C[^_ÐhXC5D*CķhXC5D*C詷hXC5D*C获hXC5D*Cst*C C[^_ÐhXC5D*C@t*C C[^_hXC5D*Ct*C C[^_hXC5D*Ct*C C[^_hXC5D*C谶t*C C[^_hXC5D*C耶t*C C [^_hXC5D*CPt*C C[^_hYC5D*C uhYC5D*C t*C C[^_ÐhYC5D*Cصt)=Cu3*C C[^_ÐhYC5D*C蘵t*C C[^_h%YC5D*Chuh-YC5D*CQ*C[^_ÐUPW3=C= C WhAYCh2YCj'~+ C =ChBYCfY=h@t# C=Ct hUYCeY3_ ~! C =Ct^hvYCeYQu=CtChYCeY6 C=Ct!hYCۚY=Ct hYCReY_ÐUWVS33=CtL=@tC=C|:=C~ CH4%Ct =Ct CFuWhZCw=ZCt=T@thZCW苠=@t&=T@thZCj~} @=\Cj E 9EthjaCp0/ hjaCpT/ E9EE -9E}sE @9E~hE 9E}juu juu  ;]}9E 9E}juu  Ljuu  3|@}|:C@9E},} |&C@9E }juuu uءaCxXtjjuuaCxptjjuu}|%||| [^_Ð9]39}.9u)hjuuaCpPK" PZ. E;;juuu u$j; Puu#CfUfPCfUf3[^_UWVS}uaCxX(C@@3 aCxp(C@BءC@Hu [^_Ð}uju ujV2[^_hjWo- ju ujV[^_UWVuuu! uuu f ^_ÐUWVSE 9E<9E}u +u(CXHޡ(C@^u+u (CXJޡ(C@\ȡ(C@dЃ}u&;};} [^_Ð;}[^_Ð[^_Ð;}0;},hju aC$Z Pi, ;}XE 9E}(hjVaC$ P3, _hjVaCP , 7E 9E} aCxTaCxthjW+ N3[^_UWVSE 9E(C@dE 9E}ju u ju u (C@L=}"ju j (CRLЋ؃}u#;} ;}[^_;}[^_Ð[^_Ð;},;}(hju aCpHP* [;}(hjaCp0* ju j9 ,E 9E}ju u ju u 3[^_ÐUWVSaCxluaCu [^_áC@D`C<aCf@f|(C@4`C3aCxltuaC@t#E =CEE=CU+Ћ3؅~E=CCEE(C@NÉEEEE}u'(C@`;E}(C@`[^_ÐE[^_á(C@`;E}2hjE +EPaC4PC) (C %tFhjaC) (ChjaC@( KEEaCxuuE%C;B,t7aCxu,tV ;Y@u:YЁ~f(aCVP:P:YЋ/FFU/FuV:jP:} =L@ }VhVaCPH:P>:YЋEFuV:jP9}f=L@ t!jhkaC8tf(aC'f(aCf(aC}t Euh\C9hP29 =8Yf(aCCuf(aC(|CW[Y9uW>YW.YWYWYWYDž=$aCh8YaCtzj&8YaCt]j>7YaCt@h7Y aCC9 aCt 5 aCV7Y5aCJ7Y5aC>7Y5aC27Yf(aC}u (aCPYR[^_Ð$aCaCtCaCCaC@C aCCxs DžCu7Y(}t EjuaCPk7 aCƀaCaCaCaCaC aCaCaCaCǂǀ} uu 76YuE aCfU fl5aC<YaCaC3f@ы aC aCB aCaCƀaCaC aCǁj4jaCP5 aCnPhTaClPV5 3aCaCn JHJHJ H fJfHWVA5 aC@%5aCG;sFӁu;s+PjV4 tGaCaC@<;WbY;s#} fffu;s#+ùEPjSO4 Phju 4 =t5t+t!aCffPaCffDžDžhaC3YhaCz3Yt&2Y~aCffPt%2Y~aCffPhhTu 3 =t7fft+fftaCffPaCff aC aCAWY;s'} Ëu;s#+ùPjS2 We2 aC%=uMaCfaCt&aCPhTaClP1 3 aCxt aC aCǀaC@+aCP5aC5aC1 aC@(aCR+P5aCaC@P1 aClaCR(+P5 aCaC@(P^1 aCL aCDžU,aC ɉ taC`C p |aC4aCaC@=u$aCxuaCf@f| aCf@DžU8aC<t040uaC`C raCǀDžuސUWV}W=nc=bstO=ns=pttuE%juhfChaCWyLEaCE}3^_ÐjEPaCp` t=u F3^_ÐjEPaC@ t= uFtJ3^_ÐjEPaCp0 t&= uFu3^_ÐaC,u ^_Ð3^_ÐEU^_ÐU WVS}jQhfChaCW`KaCu [^_Ðs[^_ÐUWV}u EcjuhgChbCWKE aCE}u3^_ËEUEt>tu6),u#,Y@E^_ÐUheChxC+h\C(aC4dChxC* hfChxC*ÐUaCUaCǀÐUWVSDžl}qCDž`E \EXaC} sC%:uGDžӈGht&=t = `taC@TDžhaC@lT`t;Tt2aC@H9h} aCxtthaC@tTTt&aC@P9EuThsC)*hFhlllpTP)YlBlpO\X;G-1`=UM$ltCl@l\pl@lXpl@lUpl@lUpl@lUpnl@lU pRl@lU$p6l@lU(pl@lU,p1u3`=a|2=z(Gl-alpT=A=ZGlalfpf Pf=a|2=z(l@lGaTp,=A=Z l@lGaJpl@lGpG='DžhDžd=-uDždG=+Gllpllphl@lhӉpllpllphl@lh+Ӊpllpllphl@lhӉpzllpllphlBlp0llpllphl@lpllpllphl@lh#Ӊpllpllphl@lh ӉpCllpllphl@lh3Ӊpllpllph9hllpllph9hwllpllph9h|?llpllphhtG3lBlpllpllphh랐lpu3lp{lp҉p`llpuJjeW;j;W)- V=^KC$tCGuhsCV{"qC[^_Ð%t FӈΐlphG뉐- |=w |$tCDžt u͋=Xt =dt=ot=st =xӈsuhPV! hPV! F>ulkh -0hG؃0|9~܃}t3[^_Ël@ldhpUWVS}3E=%u8GU ;t=;u u [^_Ð=?uF=;uNGu3[^_ÐUWVS}3EEaC@,9 vCtaC9 vCuE)Ct!k G-0)Cuk =.uuGtaCxt}u[^_ÐCPUY[^_uV4[^_ÐUW}t?= vC2=$uG=<uuu W GPUY?u3_ÐUC@,hhC YjjzhXjC@5C YÐUjuC@,}u KÐj|YÐUW}aC} _Ð}aC9tF~aC}W>YWaCuWYaC3_Ð}뾐UPjjaC Ѓ}t!RjaC ÐUaCf}~MaCƀ}c~E@cdaCaCƀUÐaCƀaCƀaCƀАUWVaC|WYuEvYtjVaC^_ÐUWVS}u ](Ct3E%E%E}%~fE%~fEE~fEfuE!EaC@=taC@ EfEftE!EfEftpE!EE9Et:jSuu=u"(C@xEfEEйf fHEU;tSEPEPv [^_ÐEU;tSEPEPP E9EtjSuu [^_ÐU$WVS}u ]EaC4aC@EaC9uE܉}uEU܍‹aC#Et!EU܍‹U!E܁LEE|[E}~DE5EU܍‹U#`CtE`C EMt E} |ȋE܋UTEM܅H}u;aC4ttSj%P%P%@P% P%P%P%P%P%PaC4Y(Ph EpaCxuaCf@f|3#DžE#3ƅEEuaCU#9Ut)SjaCYP E3]EMEU#`Ct8SjaCU4YP E`C#EE}|3#DžEteEVEU#`CtBSjaCLU4$YP5 EE`CЋU#Ѕ҉Ut E} |aCf@f~SjaCp` aCE[^_ÐUWVSf}](CE(C@xEfu>Sj aC{YP aCtEf@f[^_á aCt*SjP aC+P: [^_ÐEkDUR;tCSjEkDP aCP EUkfT fPEkU;LSjEkP aCP EUkf f[^_UWVS}u uVPr =u [^_ÐPWw*[^_ÐUWVS}EGE;=CtGG3GGG$9E|G&9E fG&GHffG W^Yf;EfEfGWDY;=Cu3[^_ËÈGtW'YO ƈGt WY[^_Ð3[^_ÐUWVS}GGE+Pw0WDЍR+4 =,CtSVE+PjW,C;=CC@p;|C@fUfpC@ p;|'C@p;~CCR fru3(CR(Cx4n(C@4ECECt 3EEù@EYGp;~ GfpG UJfpO tW9&YGt WOY[^_Ð3[^_ÐEUEE9E|ùEÙ҉UuEEM E}|(Ctv(CEù@EEUEE9E|ùEÙ҉UuEEM E}|3[^_ÐUWVS}u ]||G;}G;| [^_ÐfGfO GtWY[^_Ð3[^_ÐU$WVSC9Eu 3E}t%Cxt}t C@3[^_Ð}uC9Et u3Y'aC=t}u Cxt C@CffvCCf@fvC(C@4 vC(C$vCCf@fvCCf@fvC(CX0XC(C%B(C%=(CfxthjaCC tC(C%thjaC aC=t*hjaCtaC4 hjaC hj aCl aCt hjaC]YPnhhj (C`CCxaCxt"hvCPaCp< CC3f fHf vCf vCCxu5CһYdvCEvCt3U+ЉUvCHECxCp (C@EEEt;tH=uCC@C@:EC@<@ECUUPCUUP vC;}u0#aC=uCfUfP:}}4uuEC@(%tuuCEE9EuuuGE9EuBCfvCfCfvCfP CCffvCCf@fvCvC;} uYf>fEE9EtH=u ;uCCEC@EvC9Eu vC9Et2uuvCPvCPfEfvCfEfvCC@CP(P(CP(P(aCƀCfvCfP:Cf@ 30C@,EEE}}EܹEEܙʸ vCMM #EuuuuNhC@DUUJ%PC@DUU܋%P CCRDMM܋P,juu E}}=$vCt=EعEEؙʸ$vCMM # 3EEtEEEE9Etuuuu=hC@DUUJ%~PC@DUU؋%~P CCRDMM؋~P,juu< EuuEtEEPu蠭CUP,hCp,E%P{ CUāP,}tVuu  }tVuu vCH9Euul YaCxt8aCxt-E%=_uj lYuuE@PuܬaCxtE%=~u`EP+YƋUĉEfvCE9EE9EO}EC@DU4 > uEvC9E|C@UfMf PvC9EuC@ fPVvCHECU@D‹U > u M}}C@ UfMf PC@UPvC;} 3(CRM[^_ÐUWVS(C %E%= EPEPuu uGE~9aCt (C@X (C@>E(CR:ЉU E>E9EaCxt (C%(C %tG(C %hjaC (CU(C %t)hjaC (ChjaC{ aCt.hjuaC8PG \3M(C%?E %= *EE;E}EEEEPuuuu }E3UЃ: t3 C;]|(C@<EE(C%te(C %t3 (C@8E(C@V;~(C@V;E}(C@VEMaCtE9]|ՋE@;}C]P[^_ÐvC;|CvC;|}uQaCxt5hvCPaCp<; fvCfvC5CaCxDu!aCgaCx XjuvCPvCPbfEfvCfvCaCxthvC+EPaCxDt aC@D!vC+EPaCMP\ CfUf5CYjvCPu5Cq[^_ÐU aCtJ(Cf@zf~t<EEEEE;E~ EfUfE;E} EfUfAEE;M|}܋G@E܃}K[^_ÐUWV}W<fGW:fFw@u^_ÐUWVSE@E9E | [^_Ð} }E E E;E~ E+E EEU UPU UP }tH 3@HE:>EE` %}t =t ffEfEMԃ}uExt u!Y}uExtu-Y[^_Ð3[^_ÐUju up ÐUaC=tTaCfaCfaCƀaCƀaCƀaCǀ覼3ÐUPaCt~aCB= tkaC|]aCBFjEPaC ~1aCaCBBfMf PÐ3UhvChxCh8C`C40vChxC hvChxCÐUPWVS}aCxu{aC%E}~}r [^_ÐEEvCaCtaC3ۋǙSU YO3[^_ÐUW}$t w$Yt w@Yt w1Yt w"Y0tG08t G00 Yw0Y4tG48t G40Yw4Yt wYt Yt YWY_ÐUW}u _ÐWY| YtCu$$aCC9tG7Y9'YYYYWY3_UPWV}fG8f~ ^_ÐtGfWfPwY@uGmG@ EfH8@@E}u=,Ct wYwD}YwtYWmY3^_ËGD4[Y=,Ct G4FYN륐U5CYÐU WVShmYaCHuf(aC[^_Ðhj+WC ]vC]vCK aCHt' FEFEEU>uމ=0C=,CtVhYaCDET3 E  fXC|ًE4C3[^_ÐUWVS(Cx85 aC3ۡaC@EaC@aCaCjaC}u$0wChuu 0wCڃEjaC}u$0wChuu 0wCڃE3faCaCjaC}u$0wChuu4 0wCڃEjaC}u$0wChuu 0wCڃE3f jCEwC4}u$0wChuu 0wCڃ뫐jj CEwC4UP}u$0wChuuB 0wCڃf|jj jaCpP P}u$0wChuu 0wCڃfjjaC$譸P}u$0wChuu 0wCڃfaCUP[^_ÐU0wCÐU}u0wChu uB 0wCU(WVS}u jH#YtlPYCDtP=,CtPj6Ct%}EPYCu,sbYsDYYSRYf`C3[^_Ð}CC 3fCffCfCfEfCfEfC (C@EEu%(C@C;|;5C|3CC(EC(EC(EC(E3CCEME% ЉEME% ЉEME% ЉEME% ЉCC(% C(3fC$fC8GfC&C0 fCX}u=t;E}EE}u=t;E~EEE9E=t E=u Ef9EUU;~ EUUfEUU;} EUUfEEԋCR:;}CUUfP:EEԋCR<;~CUUfPfEUUEU‹U؍‰EE+E@Puu- EEEEEEEE9EkCH g 3[^_ÐU(WVS}GtZE+EE}EE+EE;E~EE܋E9E$}|;E~fEf;E}fEfEEEE9E|O A<EA:EA@ȅ![^_UPWVSE؋E7F@9uV'YKEt$YEt YuVY[^_U$WVS}u GE%E%EEGEE== tz= } r }EGE3GG} ueE EÙ=CC+‹ЉUG;GEW Y!K}3ۋfGO E ^PW=tE5@ EPW=uEGEEGEG uG0%E~t G,%G, E܋ uGDU;4t_GP;} Gf PG UP;~ G f PGDU4=,CtGց ΁ fXCG;uCG&9Eu2jW=uEG;uKEE3EfEffGtW#Y}uVWC[^_ÀO }uW Y[^_ÐE[^_uWg=C;]|~UWVS}G(%t G t [^_ÐGEGE3GGGG$;|G&; fG$ffE PW?fGfEGtW/YEGt WBY[^_3[^_ÐU8WVS}=,Ct,CE,C EW$;|W&;G&@GE} }3+EE;E ~EE E+E EE+EEE7U+ЉU;U }EE EHE+E EHU+ЉUEfG8f @u3E܋GEЋG EGE}GDUEGDUWDMGDUM ;=C(Cx4(C@4UE(C@4U(CR4M(C@4UM (Ctu(CUE(CU(CM(CUM (EPGDU4GDU4 ;=CuCEЋUfPUЋMfJE̋UfPUfJ(C@U(CREЋUfPE̋MIf PMEEE}w} } E+EEHU+ЉU}~^GEGE3GGGfGfEfW菽YMEE}fGfE؈GEԈGO }tEȣ,CjSuE+PW,CtWY;=Ct}t WY[^_Ð3[^_ÐUPjjtRj4wC@4wC=u^_U=xCuh0|ChwCjxCÐ5xC!YÐU=xCt5xCYxCUW}G?t=:t = u= u ?tG_ÐU=xCu h2|ChwCxCu3Ð5xCYÐUWVuhhxC = |CWIY=|CW:Y=:j EPW W7YPj:W 9EuZWY|`~aƣ|Ct3=:t)j EPW? WYPj:WQ 9Et3^_WY|`~aƣ|C= |C=$|CWcY=(|CWTY=,|CWEY=|CG?t =,u?tG=|C |C^_øÐ 3ÐP|ÐhÐUW5L@Y}t1Et(uYPuj jh4|Cj WYPWj jh7|Cj _øWÐUWVSEPYg=<|Cuijj&@|CPY<|C=<|CuL@ 3[^_Ð=<|C @|C<|C;rߋE =ruEEE =ruEEE=<|C"?t+<|CPIY@|C<|C;rɋE =ru3EV Y9]t uYujS 9]tSYjuhP|ChL|ChD|CjY}u 3[^_Ð<|CUSYu V[^_ÐUWVE@ uYjjhEjjYEjjJEEP&Y=<|Ct<|C;4tu܃=L@tӃuEujujuj=<|Ct <|CE^_ÐUWV} }}L@ 3^_Ð]t?F EF F F3҉VC=at=rt =wt3^_ÀN jju N G=+uf N ^_ø*L$Q3ÐUW}WYjjG P GGg G tg _ÐOTÐUPU RuhXC[ ÐUPURu uA UWV}uEljEEWYEE=Gt2 =Et)t=XtPk=ft =et V=guMEE +=ut=ou0E=xuET|C}WY3[^_ÐGG=+t=-t=0t<EMT|C} W4Y GG؃0} i}T|C} WY GGE=xtE=XG =<t?t#T|C} W诿Y GGE,jVG P =u EET|CE)Ct=w7|3$xC}t#=HCM|ƀQhDCYLCH|G=w@|<$C}t,PC+0C=M|EQhLC2YE;u;uE9E|0EE9E9u}E}t0CE琐,CU+ЉU}tUCEPYEG ^_UWVSEQUE؃}}EQKE<CECƙCpC| FYF!Ft mnN|܉5C=Cƹtmn=nuUC3 TC+FTC;}UCGC5CCCtmn=nuUCCC+…|Ff`C*SCFE`C™fu`CF |UCC[^_Ëƹt mn+Fƹt mn;}U\WVS3EEEE3EEEjjEPñ jjEP賱 hCVYEtEE [^_ÐE=t E=uM}}mEiUQPǹ +x }|b} \EUP=.uFE@EGv}|2},EԊUP=.uE@EGI}|}~5EԊUPǹ +x H|=w| $ԊCEEu=/uGE@E[}u3 EFuEE̋UЋEPǹ +x E@CEУ,CẸ0CEȣ4CE8CEģ=A=@=H=G=I=dE{=\?=Ztg=P=,u }up=;u*}[ǹ +x E@EA6@@/@@/@@\@@/@@\@@\ C-Kermit 6.0.192C-Kermit 6.0.192, 6 Sep 96Copyright (C) 1985, 1996, Trustees of Columbia University in the City of NewYork. The C-Kermit software may not be, in whole or in part, licensed orsold for profit as a software product itself, nor may it be included in ordistributed with commercial products or otherwise distributed by commercialconcerns to their clients or customers without written permission of theKermit Project, Columbia University. This copyright notice must not beremoved, altered, or obscured. For further information, contact the Kermit Project, Columbia University,612 West 115th Street, New York NY 10025-7799, USA; phone +1 (212) 854 3703,fax +1 (212) 663 8202 or +1 (212) 662 6442, email kermit@columbia.edu,Web http://www.columbia.edu/kermit/.C-Kermit Server REMOTE Commands: GET files REMOTE CD [dir] REMOTE HOST command REGET files REMOTE SPACE [dir] REMOTE DIRECTORY [files] RETRIEVE files REMOTE DELETE files REMOTE LOGIN user password SEND files REMOTE PRINT files REMOTE SET parameter value RESEND files REMOTE TYPE files REMOTE QUERY type variable MAIL file user REMOTE WHO [user] REMOTE ASSIGN variable value FINISH, BYE REMOTE HELP Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. KermitXMODEMYMODEMYMODEM-gZMODEMOtherU1isabsoluteisabsolute returns0anonymousA1Apple IIA3MacintoshD7VMSDARSTS/EDBRT11F3AOS/VSI1VM/CMSI2MVS/TSOI4MUSICI7CICSI9MVS/ROSCOEK2Atari STL3AmigaMVStratus VOSN3Apollo AegisU1UNIXU8MS-DOSUDOS-9UNWindows-32UOOS/2main executing init filemain exits init fileInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commandsmain cfilefckcmai got interruptmain cmdfilInterrupt during initialization or command-line processing.C-Kermit quitting...Can't initialize!rx %srx %ssx %ssx -a %srx %srx %srbrbsb %ssb -a %srbrbrbrbsb %ssb -a %srbrbrzrzsz %ssz -a %srzrzkermit -irkermit -rCan't allocate i/o buffers!Can't open device: /dev/ttyCan't allocate packet buffers!main argc after prescan()main 2 cfilefmain argcckcmai setting interrupt trapgetiobs ok@+@O@X@0000001 111$1,141<1D1L1UNIX Communications support, 6.0.169, 6 Sep 96 Interactive UNIX System V/386 R3.2/dev/ttynonettgwsiz tt_rowsttgwsiz tt_colssysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! sysinit jchdlr: SIG_IGNsysinit jchdlr: SIG_DFLsysinit jchdlr: otherttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 *NOT* definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen got open fdttopen fdflagttopen alarmttopenmodem ttyfd alarm returnttopen ttyfdttopen tty access denied/dev/null%s is not a terminal device ttopen not a tty/dev/tty ttname=CTTNAM cname ttyname ctermid ttyname redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %s %sttopen ioctl TCGETA ttold.c_lflagCan't unset O_NDELAYttopen ttspeedttopen, ttyfd lcl lock filettclos ttyfdttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donetthang get settingstthang speedtthang turning O_NDELAY ontthang TCXONCtthang close(open()), OPENFLGStthang restore settingsttres tty modes restorettres errnottrpidttrpid PIDSTRING read%dttrpid pid/usr/spool/locksLCK..%s%s/%s%s/LTMP.%05dttlock flfnamttlock tmpnamttlock creat failedUUCP not installed or Kermit misconfigured %10d ttlock hdb pid stringttlock fpidttlock killttlock kill errnottlock removing stale lockRemoving stale lock %s (pid %d terminated) ttlock unlinkttlock found tty lockedttlock can't get fpidWarning - Can't remove lockfile: %s ttpkt parityttpkt xflowttpkt speedttpkt ttpmskttpkt netconnttpkt carrierttvt ttyfdttvt tvtflgttvt speedttvt flowttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failscongspdttgspd ttyfdttgspd cfgetospeed 1 ATTSVttgspd cfgetospeed 2 ATTSVttgspd codettgspd speedmyfillbuf readmygetbuf errnoSERIALSVORPOSIX myfillbufttflui ttyfdttflui ATTSVSVR3 job controljcconbgt jcconbgt jcshellconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconint SIGSTSTPconnoiin_chk pollin_chk my_countttxin nttxin MYREADttxin myread returnsttol nttol sttol tryttol okttol failedttol partialttoc timeoutttoc flowttoc errorttinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl myread failure, nttinl myread errnottinl myread ittinl untimed network myread failsttinl lengthttinl length^C... ttinl skippingttinl EOP lengthttinl ittinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttsndb ttyfdsndbrk ATTSVCan't send BREAKmsleep POLLgtimerztime: ATTSVcongm getting modes/dev/ttyconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb cccbrk.c_flagconcb c_cc[VINTR]concb returnsconbinconres cgmfconres isatty okconres restoring ioctl conchk contypconinc(0) errnoconinc HORRIBLE ERRORconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlsuspendpsuspend errorpsuspend ok?Sorry, device is not open ?Can't wait for child process? ?Command exit status: %d ?Command did not exit - cancelling it now. h<@<@<@<@<@<@<@<@<@<@<@<@;Zx0Nl$n m$n$n`m$n$nm$n$nmE@'UNIX File support, 6.0.115 6 Sep 96 Interactive UNIX System V/386 R3.2rm -f cp mv pwd ls -l ls -l cat df df who zopeni fpzopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinr zopenizopenizopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULL zopeno fp[]=stdoutwazopeno appendzopeno fopen argzopeno failed errnozopeno okzclose fclose failszclose error flushing last bufferzclose successzsinlZINFILL feofZINFILL freadZINFILL ferrorZINFILL errnoZINFILL count 0 EOF return -1ZINFILL count 0 not EOF return -2 zoutdump charszoutdump write okzoutdump write errorzoutdump write returns/dev/nullzchki stat failszchki skipping:zchki stat ok: access failed: access ok: length/dev/nullMalloc error 46 izchko access failed:zchko access ok:zrtol original nameNONAMEzrtol new namezstrip beforezstrip after tilde-strippingzstrip afterzltor name2zchdirzchdir 2zchdir 3HOME.zgtdir CWDBLwzxcmd pipe failure/bin/shzxcmd pid/dev/nullSHELLzxcmd...-czxcmd fork failurezxcmd pidwrzclosf filnumzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzxpand entryzxpand after tilde_xzxpand okzxpand fgen1zxpand fgen2 okzxpand 2 not okznextznewn: about to expandznewn matchesznewn number ok.~%d~znewn: too many names.~xxxx~zrename oldzrename new/zrename dirzrename no dirzrename link fails, errnozrename unlink fails, errnozcopy sourcezcopy destination/zcopy dirzcopy no dirU1zdatstr timelocaltime returns nullzdatstr year%04d%02d%02d %02d:%02d:%02dzdatstrzfcdat stat failedzstrdtBad creation date zstime date check 1Bad creation date zstime date check 2Bad creation date zstime date check 3zstime so far so goodzstime yearzstime fails - yearzstime 4 bad date zstime 6 bad date zstime 9 bad date zstime 12 bad date zstime 15 bad date zstimezstimezstime: zstrdt failszstime: tmzstime: A-pkt date ok zstime: Can't stat file:zstime: sb.st_atimezstime 0: can't set modtime for filezstime 0: modtime set for filezstime 1: comparezstime 1: comparepacketmail %s < %szprint filezprint flagszprint printfilezprint printpipecat %s | %scat %s >> %s%s %s < %slpzprint commandecho%s %ssplitpathsplitpath mallocsplitpath malloc failurefgen patfgen string spacefgen can't malloc string space addresultmatch strmatch skipLOGNAMEtilde_expand?Privilege cancellation failure /bin/shsh-c/bin/sh/bin/shSHELL-i-cisdir statisdir errnoisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseekL@M@#M@*M@2M@9M@@M@HM@LM@SM@hpxթթC-Kermit functions, 6.0.133, 6 Sep 96Error receiving filerenamereplacebackupappenddiscardaskupdateencstr string too bigencstr fits OK, sizeputfil zchout write error, setting czseendecode _write error - errnogetpkt: empty stringgetpkt: empty input functiongetpkt funcstrgetpkt: input errorgetpkt empty filegetpkt 1st chargetpkt fmaskgetpkt new rtgetpkt eof crc16getpkt eof ffcgetpkt leftovergetpkt osizegetpkt eof/eottinit bestlentinit setting justone=0tinit getsbufTransaction beginsGlobal file mode:binarytextCollision action:resetc fsizefnlist: no memory for cmargbufsinit nfilssinit cmargsinit cmarg2stdinsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamTransaction beginsGlobal file mode:binarytextsinit oksipkt pktnumsipkt ksipkt getsbufxsinit kNONAMErcvfilrcvfil cmarg2Receivingrcvfil substituting cmarg2rcvfil zstripUNKNOWNUNKNOWNrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2rcvfil discard refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure.rcvfil: nreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof successmailed toprinted with optionsreof returnssfile cmarg2sfile fnspathsfile zstripUNKNOWNUNKNOWNSATURDAY fncnvsfile pktnamsxpackSending as mode: binary mode: textSending from:SFILE fsecssdata entry, first drainsdata draining, winlosdata sbufnumsdata countdownsdata packetsdata cx/zseen, drainsdata spsizsdata eof, drainsdata ttchk *** interrupted, sending discard requestseof can't get s-buffersxeof nxtpkt failssxeof packetrpar 8bq sqrpar 8bq ebqrparentering sparspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar lscapuspar yspar lpcapuspar lp lenspar slow-start spsizspar lp spmaxspar windowspar window after adjustmentspar windowspar no windowsspar sending, redefine spmaxRemote system type: gnfile sndsrcTransaction cancelledgnfile czseengnfile nfils?Internal error expanding ADD list gnfile addlist filnamgnfile cmlist filnamgnfile ngetpathgnfile getpathgnfile absolutegnfile wildgnfile zxpandgnfile znextgnfile donegnfile znextgnfile skipping:not sent, reasonRead access deniedtypenxtdirfuncnxtnxtdir funcbuf %04d-%02d-%02d %02d:%02d %11ld %s %04d-%02d-%02d %02d:%02d %11s %s (directory) %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiessssnddir./*Listing files: "%s" snddir zxpandnxpndREMOTE DIRECTORYsnddirsinit() %10s: %s skippingdeleted directory: %s %ld file%s deleted, %ld byte%s freed ssDeleting "%s" REMOTE DELETEDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremsetadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new lenwhoarewe xfermodewhoarewe remote sysidL3N3whoarewe flag !"$'(+-.03569:RetransmissionRESEND PKT NOT IN WINDOWRESEND kresend pktinfo indexToo many retries. retry(resend)resend ttol returns(resend)kstart SOPkstart EOPB00zstart Zmodem SOPentering rpack, pktnumrpack getrbufrpack: ttinl failsrpack ^C serverrpack ^C en_finBad packet headerrpack packet length less than 3Bad packet lengthrpack bad sequence numberBad sequence numberrpack echorpack bctlrpack chklenpacket sticks out too farrpack block check Bchecked charsblock checkshould beChecksum errorchecked charsblock checkshould beChecksum errorchecked charsblock checkshould beCRC errorbad type B block checkChecksum error(crunched)rpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d-Transaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate complete, sizeWZ#Z# p@ p@p@p@p@#p@+p@0p@9p@Cp@Jp@Sp@_p@jp@up@|p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@p@ <DL    T \d   inibufs sinibufs rini_pkts: no memory for s_pktini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmksbuf makebuf returnmkrbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf, packetgetsbuf, sbufnumgetrbuf rbufnumgetrbuf wslotsgetrbuf dum002getrbuf dum003getrbuf new rbufnumgetrbuf foulupfreesbuf sseqtbl[n]freerbuf, slotfreerbuf no such slotfreerbuf, packetfreerbuf, new rbufnumfreerpkt seqfreerpkt kfreerpkt freerbufchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...free: %d, winlo: %d %ld%ld%dsattr pkt too longsattr spsizsattrsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsize23456789:;<=>name@nameunknownrsattr: refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgtattr: no memory for dsbufgattr file typegattr binary refused: typegattr attribute A = textgattr attribute B = binary refused: dategattr encodinggattr unk encoding attribute refused: encodinggtattr: no memory for dsbuf refused: bad disposition refused: mail disabled refused: print disabledgattr RESENDgattr: no memory for spbufgattr length refused: length bytes refused: length K%ldgattr fsizegattr RESENDN+gattr RESEND not binary%ldgattr RESEND OKN?gattr returnAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopena xflgopena remfileopena remappdopena dispopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text opena charsetCan't open output fileFailure to openError:opena errorcanned: cxseen czseenopeni sndsrc file numberauthorization failure openi authorization failure ok zopeni okcould not be opened openi failedopeno: name open cancelledauthorization failure openo authorization failureopeno failedFailure to openopeno ok, nameclsof dispFailure to closeIncomplete: discarded incomplete: discardedIncomplete: Kept incomplete: keptClosed@ʁ@v@aXb8c8c8cbbp-$.L../,00D11d23,5|67778:;D=>??p@,AAAAA A[ A A A A2 Au A A A A, Ae A A A A] A A A AE Aa A} A A AAaAAAA(AEAAA&A;A_AAA-A.AFAAAA_AAAAAAJAAAA7AlAAAAaAkAAAAKAAA ATAAAAAOAAAA#AjAAA$AmAAA.AwAxAAA(ArAAAAAVAAAA\AAAA4A{AA A" A7 A A A A A!Ai!A!A!A0"A1"AU"A"A"A#AD#Az#A#A#AC$A$A$A&%Ac%A%A%A!&A_&A&A&A'AK'A'A'A'A'A'A'A@(A(A(A(A)AZ)A)A)A(*Ao*Ap*A*A+AL+A|+A}+A+A+A2,A?,A@,Ah,A,A,A,AH-Af-A-A-A-A-A=.Aq.A.A.A.A.A.A./Af/A/A/A/A 0A40A{0A0A0A0A 1AX1A1A1A1A 2AW2A2A2A03Al3A3A3A3A4A_4A4A4A/5AC5AS5A5A5A5A5A5A6AG6A6A6A7A/7A@7AQ7Af7Av7A7A7A7A8AZ8A8A8A8A8A@9Am9An9A9A9A:A`:A:A:A:A';As;A;AA>A_>Aq>Ar>A>A>A?A^?A?A?A?A?A@Ah@A@A@ABAAAAAAAAAABABAhBABABA;CACACACACA5DAyDADADADADAEAEA1EA2EAGEAEAEA FAhFAzFA{FAFAFA-GAzGAGAHAHAHA9HAPHAHAHAHA IAEIAIAIA#JAlJAJAJA$KAKKAKAKAKAKA$LA]LALALA2MA{MAMA NAVNANANAOAd4TTd$8t88$TTdT\8Xd8d$48$D888H8h8D8$t888DD8888888t4x88448Tt88888D88(8(88iAiAjADjAjAjAkALkAxkAkAkA6lAulAlAlAmAmA*mArmAmAmAmAnAcnAnAnAnAnA2oA~oAoAoA pA,pAGpApApApA qAlqAqAqAqAArArArAsA6sAsAsAsA+tA^tAtAtAtAtA>uAuAuAuAuA'vAnvAvAvAwA5wAjwAwAwAxAxA:xA}xAxAxAyA]yAyAyAyA7zARzAzAzAzA:{A{A{A{A{A|A@|A|A|A|A;}A}A}A}A}A~AL~A~A~A/AHApAAAPAAAۀA%ApAÁAASAA؂A"A?AA̓AALAAAA>AkAAӅA A>AsAtAAAA0AzAAAA AVAAA3A4ATAAA/AvAÊAAA(AsAA΋AAAAGA]AAA.ACAAAAAAAAVAAAADAA׏AAA2ApAAːAAAASAAAA.ACAAAAAAFA[AAAA:AlAyAAǔAAAPAAݕA(AlAAAŖA AQAAAARAAA7AXAAٙA#AkAAĚAAAAAЛAA)AWAAAAxT8XThxXThTTTTTT$TDTtTTTTTT(dTH8TTTTT4(TTHTTTTT$TT4TTTTTTDAAeAAתA AGA 0@P`p [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -d log debug info to debug.log -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory other: -C "command, command, ..." (interactive-mode commands to execute) = means ignore following words, but place them in array \&@[]. If no action command is included, or -S is, enter interactive dialog. Usage: Trustees of Columbia University in the City of New York. Type INTRO for a brief introduction to C-Kermit. Type VERSION for version and copyright information. Type HELP followed by a command name for help about a specific command. Type NEWS for news about new features. Type BUG to learn how to get technical support. Press ? (question mark) at the prompt, or anywhere within a command, for a menu (context-sensitive help, menu on demand). From system level, type "kermit -h" for help about command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support. Welcome to C-Kermit 6.0. This version of C-Kermit was released concurrently with the second edition of the manual, "Using C-Kermit", and it is completely described there, with supplementary material found in system-specific publications, such as the Kermit 95 manual. The update files that accompanied edits 189, 190, and 191 are no longer needed. If the release date shown by the VERSION command is long past, be sure to check with the Kermit Project to see if have been updates.Welcome to UNIX C-Kermit communications software for: . Error-free and efficient file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing While typing commands, you may use the following special characters: . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. . CTRL-W: Delete the most recent word typed. . CTRL-U: Delete the current line. . CTRL-R: Redisplay the current line. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-N: Command recall - go forward in command recall buffer. . ? (question mark) Display a menu for the current command field. . ESC (or TAB) Attempt to complete the current field. . \ (backslash) include the following character literally or introduce a backslash code, variable, or function. Command words other than filenames can be abbreviated in most contexts. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request general help HELP command request help about the given command TAKE execute commands from a file Commands for file transfer: SEND send files RECEIVE receive files GET get files from a Kermit server RESEND recover an interrupted send REGET recover an interrupted get from a server SERVER be a Kermit server Important settings: SET PARITY communications parity SET FLOW communications flow control, such as XON/XOFF SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET DIAL DIRECTORY specify dialing directory file (optional) SET DIAL COUNTRY-CODE country you are dialing from (*) SET DIAL AREA-CODE area-code you are dialing from (*) LOOKUP lookup entries in your dialing directory (*) SET MODEM TYPE select modem type SET LINE select serial communication device SET SPEED select communication speed DIAL dial the phone number CONNECT begin terminal connectionFurther info: HELP DIAL, HELP SET MODEM, HELP SET LINE, HELP SET DIAL(*) (For use with optional dialing directory) To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. To speed up file transfers: SET RECEIVE PACKET-LENGTH (use bigger packets) SET WINDOW (use sliding windows) SET PREFIXING (reduce prefixing overhead) FAST (combination of the three above) For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: The Kermit Project E-mail: kermit-orders@columbia.edu Columbia University Web: http://www.columbia.edu/kermit/ 612 West 115th Street Voice: +1 (212) 854-3703 New York NY 10025-7799 Fax: +1 (212) 663-8202 USASyntax: INPUT { number-of-seconds, time-of-day } [ text ]Example: INPUT 5 Login: or INPUT 23:59:59 RING Waits up to the given number of seconds, or until the given time of dayfor the given text to arrive on the connection. If no text is given, INPUTwaits for any character. For use in script programs with IF FAILURE andIF SUCCESS. Also see MINPUT, REINPUT, SET INPUT. See PAUSE for details ontime-of-day format.Syntax: SET PROTOCOL { KERMIT, XMODEM, YMODEM, ZMODEM } [ s1 s2 s3 s4 s5 s6 ] Selects protocol to use for transferring files. s1 and s2 are commands tooutput prior to SENDing with this protocol, to automatically start theRECEIVE process on the other end in binary or text mode, respectively.s3 and s4 are commands used on this computer for sending files with thisprotocol in binary or text mode. s5 and s6 are the commands for receivingfiles with this protocol. Use "%s" in any of these strings to representthe filename(s). Use { braces } if any command contains spaces. Example: set proto ymodem rb {rb -a} {sb %s} {sb -a %s} rb rb NOTE: This feature requires REDIRECT and external protocols that can beredirected.Syntax: BYE Shut down and log out a remote Kermit serverSyntax: CLOSE nameExample: CLOSE PACKET Close one of the following logs or files: SESSION TRANSACTION PACKET DEBUGGING READ WRITEType HELP LOG and HELP OPEN for further info.Syntax: MINPUT n [ string1 [ string2 [ ... ] ] ]Example: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RING For use in script programs. Waits up to n seconds for any one of thestrings to arrive on the communication device. If no strings are given, thecommand waits for any character at all to arrive. Strings are separated byspaces; use { braces } for grouping. If any of the strings is encounteredwithin the timeout interval, the command succeeds and the \v(minput)variable is set to the number of the string that was matched: 1, 2, 3, etc.If none of the strings arrives, the command times out, fails, and\v(minput) is set to 0. Also see: INPUT, REINPUT, SET INPUT.Syntax: CONNECT (or C) [/QUIETLY] Connect to a remote computer via the serial communications device given inthe most recent SET LINE command, or to the network host named in the mostrecent SET HOST command. Type the escape character followed by C to getback to the C-Kermit prompt, or followed by ? for a list of CONNECT-modeescape commands. Include the /QUIETLY switch to suppress the informational message thattells you how to escape back, etc.Syntax: GET filespec Tell the remote Kermit server to send the named file or files. If the filespec is omitted, then you are prompted for the remote and local filenames separately.Syntax: LOG (or L) name [ { NEW, APPEND } ]Record information in a log file: DEBUGGING Debugging information, to help track down bugs in the C-Kermit program (default log name is debug.log). PACKETS Kermit packets, to help with protocol problems (packet.log)SESSION Terminal session, during CONNECT command (session.log)TRANSACTIONS Names and statistics about files transferred (transact.log) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created.Use CLOSE to stop logging.Syntax: SCRIPT text A limited and cryptic "login assistant", carried over from old C-Kermitreleases for comptability, but not recommended for use. Instead, pleaseuse the full script programming language described in chapters 11-13 of"Using C-Kermit". Login to a remote system using the text provided. The login scriptis intended to operate similarly to UNIX uucp "L.sys" entries.A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and'send' is the names, numbers, etc, to return. The send may also be thekeyword EOT, to send control-d, or BREAK (or \\b), to send a break signal.Letters in send may be prefixed by ~ to send special characters. These are:~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don'tappend a return, and ~o[o[o]] for octal of a character. As with someuucp systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect,e.g. ~0 or two adjacent dashes, causes a short delay. If you expectthat a sequence might not arrive, as with uucp, conditional sequencesmay be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.Syntax: RECEIVE (or R) [filespec] Wait for a file to arrive from the other Kermit, which must be given aSEND command. If the optional filespec is given, the (first) incomingfile will be stored under that name, otherwise it will be stored underthe name it arrives with. If the filespec denotes a directory, theincoming file or files will be placed in that directory.Syntax: SEND (or S) filespec [name] Send the file or files specified by filespec. filespec may contain wildcard characters '*' or '?'. If no wildcards, then 'name' may be used to specify the name 'filespec' is sent under; if 'name' is omitted, the file is sent under its own name. Also see ADD.Syntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.Syntax: REGET filespec Ask a server to RESEND a file to C-Kermit.Syntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position.Syntax: MSEND filespec [ filespec [ ... ] ] Send the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. An alternate name cannot be given.Syntax: ADD filespec [ [ ] ] Add the file or files to the current SEND list. Use SHOW SEND-LIST and CLEAR SEND-LIST to display and clear the list, use SEND by itself to send it.Syntax: SERVER Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program. Use FINISH or BYE to get C-Kermit out of server mode.The SET command is used to establish various communication or fileparameters. The SHOW command can be used to display the values ofSET parameters. Help is available for each individual parameter;type HELP SET ? to see what's available.Syntax: SET KEY k textOr: SET KEY CLEAR Configure the key whose "scan code" is k to send the given text whenpressed during CONNECT mode. SET KEY CLEAR restores all the defaultkey mappings. If there is no text, the default key binding is restored forthe key k. To find out the scan code and mapping for a particular key, use theSHOW KEY command.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, orBLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3specify more rigorous checking at the cost of higher overhead. TheBLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain noblanks.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31, 127-159, 255.The word "ALL" means the command applies to all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL isrecommended for safety. You can include multiple values in onecommand, separated by spaces.Syntax: SET MODEM ... Note: Many of the SET MODEM parameters are configured automatically whenyou SET MODEM TYPE, according to the modem's capabilities. SHOW MODEM tosee them. Also see HELP DIAL and HELP SET DIAL. SET MODEM TYPE Tells Kermit which kind of modem you have, so it can issue the appropriate modem-specific commands for configuration, dialing, and hanging up. For a list of the modem types known to Kermit, type "set modem type ?". Use SET MODEM TYPE NONE (the default) for direct serial connections. Use SET MODEM TYPE USER-DEFINED to use a type of modem that is not built in to Kermit, and then user SET MODEM CAPABILITIES, SET MODEM DIAL-COMMAND, and SET MODEM COMMAND to tell Kermit how to configure and control it. Give the SET MODEM TYPE command BEFORE the SET LINE command so Kermit can open the communications device in the correct mode for dialing. SET MODEM CAPABILITIES Use this command for changing Kermit's idea of your modem's capabilities, for example, if your modem is supposed to have built-in error correction but in fact does not. Also use this command to define the capabilities of a USER-DEFINED modem. Capabilities are: AT AT-commands DC data-compression EC error-correction HWFC hardware-flow ITU v25bis-commands SWFC software-flow KS kermit-spoof SB speed-buffering TB Telebit SET MODEM CARRIER-WATCH { AUTO, ON, OFF } Synonym for SET CARRIER-WATCH (q.v.) SET MODEM COMPRESSION { ON, OFF } Enables/disables the modem's data compression feature, if any. SET MODEM DIAL-COMMAND The text replaces Kermit's built-in modem dialing command. It must include '%s' (percent s) as a place-holder for the telephone numbers given in your DIAL commands. SET MODEM ERROR-CORRECTION { ON, OFF } Enables/disables the modem's error-correction feature, if any. SET MODEM ESCAPE-CHARACTER number Numeric ASCII value of modem's escape character, e.g. 43 for '+'. For Hayes-compatible modems, Kermit uses three copies, e.g. "+++". SET MODEM FLOW-CONTROL {AUTO, NONE, RTS/CTS, XON/XOFF} Selects the type of local flow control to be used by the modem. SET MODEM HANGUP-METHOD { MODEM-COMMAND, RS232-SIGNAL } How hangup operations should be done. MODEM-COMMAND means try to escape back to the modem's command processor and give a modem-specific hangup command. RS232-SIGNAL means turn off the DTR signal. SET MODEM KERMIT-SPOOF {ON, OFF} If the selected modem type supports the Kermit protocol directly, use this command to turn its Kermit protocol function on or off. SET MODEM MAXIMUM-SPEED Specify the maximum interface speed for the modem. SET MODEM NAME Descriptive name for a USER-DEFINED modem. SET MODEM SPEED-MATCHING {ON, OFF} ON means that C-Kermit changes its serial interface speed to agree with the speed reported by the modem's CONNECT message, if any. OFF means Kermit should not change its interface speed. SET MODEM COMMAND commands are used to override built-in modem commands foreach modem type, or to fill in commands for the USER-DEFINED modem type.Omitting the optional [ text ] restores the built-in modem-specific command,if any: SET MODEM COMMAND AUTOANSWER {ON, OFF} [ text ] Modem commands to turn autoanswer on and off. SET MODEM COMMAND COMPRESSION {ON, OFF} [ text ] Modem commands to turn data compression on and off. SET MODEM COMMAND ERROR-CORRECTION {ON, OFF} [ text ] Modem commands to turn error correction on and off. SET MODEM COMMAND HANGUP [ text ] Command that tells the modem to hang up the connection. SET MODEM COMMAND INIT-STRING [ text ] The 'text' is a replacement for C-Kermit's built-in initialization command for the modem. SET MODEM COMMAND HARDWARE-FLOW [ text ] Modem command to enable hardware flow control (RTS/CTS) in the modem. SET MODEM COMMAND SOFTWARE-FLOW [ text ] Modem command to enable local software flow control (Xon/Xoff) in modem. SET MODEM COMMAND NO-FLOW-CONTROL [ text ] Modem command to disable local flow control in the modem. SET MODEM COMMAND PULSE [ text ] Modem command to select pulse dialing. SET MODEM COMMAND TONE [ text ] Modem command to select tone dialing. The SET DIAL command establishes or changes all parameters related todialing the telephone. Also see HELP DIAL and HELP SET MODEM. Use SHOWDIAL to display all of the SET DIAL values. SET DIAL COUNTRY-CODE Tells Kermit the telephonic country-code of the country you are dialing from, so it can tell whether a portable-format phone number from your dialing directory will result in a national or an international call. Examples: 1 for USA, Canada, Puerto Rico, etc; 7 for Russia, 39 for Italy, 351 for Portugal, 47 for Norway, 44 for the UK, 972 for Israel, 81 for Japan, ... If you have not already set your DIAL INTL-PREFIX and LD-PREFIX, then this command sets default values for them: 011 and 1, respectively, for country code 1; 00 and 0, respectively, for all other country codes. If these are not your true international and long-distance dialing prefixes, then you should follow this command by DIAL INTL-PREFIX and LD-PREFIX to let Kermit know what they really are. SET DIAL AREA-CODE [ ] Tells Kermit the area or city code that you are dialing from, so it can tell whether a portable-format phone number from the dialing directory is local or long distance. Be careful not to include your long-distance dialing prefix as part of your area code; for example, the area code for central London is 171, not 0171. SET DIAL CONFIRMATION {ON, OFF} Kermit does various transformations on a telephone number retrieved from the dialing directory prior to dialing (use LOOKUP to see them). In case the result might be wrong, you can use SET DIAL CONFIRM ON to have Kermit ask you if it is OK to dial the number, and if not, to let you type in a replacement. SET DIAL CONNECT { AUTO, ON, OFF } Whether to CONNECT (enter terminal mode) automatically after successfully dialing. ON means to do this; OFF means not to. AUTO (the default) means do it if the DIAL command was given interactively, but don't do it if the DIAL command was issued from a macro or command file. If you specify ON or AUTO, you may follow this by one of the keywords VERBOSE or QUIET, to indicate whether the verbose 4-line 'Connecting...' message is to be displayed if DIAL succeeds and Kermit goes into CONNECT mode. SET DIAL CONVERT-DIRECTORY {ASK, ON, OFF} The format of Kermit's dialing directory changed in version 5A(192). This command tells Kermit what to do when it encounters an old-style directory: ASK you whether to convert it, or convert it automatically (ON), or leave it alone (OFF). Old-style directories can still be used without conversion, but the parity and speed fields are ignored. SET DIAL DIRECTORY [ filename [ filename [ filename [ ... ] ] ] ] The name(s) of your dialing directory file(s). If you do not supply any filenames, the dialing directory feature is disabled and all numbers are dialed literally as given in the DIAL command. If you supply more than one directory, all of them are searched. SET DIAL SORT {ON, OFF} When multiple entries are obtained from your dialing directory, they are sorted in "cheapest-first" order. If this does not produce the desired effect, SET DIAL SORT OFF to disable sorting, and the numbers will be dialed in the order in which they were found. SET DIAL DISPLAY {ON, OFF} Whether to display dialing progress on the screen; default is OFF. SET DIAL HANGUP {ON, OFF} Whether to hang up the phone prior to dialing; default is ON. SET DIAL METHOD {DEFAULT, TONE, PULSE} Whether to use the modem's DEFAULT dialing method, or to force TONE or PULSE dialing. SET DIAL TIMEOUT number How many seconds to wait for a dialed call to complete. Use this command to override the DIAL command's automatic timeout calculation. A value of 0 turns off this feature and returns to Kermit's automatic dial timeout calculation. SET DIAL RESTRICT { INTERNATIONAL, LOCAL, LONG-DISTANCE, NONE } Prevents placing calls of the type indicated, or greater. For example SET DIAL RESTRICT LONG prevents placing of long-distance and international calls. If this command is not given, there are no restrictions. SET DIAL RETRIES How many times to redial each number if the dialing result is busy or no no answer, until the call is succesfully answered. The default is 0 because automatic redialing is illegal in some countries. SET DIAL INTERVAL How many seconds to pause between automatic redial attempts; default 10. The following commands apply to all phone numbers, whether given literallyor found in the dialing directory: SET DIAL PREFIX [ text ] Establish a prefix to be applied to all phone numbers that are dialed, for example to disable call waiting. SET DIAL SUFFIX [ text ] Establish a suffix to be added after all phone numbers that are dialed. The following commands apply only to portable-format numbers obtained fromthe dialing directory; i.e. numbers that start with a "+" sign andcountry code, followed by area code in parentheses, followed by the phonenumber. SET DIAL LD-PREFIX [ ] Your long-distance dialing prefix, to be used with portable dialing directory entries that result in long-distance calls. SET DIAL LD-SUFFIX [ ] Long-distance dialing suffix, if any, to be used with portable dialing directory entries that result in long-distance calls. This would normally be used for appending a calling-card number to the phone number. SET DIAL TOLL-FREE-AREA-CODE [ [ [ ... ] ] ] Tells Kermit the toll-free area code(s) in your country. SET DIAL TOLL-FREE-PREFIX [ ] You toll-free dialing prefix, in case it is different from your long- distance dialing prefix. SET DIAL INTL-PREFIX Your international dialing prefix, to be used with portable dialing directory entries that result in international calls. SET DIAL INTL-SUFFIX International dialing suffix, if any, to be used with portable dialing directory entries that result in international calls. SET DIAL PBX-OUTSIDE-PREFIX Use this to tell Kermit how to get an outside line when dialing from a Private Branch Exchange (PBX). SET DIAL PBX-EXCHANGE If PBX-OUTSIDE-PREFIX is set, then you can use this command to tell Kermit the leading digits of a local phone number that identify it as being on your PBX, so it can make an internal call by deleting those digits from the phone number. SET DIAL PBX-INTERNAL-PREFIX If PBX-EXCHANGE is set, and Kermit determines from it that a call is internal, then this prefix, if any, is added to the number prior to dialing. Use this if internal calls require a special prefix.Syntax: SET FLOW value Type of flow control to use during file transfer and CONNECT mode.Choices: AUTOMATIC (the default, let Kermit choose for you); KEEP (don'tchange the device's current setting), XON/XOFF (software flow control),NONE (no flow control at all), and possibly others including RTS/CTS(hardware) depending on the capabilities of your computer and operatingsystem. Type SET FLOW ? for a list.Syntax: SET FILE parameter valueParameters: BYTESIZE { 7, 8 }: normally 8. If 7, truncate the 8th bit of all file bytes. COLLISION tells what to do when a file arrives that has the same name asan existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if it is newer than the existing file.Example: SET FILE COLLISION UPDATE SET FILE DISPLAY selects the format of the file transfer display forlocal-mode file transfer. The choices are: SERIAL (the default). One dot is printed for every K bytes transferred. This format works on any kind of terminal, even a hardcopy. CRT. Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. FULLSCREEN. A fully formatted 24x80 screen showing lots of information. This requires a video display terminal whose control sequences are understood by Kermit. NONE. No file transfer display at all. DOWNLOAD-DIRECTORY [ ]Directory into which all received files should be placed. By default,received files go into your current directory. INCOMPLETE - what to do with an incompletely received file: KEEP(default), or DISCARD. NAMES are normally CONVERTED to 'common form' during transmission; LITERALmeans use filenames literally (useful between like systems). Also seeSET SEND PATHNAMES and SET RECEIVE PATHNAMES. TYPE: How file contents are to be treated during file transfer.TYPE is normally TEXT, with conversion of record format and character set.BINARY means to do no conversion. Use BINARY for executable programs orbinary data. Example: SET FILE TYPE BINARY. WARNING. SET FILE WARNING is superseded by the newer command, SET FILECOLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAMEand SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. Syntax: SET HANDSHAKE value Character to use for half duplex line turnaround handshake during filetransfer. C-Kermit waits for this character from the other computer beforesending its next packet. Default is NONE, others are XON, LF, BELL, ESC,etc. SET HANDSHAKE CODE lets you specify the numeric ASCII value of thehandshake character. Type SET HANDSH ? for a list.SET SERVER DISPLAY {ON,OFF}Tell whether local-mode C-Kermit during server operation should put afile transfer display on the screen. Default is OFF. SET SERVER GET-PATH [ directory [ directory [ ... ] ] ]Tells the C-Kermit server where to search for files whose names it receivesfrom client GET commands when the names are not fully specified pathnames.Default is no GET-PATH, so C-Kermit looks only in its current directory. SET SERVER IDLE-TIMEOUT secondsIdle time limit while in server mode, 0 for no limit. SET SERVER LOGIN [ username [ password [ account ] ] ]Sets up a username and optional password which must be supplied beforethe server will respond to any commands other than REMOTE LOGIN. Theaccount is ignored. If you enter SET SERVER LOGIN by itself, then loginis no longer required. SET SERVER TIMEOUT nServer command wait timeout interval, how often the C-Kermit server issuesa NAK while waiting for a command packet. Specify 0 for no NAKs at all.Default is 0.The REMOTE command is used to send file management instructions to aremote Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.Syntax: IF [NOT] condition command If the condition is (is not) true, do the command. Only one command maybe given, and it must appear on the same line as the IF. Conditions are: SUCCESS - the previous command succeeded FAILURE - the previous command failed BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground REMOTE-ONLY - C-Kermit was started with the -R command-line option DEFINED variablename or macroname - The named variable or macro is defined DIRECTORY string - The string is the name of a directory NEWER file1 file2 - The 1st file is newer than the 2nd one NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n2 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 > n1 n2 - n1 is arithmetically greater than n2 The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less See also XIF.Syntax: EVALUATE expression Evaluate an integer arithmetic expression and print its value. Theexpression can contain numbers and/or numeric-valued variables or functions.Operators include +-/*(), etc. Example: EVAL (1+1) * (\%a / 3).Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Extended IF command. The conditions are the same as for IF (type HELP IF)but multiple comma-separated commands may be grouped within braces in boththe IF and ELSE parts. The ELSE part, if any, must be on the same line asthe XIF (or use dash for line continuation). Example: XIF equal \%a YES { echo OK, goto begin } ELSE { echo Not OK, stop }Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist thenumber of times given by the initial value, final value and increment.Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketedcommandlist while the condition is true. Conditions are the same as forIF commands.Syntax: SWITCH { case-list }The case-list is a series of lines like these: :x, command, command, ..., break where "x" is a possible value for the variable. At the end of thecase-list, you can put a "default" label to catch when the variable doesnot match any of the labels: :default, command, command, ...Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specifiedmode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or writeto a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename [ prompt ]Example: ASKQ \%p { Password:} Issues the prompt and defines the variable to be whatever you type in.The characters that you type do not echo on the screen.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: ASK variablename [ prompt ]Example: ASK \%n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: GETC variablename [ prompt ]Example: GETC \%c { Type any character to continue...} Issues the prompt and sets the variable to the first character you type.Use braces to preserve leading and/or trailing spaces in the prompt.Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally.No expansion or evaluation of the definition is done. Thus if thedefinition includes any variable or function references, their names areincluded, rather than their values (compare with ASSIGN). If the definitionis omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro).The definition string is fully evaluated before it is assigned, so thatthe values of any variables are contained are used, rather than theirnames. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This will print 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current valueis numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value isnumeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: SET EXIT ON-DISCONNECT { ON, OFF } When ON, C-Kermit EXITs automatically when a network connection is terminated either by the host or by issuing a HANGUP command. This command is not currently supported on serial connections. Syntax: SET EXIT STATUS number Set C-Kermit's program return code to the given number, which can be a constant, variable, or an \feval() expression. Syntax: SET EXIT WARNING { ON, OFF, ALWAYS } When EXIT WARNING is ON, issue a warning message and ask for confirmation before EXITing if a connection to another computer might still be open. When EXIT WARNING is ALWAYS, confirmation is always requested. The default is ON.Syntax: PAUSE [ { number-of-seconds, hh:mm:ss } ]Example: PAUSE 3 or PAUSE 14:52:30 Do nothing for the specified number of seconds or until the given time ofday in 24-hour hh:mm:ss notation. If the time of day is earlier than thecurrent time, it is assumed to be tomorrow. If no argument given, onesecond is used. The pause can be interrupted by typing any character on thekeyboard. If interrupted, PAUSE fails, otherwise it succeeds.Synonym: SLEEP.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given,100 milliseconds.Syntax: ! [ command ] or RUN [ command ] or PUSH [ command ] Give a command to the local operating system's command processor, anddisplay the results on the screen. If the command is omitted, enter interactive mode; return to Kermitby exiting from the system's command parser. The command is usuallyEXIT or QUIT or LOGOUT.Syntax: TRANSMIT file The TRANSMIT command is used for sending single files to other computersthat don't have Kermit. Text files are sent a line at a time; binary filesare sent a character at a time. There is no guarantee that the othercomputer will receive the file correctly and completely. Before you startthe TRANSMIT command, you must put the other computer in data collectionmode, for example by starting a text editor. TRANSMIT may be interrupted byCtrl-C. Synonym: XMIT.Syntax: WAIT { number-of-seconds, hh:mm:ss } [modem-signal(s)]Example: WAIT 5 \cd \ctsOr: WAIT 23:59:59 \cdWaits up to the given number of seconds or the given time of day for all ofthe specified modem signals to appear on the serial communication device.Sets FAILURE if signals do not appear in the given time or if interrupted bytyping anything at the keyboard during the waiting period. Signals: \cd = Carrier Detect, \dsr = Dataset Ready, \cts = Clear To SendSyntax: WRITE name text Writes the given text to the named log or file. The text text may includebackslash codes, and is not terminated by a newline unless you include theappropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGSyntax: LOOKUP name Looks up the given name in the dialing directory or directories, if any,specified in the most recent SET DIAL DIRECTORY command. Each matchingentry is shown, along with any transformations that would be applied toportable-format entries based on your locale. HELP DIAL, HELP SET DIALfor further info.Syntax: ANSWER [ ] Waits for a modem call to come in. Prior SET MODEM TYPE and SET LINErequired. If is 0 or not specified, Kermit waits forever or untilinterrupted, otherwise Kermit waits the given number of seconds. The ANSWERcommand puts the modem in autoanswer mode. Subsequent DIAL commands willautomatically put it (back) in originate mode. SHOW MODEM, HELP SET MODEMfor more info.Syntax: DIAL phonenumberExample: DIAL 7654321 Dials a number using an autodial modem. First you must SET MODEM, thenSET LINE, then SET SPEED. Then give the DIAL command, including the phonenumber, for example: DIAL 7654321 See also SET DIAL, SET MODEM, SET LINE, SET SPEED, REDIAL. If the phonenumber starts with a letter, and if you have used the SET DIALDIRECTORY command to specify one or more dialing-directory files, Kermitlooks it up in the given file(s); if it is found, the name is replaced bythe number or numbers associated with the name. If it is not found, thename is sent to the modem literally. If the phonenumber starts with an equals sign ("="), this forces the partafter the = to be send literally to the modem, even if it starts with aletter, without any directory lookup. A dialing directory is a plain text file, one entry per line: name phonenumber ; comments for example: work 9876543 ; This is a comment e-mail +1 (212) 555 4321 ; My electronic mailbox heise +49 (511) 535 2301 ; Verlag Heinz Heise BBS If a phone number starts with +, then it must include country code andarea code, and C-Kermit will try to handle these appropriately based onthe current locale (HELP SET DIAL for further info); these are calledPORTABLE entries. If it does not start with +, it is dialed literally. If more than one entry is found with the same name, Kermit dials all ofthem until the call is completed; if the entries are in portable format,Kermit dials then in cheap-to-expensive order: internal, then local, thenlong-distance, then international, based on its knowledge of your localcountry code and area code (see HELP SET DIAL). Specify your dialing directory file(s) with the SET DIAL DIRECTORY command.DOHELP xxSyntax: APC text Echoes the text in the form of a VT220/320/420 Application Program Command. Use the APC command to send commands to MS-DOS Kermit 3.13 or later.Describes how to get technical support.Syntax: BEEP Sends a BEL character to your terminal.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: CLEAR [ { DEVICE, INPUT, DEVICE-AND-INPUT, DIAL-STATUS, SEND-LIST } ] Clears the communications device input buffer, the INPUT command buffer, or both. CLEAR SEND-LIST clears the SEND list (see ADD). CLEAR DIAL-STATUS clears the \v(dialstatus) variable. The default is DEVICE-AND-INPUT.Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: COPY source destination Copy the file 'source' to 'destination'.Syntax: CD [ directoryname ] Change Directory. If directory name omitted, changes to your home directory.Syntax: DECLARE arrayname[size] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables.Syntax: UNDEFINE variable-name Undefines a macro or variable.Syntax: DELETE filespec Delete a local file or files. RM is a synonym for DELETE.Syntax: PDIAL phonenumber Partially dial a phone number. Like DIAL but does not wait for carrier or CONNECT message.Redial the number given in the most recent DIAL commnd.Syntax: DIRECTORY [ filespec ] Display a directory listing of local files.Syntax: DISABLE command Security for the C-Kermit server. Prevent the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Execute a macro that was defined by the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1, \%2, etc.Syntax: ECHO text Display the text on the screen, followed by a line terminator. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: XECHO text Just like ECHO but does not add a line terminator to the text. See ECHO.Syntax: ENABLE capability For use with server mode. Allow the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exit from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: E-PACKET Send an Error packet to the other Kermit.Syntax: QUIT (or EXIT) [ number ] Exit from the Kermit program, closing all open files and devices, optionally setting the program's return code to the given number.Syntax: FINISH Tell the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Print the prompt, make user type 'yes', 'no', or 'ok', and set SUCCESS or FAILURE accordingly.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1996,Give a brief introduction to C-Kermit.Syntax: REINPUT n string Look for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Change the name of file 'oldname' to 'newname'.Introduce a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Send the file to the remote Kermit, which must be in RECEIVE or SERVER mode, and request that the remote host deliver the file as electronic mail to the given address. Example: MAIL BUG.TXT KERMIT@CUVMAMMOVE is exactly like MSEND, except each file that is sent successfully is deleted after it is sent. Print news of new features since publication of "Using C-Kermit".Syntax: OUTPUT text Send the text out the currently selected line, as if you had typed it during CONNECT mode. The text may contain backslash codes. Example: OUTPUT help\13Syntax: PRINT file [ options ] Print the local file on a local printer with the given options.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Read a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with with \fexecute(macro), which allows macros to be used like functions.MOVE is exactly like SEND, except each file that is sent successfully is deleted after it is sent.Syntax: SUSPEND or Z Suspend Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET ySorry, help not available for "%s" Syntax: REDIRECT command Run the given local command with its standard input and output redirected to the current SET LINE or SET HOST communications path. Synonym: < (Left angle bracket).Display current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TYPE file Display a file on the screen. Pauses if you type Ctrl-S, resumes if you type Ctrl-Q, returns immediately to C-Kermit prompt if you type Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Declares a variable to be local to the current macro or command file.View the terminal emulation screen even when there is no connection. Synonym for SET FILE TYPE TEXT. Synonym for SET FILE TYPE BINARY. Prints the current date and time. Just like GET but asks the server to delete each file that has been sent successfully. Equivalent to SET PARITY NONE, SET COMMAND BYTE 8, SET TERMINAL BYTE 8. Syntax: SAVE KEYMAP Saves current keymap definitions to file, "keymap.ini" by default.Sorry, help not available for "%s" %s %s Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command, used for uploading filesto computers that don't have Kermit programs. Parameters are: ECHO ON/OFF: Whether to echo text as it is being transmitted.EOF text: Text to send after end of file is reached.FILL number: ASCII value of character to insert into blank lines.LINEFEED ON/OFF: Transmit LF as well as CR at the end of each line. Normally, only CR is sent.LOCKING-SHIFT ON/OFF: Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.PAUSE number: How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).PROMPT number: ASCII value of character to look for from host before sending next line, normally LF (10).Synonym: SET XMIT.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screeneven though Kermit thinks it is running in the background.Syntax: SET BUFFERS n1 [ n2 ] Change the overall amount of memory allocated for SEND and RECEIVE packetbuffers, respectively. Bigger numbers let you have longer packets and morewindow slots. If n2 is omitted, the same value as n1 is used.Syntax: SET COMMAND parameter value SET COMMAND BYTESIZE { 7, 8 } Informs C-Kermit of the bytesize of the communication path between itself and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow entry and display of 8-bit characters. SET COMMAND HEIGHT Informs C-Kermit of the number of rows in your command screen for the purposes of More?-prompting. SET COMMAND WIDTH Informs C-Kermit of the number of characters across your screen for purposes of screen formatting. SET COMMAND MORE-PROMPTING { ON, OFF } ON (the default) enables More?-prompting when C-Kermit needs to display text that does not fit vertically on your screen. OFF allows the text to scroll by without intervention. If your command window has scroll bars, you might prefer OFF. SET COMMAND RECALL-BUFFER-SIZE number How big you want C-Kermit's command recall buffer to be. By default, it holds 10 commands. You can make it any size you like, subject to memory constraints of the computer. A size of 0 disables command recall. Whenever you give this command, previous command history is lost. SET COMMAND QUOTING { ON, OFF } Whether to treat backslash and question mark as special characters (ON), or as ordinary data characters (OFF) in commands. ON by default. SET COMMAND RETRY { ON, OFF } Whether to reprompt you with the correct but incomplete portion of a syntactically incorrect command. ON by default. Use SHOW COMMAND to display these settings.Syntax: SET CARRIER ON, AUTO, or OFF Attempts to control treatment of carrier on the communication device.ON means that carrier is required at all times except during the DIALcommand. OFF means that carrier is never required. AUTO (the default)means that carrier is required only during CONNECT.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission ofselected file attributes along with each file, and to handle or ignoreselected incoming file attributes, including: DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET INPUT parameter value The SET INPUT command controls the behavior of the INPUT command: SET INPUT BUFFER-LENGTH number-of-bytesRemoves the old INPUT buffer and creates a new one with the given length. SET INPUT CASE { IGNORE, OBSERVE }Tells whether alphabetic case is to be significant in string comparisons.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files. SET INPUT ECHO { ON, OFF }Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUTcommand times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT }Tells whether to proceed or quit from a script program if an INPUT commandfails. PROCEED (default) allows use of IF SUCCESS and IF FAILURE commands.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files.Syntax: SET TAKE parameter value Controls behavior of TAKE command. SET TAKE ECHO { ON, OFF } tells whether commands read from a TAKE fileshould be displayed on the screen. SET TAKE ERROR { ON, OFF } tells whether a TAKE command file should beautomatically terminated when a command fails. This setting is local tothe current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter value SET TERMINAL TYPE ...This command is not available because this version of C-Kermit does notinclude a terminal emulator. Instead, it is a "semitransparent pipe"(or a totally transparent one, if you configure it that way) to the computeror service you have made a connection to. Your console, workstation window,or the terminal emulator or terminal from which you are running C-Kermitprovides the emulation. SET TERMINAL APC { ON, OFF, UNCHECKED }controls execution of Application Program Commands sent by the host whileC-Kermit is in CONNECT mode. ON allows execution of "safe" commands anddisallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, andRUN. OFF prevents execution of APCs. UNCHECKED allows execution of allAPCs. OFF is the default. SET TERMINAL AUTODOWNLOAD { ON, OFF }enables/disables automatic switching into file-transfer mode when a validKermit or ZMODEM packet of the appropriate type is received during CONNECTmode. Default is OFF. SET TERMINAL BYTESIZE 7 or 8, to use 7- or 8-bit terminal charactersbetween C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } to specify how incomingcarriage return characters are to be displayed on your screen. SET TERMINAL DEBUG { ON, OFF } controls terminal session debugging. SET TERMINAL ECHO { LOCAL, REMOTE } specifies which side does the echoingduring terminal connection. SET TERMINAL ESCAPE-CHARACTER { ENABLED, DISABLED } turns on/off the abilityto escape back from CONNECT mode using the SET ESCAPE character.If you disable it, Kermit returns to its prompt only if the connection isclosed by the other end. USE WITH EXTREME CAUTION. SET TERMINAL HEIGHT tells C-Kermit how many rows (lines) are onyour CONNECT-mode screen. SET TERMINAL LOCKING-SHIFT { OFF, ON } tells C-Kermit whether to useShift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bitcharacters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } tells whether to send CRLF when youtype CR during CONNECT mode. SET TERMINAL WIDTH tells C-Kermit how many columns (characters) areon your CONNECT-mode screen. Type SHOW TERMINAL to see current terminal settings.Syntax: SET MACRO parameter value Controls the behavior of macros. SET MACRO ECHO { ON, OFF } tells whether commands executed from a macrodefinition should be displayed on the screen. SET MACRO ERROR { ON, OFF } tells whether a macro should be automaticallyterminated upon a command error. This setting is local to the currentmacro, and inherited by subordinate macros.Syntax: SET PROMPT [ text ] Prompt text for this program, normally 'C-Kermit>'. May contain backslashcodes for special effects. Surround by { } to preserve leading or trailingspaces. If text omitted, prompt reverts to C-Kermit>. Prompt can includevariables like \v(dir) or \v(time) to show current directory or time.Syntax: SET WINDOW-SIZE number Specify number of window slots for sliding windows, the number of packetsthat can be transmitted before pausing for acknowledgement. The defaultis one, the maximum is 32. Increased window size may result in reducedmaximum packet length. Use sliding windows for improved efficiency onconnections with long delays. A full duplex connection is required, as wellas a cooperating Kermit on the other end.Syntax: SET REPEAT { COUNTS { ON, OFF }, PREFIX } SET REPEAT COUNTS turns the repeat-count compression mechanism ON and OFF. The default is ON.SET REPEAT PREFIX sets the repeat-count prefix character to the given code. The default is 126 (tilde).Syntax: SET RECEIVE parameter value Specify parameters for inbound packets: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit receives, normally 35 (number sign). Don't change this unless something is wrong with the other Kermit program.END-OF-PACKET number ASCII value of control character that terminates incoming packets, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet the other Kermit should send.PADDING number Number of prepacket padding characters to ask for (normally 0).PAD-CHARACTER number ASCII value of control character to use for padding (normally 0).PATHNAMES ON or OFF If a recognizable path (directory, device, etc) specification appears in an incoming filename, leave it ON and try to use it, or strip it OFF before trying to create the output file. When ON (the default), then if any of the directories in the path don't exist, C-Kermit tries to create them.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character that marks start of inbound packet.TIMEOUT number Number of seconds the other Kermit should wait for a packet before sending a NAK or retransmitting.Syntax: SET SEND parameter value Specify parameters for outbound packets. This command should be used onlyto override the normal negotiated parameters and is rarely needed: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit sends, normally 35 (number sign).END-OF-PACKET number ASCII value of control character to terminate an outbound packet, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet to send, even if other Kermit asks for longer ones.PADDING number Number of prepacket padding characters to send.PAD-CHARACTER number ASCII value of control character to use for padding.PATHNAMES ON or OFF When FILE NAMES is set to LITERAL, leave the path (device, directory, etc) portion ON or OFF the file name when sending it. Applies to the actual filename, not the "as-name". The default is ON.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character to mark start of outbound packet.TIMEOUT number Number of seconds to wait for a packet before sending NAK or retransmitting. Include the word DYNAMIC after the number in the SET SEND TIMEOUT command to have Kermit compute the timeouts dynamically throughout the transfer based on the packet rate. Include the word FIXED to use the "number" given throughout the transfer. DYNAMIC is the default. After DYNAMIC you may include minimum and maximum values.Synonym: SET XFER Syntax: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] } OFF disables remote-mode packet-mode cancellation from the keyboard.ON enables it. The optional is the control character to use forcancellation; the optional is how many consecutive occurrencesof the given control character are required for cancellation. Syntax: SET TRANSFER CRC-CALCULATION { OFF, ON } Tells whether C-Kermit should accumulate a Cyclic Redundancy Check for eachfile transfer. Normally ON, in which case the CRC value is available in the\v(crc16) variable after the transfer. Adds a little bit of overhead. UseSET TRANSFER CRC OFF to disable. Syntax: SET TRANSFER LOCKING-SHIFT { OFF, ON, FORCED } Tell whether locking-shift protocol should be used during file transferto achieve 8-bit transparency on a 7-bit connection. ON means to requestits use if PARITY is not NONE and to use it if the other Kermit agrees,OFF means not to use it, FORCED means to use it even if the other Kermitdoes not agree. Syntax: SET TRANSFER MODE { AUTOMATIC, MANUAL } Automatic (the default) means C-Kermit should automatically go into binaryfile-transfer mode and use literal filenames if the other Kermit says it hasa compatible file system, e.g. UNIX-to-UNIX, but not UNIX-to-DOS. Syntax: SET TRANSFER PROTOCOL { KERMIT, XMODEM, ... } Synonym for SET PROTOCOL (q.v.). Syntax: SET TRANSFER SLOW-START { OFF, ON } ON (the default) tells C-Kermit, when sending files, to gradually build upthe packet length to the maximum negotiated length. OFF means start sendingthe maximum length right away.Syntax: SET CASE { ON, OFF } Tells whether alphabetic case is significant in string comparisons done by INPUT, IF, and other commands. This setting is local to the current macro or command file, and inherited by subordinates.Syntax: SET INCOMPLETE { DISCARD, KEEP } Discard or Keep incompletely received files, default is KEEP.Syntax: SET COUNT number Example: SET COUNT 5 Set up a loop counter, for use with IF COUNT. Local to current macro or command file, inherited by subordinate macros and command files.Syntax: SET DEBUG { SESSION, ON, OFF } SESSION means display control and 8-bit characters symbolically during CONNECT mode. ON means log debugging information to file debug.log.Syntax: SET DEFAULT directory Change directory. Equivalent to CD command.Syntax: SET DELAY number Number of seconds to wait before sending first packet after SEND command.Syntax: SET SUSPEND { OFF, ON } Disables SUSPEND command, suspend signals, and Z during CONNECT.Syntax: SET SCRIPT ECHO { OFF, ON } Disables/Enables echoing of SCRIPT command operation.Syntax: SET DUPLEX { FULL, HALF } During CONNECT: FULL means remote host echoes, HALF means C-Kermit does its own echoing.Syntax: SET LOCAL-ECHO { OFF, ON } During CONNECT: OFF means remote host echoes, ON means C-Kermit does its own echoing. Synonym for SET DUPLEX { FULL, HALF }.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt or followed by ? to see other options.Syntax: SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character. Syntax: SET LINE devicename or: SET PORT devicename Select communication device to use. Normally %s. If you SET LINE to other than %s, then Kermit will be in 'local' mode; SET LINE alone will reset Kermit to remote mode. To use the modem to dial out, first SET MODEM TYPE (e.g., to HAYES), then SET LINE xxx, next issue the DIAL command, and finally CONNECT. Syntax: SET PARITY name Parity to use during terminal connection and file transfer: EVEN, ODD, MARK, SPACE, or NONE. Normally NONE.Syntax: SET QUIET {ON, OFF} Normally OFF. ON disables most information messages during interactive operation.Syntax: SET RETRY number How many times to retransmit a particular packet before giving up.Syntax: SET SESSION-LOG { BINARY, TEXT } If BINARY, record all CONNECT characters in session log. If TEXT, strip out carriage returns.Syntax: SET SPEED number Communication line speed for external tty line specified in most recent SET LINE command, in bits per second. Type SET SPEED ? for a list of possible speeds.Syntax: SET WILDCARD-EXPANSION { KERMIT, SHELL } KERMIT (the default) means C-Kermit expands filename wildcards in SEND and MSEND commands and incoming GET commands. SHELL means your shell does it.Syntax: SET ALARM [ ] Number of seconds from now after which IF ALARM will succeed. 0 means no alarm.Syntax: SET PREFIXING { ALL, CAUTIOUS, MINIMAL, NONE } Selects the degree of control-character prefixing. Also see HELP SET CONTROL.Syntax: SET TEMP-DIRECTORY [ ] Overrides automatic assignment of \v(tmpdir) variable.Syntax: SET TITLE Sets window title to text instead of using current host/port name.Not available - "%s" Syntax: REMOTE SET parameter valueExample: REMOTE SET FILE TYPE BINARY Ask the remote Kermit server to set the named parameter to the given value.Equivalent to typing the corresponding SET command directly to the otherKermit if it were in interactive mode.Syntax: REMOTE COPY source destination Ask the remote Kermit server to copy the source file to destination.Syntax: REMOTE CD [ name ] Ask remote Kermit server to change its working directory or device. If the device or directory name is omitted, restore the default.Syntax: REMOTE DELETE filespec Ask the remote Kermit server to delete the named file(s).Syntax: REMOTE DIRECTORY [ filespec ] Ask the remote Kermit server to provide a directory listing of the named file(s) or if no file specification is given, of all files in the current directory.Syntax: REMOTE HELP Ask the remote Kermit server to list the services it provides.Syntax: REMOTE HOST command Send a command to the remote host computer in its own command language through the remote Kermit server.Syntax: REMOTE KERMIT command Send a command to the remote Kermit server in its own command language.Syntax: REMOTE LOGIN user password [ account ] Log in to a remote Kermit server that requires you login.Syntax: REMOTE LOGOUT Log out from a remote Kermit server to which you have previously logged in.Syntax: REMOTE PRINT filespec [ options ] Send the specified file(s) to the remote Kermit and ask it to have the file printed on the remote system's printer, using any specified options.Syntax: REMOTE RENAME filespec newname Ask the remote Kermit server to rename the file.Syntax: REMOTE SPACE [ name ] Ask the remote Kermit server to tell you about its disk space on the current disk or directory, or in the one that you name.Syntax: REMOTE TYPE file Ask the remote Kermit server to type the named file(s) on your screen.Syntax: REMOTE WHO [ name ] Ask the remote Kermit server to list who's logged in, or to give information about the named user.Syntax: REMOTE QUERY { KERMIT, SYSTEM, USER } variable-name Ask the remote Kermit server to send the value of the named variable of the given type, and make it available in the \v(query) variable.Syntax: REMOTE ASSIGN variable-name [ value ] Assign the given value to the named global variable on the server.not working yet - %s AAAAAAAAAAAAAAAA AAAAA#A'A*A2A4A 8Ax=AAAGAKAPATAhYA_AdAgA<kApAsAxA}AA A AAAAAAAAA A A AAA AA AA A A%A)A/A6A;AIAOA]AbAfAjAmAzAAAA AAAA AAAAAA&A2A5A8AIA WA \A`AmApAsA@AA@AAAAAAA)AAA A AA+AA $A,A42A?9A@BA IA-NATA[A1aA hA.qAxA}AQAA=AAZAXUA5A+A/A/AA3AAA4AAAB BB)B#B-B4B<BBBGB.MBUB]BeBnB2wB {B BB BBBBB,BB0B-B*B B*BBP6p6667777FFFG<]_g____\`bb,b\gbbh\g]\^`@_X^cc<]dpdggggggggggggdd eset parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1set win 4, set rec pack 2200, set prefix minimalset win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all_assign _for\v(cmdlevel) { _getargs,define \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)successtimeoutinterruptedinternal errori/o errorcmdini: no memory for keymapcmdini: no memory for macrotabcmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for kermrccmdini: no memory for linecmdini: no memory for tmpbufcmdini: no memory for apcbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_xif_while_switx\&_[10]\&_[%d]\&@[%d]\&@[%d]/ini file isropen okinit filegetncm dest lengthnext cmdgetncm eom%s getncm returns ptr todomac entry maclvldomac loop maclvl 1domac loop maclvl 2domac loop exit maclvlgetnctgetnct malloc failuregetnct fgets EOFgetnct fgets ok%3d. %sgetnct terminatorgetnct bad lineWarning: Last line of %s lacks terminator command filedirectory filegetnct igetnct lp2getnct comment trimmedgetnct command too long?Line too long, maximum length: %d. getnct first chargetnct last chargetnct bcgetnct continuedgetnct returnparser tmpdir restoring&parser entry maclvl&parser entry inlevel&parser entry tlevel&parser entry cmdlvl&parser entry mtlevelCommand file terminated by error. Command error: macro terminated. DeleteStartupFileparser macroparser maclvlcmdbuf from macro?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersparser top of while loopCommandtop-level cmkey2top-level cmkey token ?Invalid - %s Command file: %s, line %d docmd returnscmdbufatmbuf?Invalid: %s top-level cmkey failedKermit command error in background execution%sCommand file: %s, line %d parser preparing to continueparser breaks out of while loopxxout obsizexxout pacingxxout stringfreelocal levelVariable name(s)\fcontents(%s)\fdefinition(%s)?Failure to allocate storage for local variables?Failure to allocate storage for local variablesdooutput sdooutputOUTPUT NULOUTPUT BREAKOUTPUT Long BREAKOUTPUT CMDQdooutputOUTPUT error herald%s, for%s Copyright (C) 1985, 1996, Trustees of Columbia University in the City of New York. TEXTBINARYDefault file-transfer mode is %s Type ? or HELP for help. addmmac lineaddmmac linesaddmmac loop exitaddmmac length?addmmac malloc error: %s addmmac malloc erroraddmmac constructed stringaddmmac length mismatch !addmmac internal error! addmac namaddmac def(null pointer)addmac def?addmac malloc error 2 addmac paddmac p(null pointer)addmac numeric global maclvladdmac macro arg maclvladdmac globaladdmac macro error 7: %s addmac macro defaddmac table sizeaddmac table overflowaddmac position?addmac malloc error 3: %s ?addmac malloc error 5: %s delmac namdelmac defdelmac def(null pointer)delman defdelmac def(null pointer)delmac mlookpopclvl cmdlvlpopclvl tlevelpopclvl maclvlpopclvl mac 1popclvl mac 2popclvl mac 3popclvl mac 4popclvl mac 6popclvl mac 7popclvl mac 8?Debugging log wasn't open Debug Log Closed?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open Transaction Log Closed ?Unexpected log designator - %d disabledlocal onlyremote onlyenabledonoff Versions: %s Numeric: %ld-%d C-Kermit %s %s for%s %s %s for%s %s %s %s %s %s %s %s %s Major optional features included: External XYZMODEM protocol support REDIRECT command RESEND command Fullscreen file transfer display Control-character unprefixing Major optional features not included: No network support No hardware flow control No character-set translation None Compiler options: DEBUGTLOGXFRCANCK_SPEEDCK_APCCK_AUTODLCK_MKDIRWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXDIRENTCK_TMPDIRCK_TTYFDHDBUUCPCK_POLLNOSETBUFNOKVERBSI386IXATTSVSVR3i386SVR3JCCK_CURSESCK_WREFRESHCK_PCT_BARCK_TTGWSIZDCMDBUFCK_RECALLCK_TIMERS \{%d} Key code \%d => String: \{27}[\{%d} String: \{27}[%c String: \{27}\{%d} String: \{27}%c String: Character: \%u%c \%u (self, no translation) Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminal bitsTERM %19s: %-13s Type(unknown) %19s: %-13s %13s: %-15s EcholocalremoteLocking-shift %19s: %-13s %13s: %-15s Newline-modeCr-displaycrlfnormalonoffunchecked %19s: %-13s %13s: %-15s APCAutodownloadonoff %19s: %-13d %13s: %-15d HeightWidth %19s: %-13s %13s: %-15s DebugSession log(none) CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL %19s: %-13s Suspend Press key: ?Error reading key Macro name, or carriage return to see them all%s - not found Macros: %d Function Status: GET %s RETRIEVE %s SEND %s MAIL %s PRINT %s REMOTE ASSIGN %s REMOTE CD/CWD %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE QUERY %s REMOTE RENAME %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s Server timeout: %d Server display: %s Server login: (none) "%s", "%s", "%s" Server get-path: (none) %d. %s %s SUCCESSFAILURE The following functions are available: \F() \v(%s) = \{%d} \{%d} %s %s Global variables: \%%%c No variables defined Macro arguments at level %d \%%%d = %s No macro arguments at top level Declared arrays: \&%c[%d] No arrays declared Cancellation: %s %d %d Send / Receive Pause: %d (msec) Type SHOW DIAL to see DIAL-related items Command Quoting: %s Take Echo: %s Take Error: %s Macro Echo: %s Macro Error: %s Input Case: %s ObserveIgnore Input Buffer-length: %d Input Echo: %s Input Silence: %d (seconds) Input Timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Output Pacing: %d (milliseconds) Script Echo: %s Command buffer: %d Atom buffer: %d File type: %s binarytext See SHOW CHARACTER-SETS for character-set info Terminal echo: %s localremote Transmit EOF: none ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: none Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: none Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d milliseconds Escape character: Ctrl-%c (ASCII %d, %s): %s DEL, speed: unknown75/1200%ldoffonautounknown, carrier: %s, timeout: %d sec, timeout: none Type SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Character set translation is not supported in this version of C-Kermit Exit warning %s onalwaysoff Exit on-disconnect: %s Current exit status: %d Printer: %s%s | (default) Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s onoff Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Suspend: %s Alarm at %s %s (no alarm set) send-list is empty (none)%s, mode: %s, alias: %s Nothing to show... Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: %s %s = (null definition)Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s invalid digit '%c' in number Invalid character '%c' in input +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript must be numeric - %s ?Array dimension or subscript must be positive or zero - %s ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)%dxwords macrododo maclvldodo maclvl too deepMacros nested too deeply do macrododo cmdlvl too deep?TAKE files and DO commands nested too deeply do macro%0\flit(litcmdlitcmd2litcmd3litcmd4litcmd5litcmd6litcmd7litcmd8litcmd9Name of local directory, or carriage return?Wildcards not allowed in directory name %s %s %swBwBwB wBwBwBwB"wB'wB-wB /wB1wB 3wB9wBDwBJwBRwB\wBfwBlwBrwBxwBwBwBwB wB wBwBwBwBwBwBwBwB d&&'('8'H'''p'|'''''&''&d''''??; ><S%S$TRR(RR8U\W\W\W8U8U%SSZS$T[\\%S@RhR%S\cdctsdsrri!read!writeappendreadwrite<=>alarmbackgroundcountdefineddirectoryemulationequalerrorexistfailurefalseforegroundlltlgtnewernotoknumericremote-onlystarted-from-dialersuccesstrueVariable name?Variable name required ?Read file not open ?Oops, no READ buffer! read zsinlread addmacPrompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).{ Yes or no? }Please respond Yes or No getc addmacPlease respond.ASK cmtxt ask addmacVariable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required dodef successdodefDefinition of variablexxdef var namexxdef var def?Argument vector array is read-only Definition of array elementxxdef array refxxdef array defDefinition of macroxxdef macro namexxdef macro defcalling addmac?%s failed ASSIGNDEFINE1996101719961011dncvtError - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sError - No international dialing prefix defined %s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK rOpening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. Type HELP DIAL for further information. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippedPlease SET HOST first, and then SET MODEM Sorry, you must SET MODEM first Sorry, you must SET LINE or SET HOST first /dev/nullSorry, you must SET SPEED first timeout (seconds)0Number to dial or entry from dial directoryNumber to dial?Lookup what? %s ?No DIAL command given yet?You must specify a number to dialdodial Lookup: "%s" - not found%s - dialing as given dodial Lookup: fatal error - dialing skipped Lookup: skipped Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number Will redial in %d second%s- press any key to redial immediately. s Ctrl-C to cancel... Directory/file specificationDIR fs_copyCK_DIR%s %sDIRFile(s) to delete?A file specification is required xxdel tmpbuf%s %sxxdel line%s - %sdeleted not ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _switx SWITCH SWITCH 2series of cases?Unbalanced brackets SWITCH 3_switx_switx_switx?SWITCH macro definition gone! SWITCH commandVariable name?Variable name required _forx initial valuedofor fx%dfinal valuedofor fy%dincrement1dofor fz%dCommand to execute?Unbalanced brackets _forx_forx_forx?FOR macro definition gone! FOR command?Incomplete FOR command Before requesting technical support from Columbia U., please consult: . The book "Using C-Kermit". . The CKCKER.UPD and CKCKER.BWR files. . The CKUKER.BWR and CKUINS.DOC files. . Your own organization's support staff, if any. . The comp.protocols.kermit.* newsgroups if you have Netnews access. . Our FAQ, http://www.columbia.edu/kermit/faq.html, if you have Web access. If you still need help or have a bug to report after consulting these sources, send e-mail to: kermit-support@columbia.edu Or contact us by post: Kermit, Columbia University, 612 W 115 Street, New York NY 10025, USA Or by fax at +1 (212) 663-8202. Telephone support is available too: +1 (900) 555-5595, USA only, $2.50 per minute +1 (212) 854-5126, from anywhere, $25.00 per call, MC/Visa Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. tod2sectod2sec t2seconds to wait, or time of day hh:mm:ss1seconds to pause, or time of day hh:mm:ss1milliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. File to rename?Name of existing file required ?Please specify a single file New name?New name for file required dorename linedorename p?Can't rename %s to %s ?Can't return from level %d RETURN parseRETURN maclvl 1_xif_for_whiRETURN poppingRETURN maclvl 2RETURN maclvl 3RETURN copymode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled ?Read file already open System command to read from?Command name required ?Can't allocate read buffer ?Write to pipe disabled ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedCommand file ends prematurely in multiline GET OofaRemote filename missing in multiline GET MupeenMacro definition ends prematurely in multiline GET OofaRemote filename missing in multiline GET Mupeen Remote file specification: Name of remote file(s) cmtxt(cancelled) Local name to store it under: Local file name(cancelled) xxget cmargxxget fspecRECEIVE arg disk or dir?Can't get current directory ?Can't access %s _getargs maclvl_putargs maclvlsuccess_getarg p(null pointer)_getarg p_putarg m_arg[maclvl+2][i]_putarg m_arg[maclvl+2][i](null pointer)_get/putarg exit_get/putarg exit maclvl_get/putarg exit argc maclvlgoto cxgoto cmdlvlgoto maclvlgoto tlevelgoto before conversiongoto after conversion?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro goto in macromacro GOTO labelmacro target label:defaultgoto failed at cmdlvl?Label '%s' not found goto found macro label:defaultgoto failed at cmdlvl?Label '%s' not found ?Stack problem in GOTO %s ]()chkvar?Condition required ?No keywords match - "%s" if trueif trueif successif failureMacro or variable nameif definedif countFileDirectory name?File or directory name required if exist 1if directory 1if directory 2first word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long IF EQ string 1, xIF EQ string 2, yIF EQ strcmpIF EQ xxstrcmpfirst number or variable name?Quantity required xxifgt cmfldxxifgt exp1countversionargcsecond number or variable name?Quantity required xxifgt exp2countversionargcxxifft ifcxxifft n1xxifft n2xxifft zvariable name or constant?Quantity required xxifnu cmfldxxifnu quantityxxifnu chknumFirst fileSecond file?Failure to get file date xxifnewer d1xxifnewer d2xxifnewer\v(ndate)IF ALARM date\v(ntime)IF ALARM timeIF ALARMIF conditiondoif: pushing command command to be ignoredObject commandelse_xif_xif_xif?XIF macro gone! { \flit(if not goto _..bot) } WHILE cmdObject commandWHILE body_while_while_while?WHILE macro definition gone! WHILE dodo?Can't allocate storage for WHILE commandrFailure to open?TAKE files and/or DO commands nested too deeply BBBBBBBGBKBSBGžBʞBОB՞BٞBޞBBBBB BBB%B/B6B=B GBMB[B`B cBhB kBuB}BBBB BBB BşBӟBBBB BBBBB BBB%B4B8BCBHBLBOBUB\BjBrBBBBBBGBàBɠB٠B B"BBB B BB#B%&B$ -B1B6B BB KBRBVBYBcB hBvB{BBBBBBBBáB̡Bkl0njookooPmooiohnoxnjo0pqspps(qssssqss0rsrssssssDsrsssrsssq0~,thHԈxȏdLDȔ̕̕̕̕p̕h̕̕ ̕t4xؖDTasciibinarytextasciibinarytextglobalkermitsystemuserdynamicfixedechoeoffilllinefeedlocking-shiftpausepromptappendbackupdiscardno-supersedeoverwriterenameupdatecollisionnamesrecord-lengthtypecrcrlflfconvertedliteralapcautodownloadbytesizecr-displaydebugechoescape-characterheightlocking-shiftnewline-modetypewidthcrlfnormaloffonuncheckedfixedundefinedthermometerno-thermometercrtfullscreennoneoffonquietserialpacket-lengthtimeoutcontrol-prefixend-of-packetpacket-lengthpad-characterpaddingpathnamespausequotestart-of-packettimeoutattributesblock-checkfileincompletereceiveretryservertransferwindowalldatedispositionencodinglengthoffonsystem-idtypebuffer-lengthcasedefault-timeoutechosilencetimeout-actionproceedquitignoreobservedisabledenabledonsetnum ?Value required %s?Not a number: %s ?Sorry, %d is the maximum Control character, numeric ASCII value, or in ^X notation, or preceded by a backslash and entered literally ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d file transfer display stylethermometerTERMSET tgetentSorry, terminal type unknown: "%s" Remote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 crlflocal text-file line terminatorhow to handle filenamesconverted%d301%dfile record length%d312type of file transfertext%d300Filename collision actionbackup%d302Name of local directory, or carriage returndownload dir?Wildcards not allowed in directory name download zfnqfp?unexpected file parameter bytesize for terminal connection8 ?The choices are 7 and 8 Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. which side echos during CONNECTremoteenablednormalapplication program command executionnumber of columns on your screen80number of rows on your screen24Parameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character 13Sorry, the legal values are 0-31 Maximum number of characters in a packet90Sorry, 10 is the minimum %d401 Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start character1How many padding characters for inbound packets00%dPacket timeout interval%d402Packet timeout interval?Out of range - %d dynamicMinimum timeout to allow1?Out of range - %d Maximum timeout to allow0onMilliseconds to pause between packets0Characters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill character0Numeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmission0 Press the X or E key to cancel. > filename, | command, or type carriage return to confirm the command?Not confirmed ?%s missing FilenameCommand?Access denied - %s remcfm remfileremcfm remappdremcfm rempiperemcfm remdest?%s missing FilenameCommand?Access denied - %s remtxt remfileremtxt remappdremtxt rempiperemtxt remdestremtxt command?Parameter name required Remote directory nameXZCWD: passwordName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specification?Not available - %s Command for remote systemCommand for remote Kermit?Remote Kermit command required User IDInternal error: malloc PasswordInternal error: malloc Account or carriage returnInternal error: malloc ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage returnRemote variable nameQRemote variable nameAssignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to rename?Name of remote file required New name of remote file?Name of remote file required ?Not implemented - %s ?File specification required rfilopFile Attribute packetsSorry, command not available 132101421014110135101331013910134101451014710?Not available Positive numberSeconds of inactivity before INPUT fails%dNumber of bytes in INPUT buffer?Network connections not supported Communication device name?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Sorry, access to lock denied: %s Sorry, access to device denied: %s Sorry, device is in use: %s Sorry, can't open connection: %s set line ; C-Kermit SAVE KEYMAP file: ; Clear previous keyboard mappings set key clearset key \%d \{%d}%cset key \%d \{%d}; EndName of INI filekeymap.ini?Sorry, %s is a directory name DispositionnewNot implemented - %s lBpBtBxB|BBBBBBBBBBBBBBBBBBŸBɸB͸BѸBԸBظBܸB߸BBBH4P4hܰзPȼ(X8\ɺtt(lDɺɺ$@Phd|h Ldl<|NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1/XONDC2DC3/XOFFDC4NAKSYNETBCANEMSUBESCFSGSRSUSevenoddmarkspacenoneinvalidModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s OnOff Clear To Send (CTS): %s OnOff Ring Indicator (RI): %s OnOff Data Terminal Ready (DTR): %s OnOff Request To Send (RTS): %s OnOffspar: data spsiz timint npad padch seol ctlq ebq ebqflg bctr rptq rptflg lscapu atcapu lpcapu swcapu wslotn whatrurpar: data rpsiz rtimo mypadn mypadc eol ctlq sq ebq ebqflg bctr rptq rptflg capas bits lscapu atcapu lpcapu swcapu wslotr rpsiz(extended)fatalFatal:setgen: can't allocate memorysetgenfnparse malloc errorfnparsefnparse rCK_NOPUSHHOSTmore? Y or space-bar for yes, N for no ^C trap() caught signal^C trap() curses^C...^C... stptrap() caught signal suspend disabled %sJob control not supported stptrap back from suspendstptrap W_CONNECTstptrap W_COMMAND pflag%sstptrap default?T-Log string too long%s %ld %s %ld?String too long[%s]?String too long[%s] %ld?String too long%s: %ld?String too long%s %s?String too long%s %s: %ld?Invalid format for tlog() - %ldconchkconincStatus report: file type: labeledimagebinary undefinedbinarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length packet length window slotsCanceling batch, wait... Canceling batch... Canceling file, wait... Canceling file... Resending packet... X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Ctrl-C to cancel file transfer: Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: labeledimagebinary undefinedbinarytext File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld [OK] [discarded] [interrupted] [skipped]Error: Message: Refused: [incomplete]*** screen() called with bad status ***%s: %ld*** screen() called with bad object ***ermsgProtocol Error:Transaction Log Closedon_exitdoexit exitstatdoexit whatC-Kermit EXIT status(NULL)(NULL)(string too long)(string too long)%s%s:%c %s%s:^%c %s%s:~^%c %s%s:~%c %s%s:%ld =%ld [%s] [%s]=%ld %s=%ld %s[%s] %s[%s]=%ld ?Invalid format for debug() - %d fxdinit fdisplaTERMfxdinit tgetentfxdinit TERM null - no tgetentWarning: terminal type unknown: "%s" Fullscreen file transfer display disabled. %-3ld%c%c%ld%s(unknown)LABELEDIMAGEBINARY UNDEFINEDBINARY / partial / resend / resendTEXT%s%02ld:%02ld:%02ldscreenc cinitscreenc cendwscreen calling initscrscreen initscr okscreenc calling clearscreenc clear okscreenc setup okscreenc doing first movescreenc myhost%s, %s%sCurrent Directory: %sNetwork Host: %sCommunication Device: %sNetwork Type: Communication Speed: (network)75/1200%ld%sunknownParity: %sRTT/Timeout:File Type:File Size:%s:Percent DoneBytes so far ...10...20...30...40...50...60...70...80...90..100Estimated Time Left:Transfer Rate, CPS:Window Slots:%s N/APacket Type:Packet Count:Packet Length:Error Count:Last Error:Last Message:X to cancel file, Z to cancel group, to resend last packet,E to send Error packet, ^C to quit immediately, ^L to refresh screen.^C to cancel file transfer.SCREENC switchRESENDING:SENDING:RECEIVING:File Name:%.55s..%s => %s => %.51s.. => %s%ldPercent Done:%sNetwork Host: %s (%s)Communication Device: %s (remote host is %s)%02ld / %02d%d%d%d of %d%s%d%c%s%ld%d%sDamaged PacketTimeout %d sec%d%ldTransfer OKFile discardedTransfer interruptedFile skipped%sRefused, %s%sRefusedIncomplete%s*** screen() called with bad status ***%ldFiles: %ld, Bytes: %ld, %ld CPS%s Elapsed Time: %s%s%s%s*** screen() called with bad function code ***\\\\\\\\\hp\\P\\\\\\\, \\\\\\\\\\\L\`\48\p%s "%s" - %s%s cmdlincmdlin cfilefxargvinvalid command-line option, type "kermit -h" for helpaction-l or -j or -X required-l or -j or -X required-a without -s, -r, or -g-a without -s, -r, or -gcan't change to '-a' directorycan't change to '-a' directorywrite access to -a file deniedwrite access to -a file deniedunredirected -k can only be used in local modeunredirected -k can only be used in local modedoarg entrydoarg argNo commands given for -CNo commands given for -Cinvalid argument bundlinginvalid argument bundlingmissing delay valuemissing delay valuebad delay valuebad delay valueconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -sinvalid argument bundling after -s-No files for -sNo files for -s-s: too many -'s-s: too many -'sinvalid mixture of filenames and '-' in -sinvalid mixture of filenames and '-' in -sdoarg s nfilsdoarg s zsending from terminal not allowedsending from terminal not alloweddoarg s stdinfconflicting actionsconflicting actionsinvalid argument bundling after -ginvalid argument bundling after -gmissing filename for -gmissing filename for -ginvalid argument bundling after -ainvalid argument bundling after -amissing name in -amissing name in -ainvalid argument bundling after -yinvalid argument bundling after -ymissing filename in -ymissing filename in -yinvalid argument bundling after -l or -jinvalid argument bundling after -l or -jcommunication line device name missingcommunication line device name missing/dev/ttycan't open devicecan't open devicecmdlin speedinvalid argument bundlinginvalid argument bundlingmissing bpsmissing bpsunsupported transmission rateunsupported transmission rateinvalid argument bundling after -minvalid argument bundling after -mmodem type missingmodem type missingunknown modem typeunknown modem typeinvalid argument bundling after -einvalid argument bundling after -emissing lengthmissing lengthUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing or bad window sizemissing or bad window sizeUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing paritymissing parityinvalid parityinvalid parityinvalid argument bundlinginvalid argument bundlingmissing usernamemissing usernameinvalid command-line option, type "kermit -h" for helphBB  BB*B.B`BB?B|BqB_BsB7B5B6B7BkBtBQBBB&BB\BBB*B BBBGBG B;*B1B8B(=BGB OB2RB TBO]B bBkB<pB@wB0{BhB B B B BHBHBiBB B B BgBVB/BB+BBB-BB9BB[B~BB}BBoBBBBvBd$B )Bv/Bm5Bl:B]ABPFBPIBPOB]VBYB^^B{eBgBDlBsByBrB0BBfBBBB3BBBwBEBBSBSBSB`BnB8BBB&BeBCBBC BBwBBB!B)(B-B4B8B =BCB!FB!JB!PBVB"aB1fBNnBuB$zB4BsB%B&BzB?B>BIB'BABABABABaBaBBJB%BNBXBXBYBBTBUB!#;:<@BBB#B*BK0B";B3=B3@B3KBPB\B2dB.rB7wB6{B6BB6BB'BBBB4BBTB0BBBEBB B B  B B B B*$B&B+B@6BNdoesc Hanging up Connected %s %stothrough, speed %ldTerminal bytesize: %d, Command bytesize: %d, Parity: noneevenoddspacemarkTerminal echo: %slocalremoteLogging to: Error resuming CONNECT session ERROR WRITING SESSION LOG, LOG CLOSED!\,C |,C,C,C,C,C,C,C,C,C,C,C,C),C,C,C(,C -C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C@-CE-C#J-CL-CR-CV-CW-CX-CL+_-Cg-Ch-Ci-Cj-Ck-Cl-Cm-Cn-Cv-C~-C-C` -C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C-C.C.C.C.C.C.C.C(.C).C*.C+.C,.C-.C..C/.C3.C4.C5.C6.C7.C8.C9.C:.C;.C<.C=.C>.C?.CZ.C[.C(\.C _.Cd.Ch.Ci.Cj.CL+q.Cv.Cw.Cx.Cy.Cz.C{.C|.C}.C~.C.C.C.C.C.C#.C.C.C.C.C.CL+.C.C.C.C.C.C.C.C.C.C.C.C.C /C/C#/C/C0/C4/C5/C6/CL+=/CE/CL/CS/CZ/Ck/Cr/C{/C/C/C/C/C}/C/C/C#/C/C/C/C/C/CL+/C/C/C/C/C0C 0C0C0C#0C+0C,0C}-0Ck0Cp0C#u0Cw0C0C0C0C0CL+0C0C0C0C0C0C0C0C0C0C0C0C}0C"1C'1C#,1C.1CI1CM1CN1CO1CL+V1C^1Ce1Co1Cv1C}1C1C1C1C1C1C1C}1C1C1C#1C1C1C1C1C1CL+1C1C1C1C2C2C2C2C 2C(2C02C72C}>2CW2C\2C#a2Cc2C~2C2C2C2CL+2C2C2C2C2C2C2C2C2C2C2C2C}2C 3C3C#3C3C%3C)3C*3C+3CL+23C:3CA3CH3CO3CV3C]3Cd3Ck3Cs3C{3C|3C}}3C3C3C#3C3C3C3C3C3CL+3C3C3C4C4C 4C'4C54CC4CK4CS4CZ4C}a4C4C4C#4C4C4C4C4C4CL+4C4C4C4C4C4C4C4C4C4C4C4C}5C5C5C#5C!5CG5CK5CL5CM5CL+T5C\5Cc5Cj5Cq5C5C5C5C5C5C5C5C}5C5C5C#5C5C5C5C6C6CL+ 6C6C6C,6C36C@6CG6CN6CU6C]6Ce6Cf6C}g6C6C6C#6C6C6C6C6C6CL+6C6C6C6C7C 7C7C7C$7C,7C47C<7C}D7C]7Cb7C#g7Ci7C7C7C7C7CL+7C7C7C7C7C7C7C7C7C7C7C7C}7C8C8C#8C 8C58C98C:8C;8CL+B8CJ8CQ8C[8Cb8Ci8Cp8Cz8C8C8C8C8C}8C8C8C<8C8C8C8C8C8C8C8C8C8C8C8C8C8C8C8C8C8CK8C 9C9C#9C9C)9C-9C.9C/9CL+69C>9CK9CX9Ce9Co9Cv9C}9C9C9C9C9C}9C9C9C<9C9Cd9C9C9C9CPL+9C:C:C%:C3:CA:CJ:CY:Ch:Cp:Cx:Cy:CKz:C:C:C<:C:Cd:C:C:C:CPL+:C:C:C ;C;C";C,;C6;C@;CH;CP;CQ;CR;CZ;C[;C\;C];C^;C_;C`;Cd;Ce;Cf;Cg;Ch;Ci;Cj;Ck;Cl;Cm;Cn;Co;Cp;C;C;C#;C;C;C;C;C;CL+;C;C;C;C;C;CC>C>C>CL+>C%>C,>C->C4>C;>CB>CL>CV>C^>Cf>Cg>C=h>C>C>C#>C>C>C>C>C>CL+>C>C>C>C>C?C?C?C?C?C&?C'?C=(?C@?CE?C#J?CL?Co?Cs?Ct?Cu?CL+|?C?C?C?C?C?C?C?C?C?C?C?C}?C@C@C@C@C"@C#@C$@C-@C.@C/@C0@C1@C2@C3@C4@C5@C6@C7@C8@C9@CI@CJ@CK@CM@CP@CQ@CR@CU@CV@CW@CX@CY@CZ@C[@C\@C]@C^@C_@C`@Ca@Cp@Cq@Cr@Ct@Cv@Cw@Cx@C|@C}@C~@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C @C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C@C2@C@C,@CACACAC AC AC AC ACACACACACACACACACAC*AC+AC#,AC/AC22AC4AC7AC9ACL=AC@ACAACBACCACDACEACFACGACHACIACJACRACSACTACVAC,ZAC\AC_ACpACtACuACvACwACxACyACzAC{AC|AC}AC~ACACACACAC#ACACACACACACACACACACACACACACACACAC` ACACAC#ACACdBCBCBC BC BCBCBCBC+BC7BC>BCEBCHBCIBCJBCKBCbBCgBC#lBCnBCyBC}BC~BCBCL+BCBCBCBCBCBCBCBCBCBCBCBC=`CpCCC C Cp!C!C`"CC"CP#CC#C@$C8CXC$CCHCCPCC@CC0CCCxCCChCC CC8CCC8CC(CCCC0%C CBCBCBCBCBCCCCCCC&CC.CC3CC@CC0ICCRCCZCCbCCkCCsCCCCCCCCCC.CC CC CC CC CC CC CC CCCC CCDCDCDC+DC7DC=DCJDC(RDCUDCYDC^DCdDCkDCsDC|DC DCDC/DCDC!DC-DCDCDC DCDC DC*DC+ EC,EC#EC-EC"3EC&8EC';EC'?EC'GEC.PEC XEC)eECiEC rEC~ECECECECEC#EC$EC%ECPhUUVV f8f,emlggLhhimj\jmklmjl|,\ P::L܊\ċ4T8Xލ xȎ\ЏTƐܐ X|ؑ$P|-v -v<hDial Command, 6.0.091, 6 Sep 96UnknownTrailBlazerTrailBlazer-PlusT1000T1500T1600T2000T2500T3000QblazerWorldBlazerCCITT / ITU-T V.25bis autodialer,:VALCRN%s Hayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 Unknown%s AT&T ISN Network DIAL%s AT&T switched-network modems,+at%s AT&T Digital Terminal Data Module%s Digitel DT-22 CCITT dialer,:HUP VALCRN%s HUP Hayes Smartmodem 1200 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 Hayes Ultra/Optima/Accura 96/144/288ATP ATT ,ATQ0X4N1Y0S37=0S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 Hayes AccuraATP ATT ,ATQ0X4N1Y0S37=0S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 Practical Peripherals V.22bis or higher with V.42 and V.42bisATP ATT ,ATQ0X4N1Y0S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0S36=0S48=128 ATS46=2 ATS46=0 ATS0=1 ATS0=0 AT&T / Paradyne DataPort V.32 or higherATP ATT ,ATQ0E1X6&S0&C1&D2&Q0S78=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N7 AT\N0 AT%C1 AT%C0 ATS0=1 ATS0=0 Microcom DeskPorte FAST 28.8ATP ATT ,ATQ0X4F0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\H0\Q0 AT\N3 AT AT%C3 AT%C0 ATS0=1 ATS0=0 AT-J0 AT-J1 Zoom Telephonics V.32bisATP ATT ,ATQ0E1N1W1X4S82=128S95=47 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=138 ATS46=136 ATS0=1 ATS0=0 ZyXEL U-Series V.32bis or higherATP ATT ,ATQ0E1&N0X5&Y1 OK ATD%s ATQ0H0 AT&H3 AT&H4 AT&H0 AT&K3 AT&K0 AT&K4 AT&K3 ATS0=1 ATS0=0 Zoltrix V.32bis and V.34 modems with Rockwell ACI chipsetATP ATT ,ATQ0E1F0W1X4Y0\K5S82=128S95=41 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT\N3 AT\N1 ATS46=138%C3 ATS46=136%C0 ATS0=1 ATS0=0 AT\N0 AT&Q0 Motorola FasTalk II or LifestyleATP ATT ,ATQ0E1X4\K5\V1 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\Q0 AT\N6 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 AT\J0 AT\J1 BOCA 14.4 FaxmodemATP ATT ,ATQ0E1F1N1W1\K5S37=11S82=128S95=47X4 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT\N3S36=7S48=7 AT\N1 ATS46=138 ATS46=136 ATS0=1 ATS0=0 Intel High-Speed FaxmodemATP ATT ,ATQ0E1Y0X4\K1\V2S25=50 OK ATB1+FCLASS=0 OK ATD%s ATQ0H0 AT\G1\Q3 AT\G1\Q1\X0 AT\G0 AT\J0\N3"H3 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 Multitech MT1432 Series MultiModem IIATP ATT ,ATQ0E1X4&E8&Q0%E1#P0 OK ATD%s ATQ0H0 AT&E4&E7&E8&E11&E13 AT&E5&E6&E8&E11&E13 AT&E3&E7&E8&E10&E12 AT&E1 AT#L0&E0 AT&E15 AT&E14 ATS0=1 ATS0=0 AT$BA0 AT$BA1 SupraFAXModem 144 or 288ATP ATT ,ATQ0E1N1W0X4Y0\K5S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5\N3S48=7 AT&Q0\N1 AT%C1S46=138 AT%C0S46=136 ATS0=1 ATS0=0 MaxTech XM288EA or GVC FAXModemATP ATT ,ATQ0E1X4Y0&L0&M0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N6 AT\N0 AT\N6%C1 AT\N6%C0 ATS0=1 ATS0=0 IBM/Siemens/Rolm CBX Data Communications Module MODIFY?CALL %s US Robotics Courier or SportsterATP ATT ,ATQ0X4&A3&N0&Y3 OK ATD%s ATQ0H0 AT&H1&R2&I0 AT&H2&R1&I2 AT&H0&R1&I0 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 Telebit TrailBlazer, T1000, T1500, T2000, T2500ATP ATT ,AAAAATQ0X1S12=50S50=0S54=3 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3S69=0 ATS58=0S68=0 ATS66=1S95=2 ATS95=0 ATS110=1S96=1 ATS110=0S96=0 ATS0=1 ATS0=0 Telebit T1600, T3000, QBlazer, WorldBlazer, etc.ATP ATT ,AAAAATQ0X2S12=50S50=0S61=1S63=0 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3 ATS58=0S68=0 ATS180=3 ATS180=0 ATS190=1 ATS190=0 ATS0=1 ATS0=0 (dummy)%s Generic Rockwell V.32 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5\N0 AT&Q0\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 Generic Rockwell V.32bis modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 Generic Rockwell V.34 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 IBM Mwave AdapterATP ATT ,ATQ0X4Y0&M0&Q0&N1&S0\K3\T0%E2S28=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q0 AT\N7 AT\N0 AT%C1"H3 AT%C0"H0 ATS0=1 ATS0=0 Gateway 2000 Telepath II 28.8ATP ATT ,ATQ0X4&N0&Y1#CLS=0S13=0S15=0S19=0 OK ATD%s ATQ0H0 AT&H1&R2 AT&H2&I2S22=17S23=19 AT&H0&I0&R1 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 Cardinal MVP288X SeriesATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 Cermetek Info-Mate 212 ABbPpTt XYR D '%s' Digital DF03-AC=%sDigital DF-100=%s#Digital DF-200=W d %s GeneralDataComm 212A/ED% $D :T%s Penril modem >k :%s Racal Vadic VA4492EKk *D ?%s Ven-Tel% $K Number to call: %s Concord Condor CDS 220 2400b, CDS >Microcom MNP modems in SX command modeDP DT ,!@SE0;S1P4;SBRK5 !D%s SF13 SF11 SF10 BAOFF;SMAUT BAON;SMDIR COMP1 COMP0 AAMicroLink 14.4 or 28.8ATP ATT ,ATQ0X4\K5 OK ATD%s ATQ0H AT\Q3 AT\Q1\X0 AT\Q0 AT\N3 AT\N0 AT%C3 AT%C0 ATS0=1 ATS0=0 \J0att-dataportatt-dtdmattdtdmatt-isnattisnatt-switched-netattmodematt-7300att7300bocaccitt-v25biscardinalcermetekconcordcourierdataportdf03-acdf100-seriesdf200-seriesdigitel-dt22directgateway-telepathgdc-212a/edgendatacommhhahayhayehayeshayes-1200hayes-2400hayes-high-speedhayes-accurahayes-optimahayes-ultrahst-courierintelitu-t-v25bismaxtechmimicmicrmicromicrocmicrocomicrocommicrocom-at-modemicrocom-sx-modemicrolinkmotorola-fastalkmultitechmwavenoneold-telebitpenrilppiracalvadicrockwell-v32rockwell-v32bisrockwell-v34rolm-dcmsportstersupratapiteteltelebittelepathunknownuser-definedusrusr-212ausr-courierusr-sportsterusroboticsv25bisventelzoltrixzoomzyxeldialtime caught SIGALRMdialint caught SIGINTddinc entry n%s dial waitfor gotdidweget indreset resetting alarm and signal handlersdreset alarm and signal handlers reset WARNING - speed change to %ld failed. Speed changed to %ld. K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_TF_AREACODE111011800888358199610119990000K_AREACODEK_PBX_XCHK_PBX_ICPK_PBX_OCPckudial dialfail%s Failure: DIALANSWERdial display is on%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. dialtimeoutInterrupted. dialinterrupteddialfail()lbuf "" Call not completed. Call did not come in. dialError initializing modem. dialmodem initunknown dialunknownckdial dialhup failedSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... INSERT CALL TO WINDOWS TELEPHONY API HERE No response from modem, retrying%s... againckdial wake_str mdmstatATS7=%d%cckdial S7 mdmstatckdial default, wake stringckdial no wake_strckdial default, waiting for wake_promptckdial no wake_promptckdial got wake promptWARNING - I don't know how to turn on EC for this modem ckudia xx_okckudia calling xx_ok for ECckudia xx_okWARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - I don't know how to turn on DC for this modem WARNING - Trouble enabling compression WARNING - I don't know how to enable modem's HWFC. WARNING - Trouble %sabling modem's local flow control disenAPM1;KMC%d APM0 ATS111=0 ATS111=%d S112=%d WARNING - I don't know how to enable autoanswer for this modem. ckdial ANSWER waitctATS2=%d WARNING - Problem setting modem's escape character DIAL command + phone number too long! dialing Dialing: %s... ckdial waitct dial awaiting response, mymdmtypckdial modem responseVALWARNING - no carrier CNXINVINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callBusyNot connectedNot ConnectedNo dial toneNo Dial ToneNo answerNo AnswerAnsweredConnectedANSWEREDBUSYDISCONNECTNO ANSWERWRONG ADDRESSANSWEREDBUSYCHECK OPTIONSDISCONNECTEDDENIEDAU 1 dial df03 gotANERAttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:)ON LINENO CONNECTOKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDABANDONDEDNOT AVAILABLELACKS PERMISSIONNOT A DATALINEINVALID DATA LINE NUMBERINVALID GROUP NAMEBUSYDOES NOT ANSWERONLINE!Online!BUSYBusyDEAD PHONEINITIATINGBUSYCALL FAILEDNO CONNECTBUSYNO DIALTONECOMMAND ERRORIN USECONNECTPROGRAM ERROR - No response handler for modem type %d ckdial alarm offdial partialdial succeeded %sall complete: %s. Partial cC %sall complete. Partial cClongjmp returns to dial routineSorry, DIAL memory buffer can't be allocated Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. dial number%sDIAL lbuf malloc ok%sDIAL rbuf malloc ok%sDIAL fbuf malloc okSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... RetT Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) WARNING - interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). ckdialckdial timeoutVALgetok rbuf init okgetok ddincgetok:OK ERROR at atMDMECHO-t AT ATMDMECHO-Tgetok returnslongjmp returned to getok()getok timeoutgetok entry nGETOK rbuf malloc okabout to alrm_execute dook()returning from alrm_execute dook()RESPONSE mdmechoSPONGERESPONSE-ARESPONSE-Cdial hayesnv lbufdial hayesnv gotdial hayesnv numericdial hayesnv suffix Local phone is ringing! No Carrier. Modem Command Error. Dial Locked. No Dialtone. Busy. Dial Locked. No Answer. Ringing... Answered by voice. CONNECT 1200/75 - Not supported by C-Kermit Ringing... Dialing... No Prompttone. RELIABLE LAPM COMPRESSED CONNECT Can't change speed to %ld Speed changed to %ld CONNECT FAST/KERMFAST/KERM RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXDELAYEDBLACKLISTEDDIAL LOCKEDRINGERRORCARRIERDATAdialhup mdmhup Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped mdmhup hup_strmdmhup escbufmdmhup esc_timemdmhup pause 1 OKmdmhup net ttslow okmdmhup pause 1 OKmdmhup ttslow okmdmhup calling response functionmdmhup hangup responsemdmhup no ok_fn^CScript Command, 6.0.028, 8 Feb 96recvseqexpecting sequencegot it (null sequence)received sequence: returning with got-it codesending sequence EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. SCRIPT string: Sorry, Can't condition communication line Script successful. Script successful.Sorry, script failed Script failed`CNetwork support, 6.0.078, 6 Sep 1996`CSVR32Kn,X` %K @@aCtCC@CC#$" !+,&unknownTERMTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/.LINESCOLUMNS !"#$       n ijk    l+,opmq/.r0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab&5   %)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}y+#-( !"#$%&'(,$- eCeC#eCReCkeCeCeCeC/usr/lib/terminfo is unaccessibleI don't know anything about your "%s" terminalcorrupted terminfo entryterminfo entry too longTERMINFO pathname for device exceeds 512 charactersmalloc returned NULLterminfo file for "%s" terminal is not readableSorry, . lClClClClClClClClClClClClClClClClClClClClClClClClClClClCmCmCmC mC mCmCmCmCmCmCmC!mC$mC'mC*mC-mC0mC3mC6mC9mCnCAnCDnCGnCJnCMnCPnCSnCVnCYnC\nC_nCbnCenChnCknCnnCqnCtnCwnCznC}nCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCnCoCoCoC oC oCoCoCoCoCoCoC"oC%oC(oC+oC.oC1oC4oC7oC:oC=oC@oCCoCFoCIoCLoCOoCRoCUoCXoC[oC^oCaoCdoCgoCjoCmoCpoCsoCvoCyoC|oCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCoCpCpCpC pC pCpCpCpCpCpCpC!pC$pC'pC*pC-pC0pC3pC6pC9pCqCAqCDqCGqCJqCMqCPqCSqCVqCYqC\qC_qCbqCeqChqCkqCnqCqqCtqCwqCzqC}qCqCqCqCqCqCqCqCqCqCqCbwamxbxsxneognhckmhsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGcoitlilmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@7@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%d%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZylllllllllll4TtT\9T9)  9989TTTTTTTTTTTTT99999999999999 9999999T999999999T9999x9T99T999T99Pp9.v-^h#i#0#4   liorkp/dev/ttyDay Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/bin/pwd/dev/null/etc/utmp/etc/passwdrr: /bin/shsh-c@Unknown error~C~C~C~C~CCC4CFCXChC{CCCCCCCC CC*C9CJC^CrCCCCǀCԀCCCCC-CHC[CwCCCCƁCCC C1CKCTC]CfC~CCCCςC܂CCCCC-C?CMCeCCCCCЃCރCC CCC.C7C@CSC\CCCCфCCCCXCvCCCÆCCCC*CLCjCCCЇCCCC?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~CHRCLASSasciiCPOSIX/lib/chrclass/zstrdtHl$@zstimeHp$Bzmailq$,Dzprintr$Fshxpandr$H|thJfgenu$@Ltraversev$\N,x$Pmatchx$Rwhoamiyb$TzbVzsyscmd{$Xzshcmdt|$\Ziswild}$\isdirx~$^zmkdir$t`zfseek$HbzfnqfpԀhd.textM38.dataH'@.bss$C.commentiflen'@pid'@fcount'@nambuf'@zmbuf)@work*@cwdbuf.@datbuf3@scratch(4@oldmtchs,8@lscmd08@sspace48@ssplen88@freeptr<8@resptr@8@remlenD8@numfndH8@.filegckcfns.cencstr܁$putsrv$$puttrmȂ$Hputfil$Tzdstuffd$decode|$lslook$Hgetpkt`$tinit($4pktinit\$rinitx$resetc $fnlist$sinit$sipkt$xsinitx$8rcvfil$reofp$reotx$ sfile$ sdata$szeof$seof0$@sxeofp$Lseot$Lrparlspar$ gnfile|$8sndhlp$Xnxttype $0sndtype<$nxtdir$snddir$\nxtdelT$snddelh$cwd@$syscmd$remset$adjpkl$whoarewe$.text܁L(.dataG@ .bss$C.comment8Tfncnam8I@memptrXI@funcptr\I@cmdstr`I@drain`J@firstdJ@thJ@ebqsentlJ@lsstatepJ@lsquotetJ@xdbufxJ@funcbufJ@funcnxtL@funclenL@nxpndL@ndirsL@nfilesL@nbytesL@.file*gckcfn2.crttinit$tgetrtt`$pinput$dopar,parchk$chktimo$Lspack$Pchk1,$$chk2P.Dchk3.hnxtpkt$ack$ackns$ackn$ack1$, nack$ resend$ errpktH$xscmd$<srinit$pkstartl$@zstart$xchkspkt$$rpack$( logpkt $tstats$@fstats$P!.texth4V.data([@4 .bss$C.commentTp_tbl0[@.filelgckcfn3.cinibufsT$.makebuf$0mksbuf$2mkrbuf`$4window$l6getsbuft$p8getrbuf$<:freesbuf $<freerbuf $>freerpkt$ $d@chkwin $Bdumpsbufh $Ddumprbuf$$tFsattr$HbpJrsattr$lLgattr$ Ninitattrt $Padebup!$Ropena #$Tcanned'$Vopeni'$Xopeno$)$lZopent*$8\clsif*$^clsofl+$`.textT*.data\j@h 2.bss$C.commentTrefusedj@reasonj@nreasonk@isopenk@.filevgckuxla.c.text-.datav@.bss$C.comment4T.filegckcpro.cwart-$Azproton$4|xxprotoo$(~sgetinit.textH.data`C.bss$C.comment@.fileRgprintw.cprintw`$(J.text`(.data`C.bss$C.comment\.file^greset_sh.c,$@V.text@.data`C.bss$C.comment @.filergsetupterm.c_Getsh$Lb=$ dG \fSx$@hc$0j.text .data`C.bss$C.comment`.filegtermcap.ctgetent$$vr b`xtgetflagl$Lztgetnum$L|tgetstrb|~.text.dataaCP.bss$C.comment,@aCaCbC.filegtermerr.ctermerr L.textL .datadC(.bss$C.commentl @.filegtinputfd.ctinputfd $.text$.datafC.bss$C.comment!@.filegtnames.c.text.datafC .bss$C.comment" .filegtparm.ctparmbx hbd.text G.dataqCl.bss$C.comment #@.filegtputs.c_tpadb<tputs$P.text .data vC.bss$C.commentL$\ocp vC.filegtstp.c_tstpX$X$<.textX.datavC.bss$C.comment%x.filegttimeout.cttimeout$x L .textd.datavC.bss$C.comment '.filegtypeahead.cP$P.textPP.datavC.bss$C.comment(.filegvidupdate.c h$,4 `.text?.datavC.bss$C.commentH*D.filegvwprintw.cvwprintw$P.textP.datavC.bss$C.comment+`.filegwclrtobot.c$.text.datavC.bss$C.comment,D.file&gwclrtoeol.c$d.textd.datavC.bss$C.comment0.D.file2gwmove.cwmove $`*.text `.datavC.bss$C.commentt/@.fileXgwrefresh.cwrefreshl$6_shoven8,  :_useidch$<_prefix $>T $@# $B_rmargin $<D_getceod $F_useceod$H- `J.textl$U .datavC .bss$C.comment0@cyvCcxvCscrlivCscrcovCmarks vCB$vC.filefgwsyncup.cwsyncupH \N 4^.textH.data0vC.bss$C.comment1@.filergwtouchln.cwtouchlnP$j.textP.data0vC.bss$C.comment43@.file~g_waddstr.cwaddstrP$v.textP.data0vC.bss$C.commentt4$.filegcbreak.ccbreakh$p.texthp.data0vC.bss$C.comment5@.filegchkinput.cY$.text.data0vC.bss$C.comment6@.filegcurserr.ccurserrl L.textlL .data0vC.bss$C.comment8@.filegdelay.c_delay$.text.datavC .bss$C.commentX9@tmspc10vC.filegdelscreen.ccP .textP .datavC.bss$C.comment:D.filegdelterm.cdelterm$.text .datavC.bss$C.comment;@.filegdelwin.cdelwin$.text .datavC.bss$C.comment=@.filegdoupdate.cdoupdatep$.textp.datavC.bss$C.comment\>@.fileginit_acs.cinit_acs$.text .datavC .bss$C.comment?@offsetsvC.fileginit_costs.cm y$ _cost_fn$4.text8>.datawC,.bss$C.comment@DoffsetswCcounter0wC.file gmakenew.c_makenewhD .textD.data4wC.bss$C.comment B@.file gmemSset.cmemSset  ( .text (.data4wC.bss$C.comment`C.file" gtcsearch.c< $ .text< .data4wC.bss$C.comment D .file. gwaddnstr.cwaddnstr $& .text  .data4wC.bss$C.comment,D@.file: gwnoutref.c|"$2 .text|".data4wC.bss$C.commentlE@.fileF gwsyncdown.c<& > .text<&.data4wC.bss$C.commentFD.fileR gdelkeymap.cT' xJ .textT'x.data4wC.bss$C.commentGD.file^ gwaddch.cw32addch'$V .text'.data4wC.bss$C.comment4I@.filej gwscrl.cwscrl*$b .text*.data4wC.bss$C.commenttJ@.filev gwinsdelln.c8+$`n .text8+`.data4wC.bss$C.commentKD.file gabort.cabort.$Pz .text.P.data4wC.bss$C.commentLT.file gatol.c.text.data.bss.commentT.file gchdir.s.text.data.bss.comment.file gctermid.cctermid.b( .text.(.data8wC.bss$C.commentM<res8wCdevDwC.file gctime.cctime/b asctime(/b ct_numb0b@ .text/8 .dataPwCt.bss$C.commentMTcbufPwC.file gchmod.s.text.data.bss.comment.file gdup.s.textH0.datawC.bss$C.commenthN.file gdup2.cdup2\0$ .text\0.datawC.bss$C.commentN.file gfread.c.text.data.bss.comment.file ggetcwd.cgetcwd0b .text0 .datawC.bss$C.commentO.file ggetegid.s.text2.datawC.bss$C.commentP .file ggeteuid.s.text2.datawC.bss$C.commentP .file ggetgid.s.text2.datawC.bss$C.comment Q.file gfseek.c.text.data.bss.commentT.file gatoi.c.text.data.bss.commentT.file) ggetlogin.cgetlogin 3b! .text 3 .datawC.bss$C.commentQT.file3 gfputs.c.textX .dataX.bssX.commentXp.file= ggetppid.s.text3.datawC.bss$C.commentR .fileI ggetpwnam.cgetpwnam3h4A .text34.datawC.bss$C.commentR8.fileU ggetpwuid.cgetpwuid3h(M .text3(.datawC.bss$C.commentR8.filen ggetpwent.csetpwent 4 8Y endpwentD4 $[ pwskiph4bH] getpwent4h<_ 4hha .text 4H/.datawC@.bss$C.comment$SPASSWDwCEMPTYxCpwfxClinexCpasswd |C.filex gfgets.c.text.data.bss.commentp.file ggetuid.s.textT6.data4|C.bss$C.comment T.file gcalloc.c.textl.datal.bssl.commentl8.file glink.s.textd6.data4|C.bss$C.commenttT.file gmkdir.s.text|6.data4|C.bss$C.commentT.file gcreat.s.text.data.bss.comment.file gpause.s.text6.data4|C.bss$C.commentT.file gperror.cperror6 p .text6p .data4|C.bss$C.commentT.file gpoll.s.text7.data<|C.bss$C.commentU.file gpopen.cpopen(7h pclose8$ .text(7t,.data<|C.bss$C.commentUP<|Copen_max@|CD|CshellL|CshflgP|C.file gfdopen.cfdopen9h .text9.dataT|C.bss$C.commentWp.file gpipe.s.text@: .dataT|C.bss$C.commentW.file gprintf.c.texth.datah.bssh.commenthp.file gfprintf.c.text\.data\.bss\.comment\t.file gmemccpy.c.text8.data8.bss8.comment8 .file grew.crewind`: D .text`:D.dataT|C.bss$C.commentX8.file' grmdir.s.text:.dataT|C.bss$C.commentX.file7 gscanf.cscanf:$+ fscanf:$- sscanf:$</ .text:p.dataT|C.bss$C.commentXT.fileK gdoscan.c_doscan(;$; number>$= stringC$? setupDlA .text(;4 k.dataT|C .bss$C.commentLYchcountT|Cflag_eofX|C.fileV gatof.c.text.data .bss.commentp_ptod.file` gfilbuf.c.text.data.bss.commentT.filen gptod.c_ptodT',d .text,.data,D.bssp.commentp_litpow_bigpow.filey ginfini_def.c.text.data .bss .comment  .file ginfini_def.o.text\E.data`|C.bss$C.comment[.initH .file ginfinity.c.text\E.data`|C.bss$C.comment\ .file gisxpg_def.c.text.data.bss.comment .file gisxpg_def.o.text\E.datah|C.bss$C.commentH\.initT .file gisxpg.c.text\E.datah|C.bss$C.comment`\.file gsetbuf.c.text.data.bss.commentT.file gsetgid.s.text\E.datal|C.bss$C.comment\.file gsetjmp.s.texttE@.datal|C.bss$C.comment\.file gsetuid.s.textE.datal|C.bss$C.comment].file gsetvbuf.csetvbufE$ .textE.datal|C.bss$C.comment$]<.file gsleep.cF  sleepF. .textF .datal|C.bss$C.comment`].file galarm.s.textG.datal|C.bss$C.comment^.file gsprintf.c.text@.data@.bss@.comment@.file gstrerror.cstrerrorGb4 .textG4.datal|C.bss$C.comment^<.file gerrlst.c.textG.data||C .bss$C.comment^ .file& gldexp.c.text .data<.bss0.comment0.file2 gstrtol.cstrtolG$* .textG .dataC.bss$C.comment_8.fileA gsystem.csystemI$6 .textI .dataC.bss$C.comment_XCshell$Cshflg(C.fileK gexecl.s.textXJ.data,C.bss$C.commentD`.fileU gexecv.s.textlJ.data,C.bss$C.comment``.file_ gexecve.s.textJ.data,C.bss$C.comment|`.filei gexit.s.textJ .data,C.bss$C.comment`.files gfork.s.textJ.data,C.bss$C.comment`.file} gstrncat.c.text@.data@.bss@.comment@<.file gtime.s.text.data.bss.comment.file gtime_comm.cJ$ HKh gmtimeMh tzsetO  .textJt.data,C.bss$C.comment(atz_style@CDCAlt_endLC#TC.`C9C.file gstrncpy.c.text8.data8.bss8.comment8<.file gtimes.s.text4Y.dataC.bss$C.commentb.file gfopen.c_endopen<hh.text .data.bss.comment.file gfindiop.c.text0.data0.bss0.comment0T.file gaccess.s.text.data.bss.comment.file gtolower.ctolowerHY$$ .textHY$.dataC.bss$C.commentDc<.file gtoupper.ctoupperlY$$ .textlY$.dataC.bss$C.commentc<.file gfcntl.s.text.data.bss.comment.file gttyslot.cttyslotY$ .textY .dataC .bss$C.commentcT.file gstrncmp.c.textH.dataH.bssH.commentH<.file gstrrchr.c.text,.data,.bss,.comment, .file) gttyname.cstatpZ$ lstatZ$ fstatZ$ ttynameZb .textpZ\.dataC(.bss$C.commentdrbufCdev C.file5 gclosedir.cclosedir[$,- .text[,.data(C.bss$C.commentlet.fileA gopendir.copendir[h9 .text[.data(C.bss$C.commente.fileK gfstat.s.text.data.bss.comment.fileY gmalloc.c.text9.data.bss.commentpallocpalloctallocxallocend.filee greaddir.creaddir\ht] .text\t.data(C.bss$C.commenthg.fileo ggetdents.s.text].data(C.bss$C.commenth .filey gsbrk.s.textD.dataD.bssD.commentD.file gseekdir.cseekdir,] ,} .text,],.data(C.bss$C.commentPht.file glseek.s.text.data.bss.comment.file gulimit.s.textX].data(C.bss$C.commenth.file guname.s.textl]0.data(C.bss$C.commenth.file gungetc.c.text\.data\.bss\.comment\T.file gunlink.s.text.data.bss.comment.file gutime.s.text.data.bss.comment.file gvsprintf.cvsprintf]$@ .text]@.data(C.bss$C.commentit.file gdoprnt.cE$@_dowrite@$.text.dataZ.bss.comment_blanks_zeroesuc_digslc_digslc_nanuc_nanlc_inf$uc_inf(.file gctype_def.c.text.data.bss.comment .file gctype_def.o.text].data(C.bss$C.comment4k.init` .file gctype.cO]$ [\^$ h,_$.text]`.data(C0.bss$C.commentLk.initlt,C.filegecvt.ccvt@b.text( .data(.bssD.commentDbuf,_dtop_ltostr.file)gdtop.c_dtopXh$x.textx .datax.bss|.comment|_bigpow_litpow.file5gbiglitpow.s.text.data.bss.comment _bigpowF_litpowF.file?gfrexp.c.text.data4.bss.commentP.fileIgfpreal.s.text.data.bss.comment.fileSgfwrite.c.text .data.bss.comment.file]gflsbuf.c.text%.data.bss.comment.fileggclose.s.text.data.bss.comment.filesggetenv.cnvmatch@bH.text.data.bss.comment8.file}gisatty.c.text8.data8.bss8.comment8T.filegi386_data.s.text.data.bss.comment .filegioctl.s.text.data.bss.comment.filegltostr.c_ltostr pb4.text4.data4.bss4.comment4.filegmemchr.c.text4.data4.bss4.comment4.filegmemcpy.s.text$.data$.bss$.comment$.filegmemset.c.text$.data$.bss$.comment$.filegopen.s.text.data.bss.comment.filegread.s.text.data.bss.comment.filegstdio_def.c.text.data.bss.comment<.filegstdio_def.o.text<_.dataXC.bss$C.comment8q.initl< .filegdata.c.text<_.dataXC.bss$C.commentPq8.filegstrcat.c.text,.data,.bss,.comment,.filegstrchr.c.text,.data,.bss,.comment,.file gstrcmp.s.text`.data`.bss`.comment`.filegstrcpy.s.text4.data4.bss4.comment4.file!gstrlen.s.text.data.bss.comment.file+gwait.s.text<_ .dataC.bss$C.commentr.file7gwaitpid.cwaitpid\_$/.text\_.dataC.bss$C.comment0r<.fileAgsysisc.s.textt_.dataC.bss$C.commentlr.fileKgwrite.s.text.data.bss.comment.fileVgsignal.s.text\.data\.bss\.comment\O.file`gkill.s.text.data.bss.comment.filejggetpid.s.text.data.bss.comment.filetgcerror.s.text .data .bss .comment .file~ggen_def.c.text.data .bss .comment  .fileggen_def.o.text_.dataC.bss$C.comment4s.init .filegmall_def.c.text.data.bss.comment .filegmall_def.o.text_.dataC.bss$C.commentls.init .filegfree_def.c.text.data.bss.comment .filegfree_def.o.text_.dataC.bss$C.comments.init.filegcuexit.s.text_$.dataC.bss$C.comments.filegfakexhand.s.text_.dataC.bss$C.comments .filegmall_data.s.text_.dataC.bss$C.comments .fileg__compat_stat.statcvt_ l`$4P`$4`$4`$Ha$HHa$H.text_.dataC .bss$C.commentt\.fileg__old_fstat.s.texta.data$C.bss$C.commenttt$.fileg__old_lstat.s.texta.data$C.bss$C.commentt$.file g__old_stat.s.texta.data$C.bss$C.commentt .filegfxstat.s.texta.data$C.bss$C.commentt.fileglxstat.s.texta.data$C.bss$C.commentt.file0gxstat.s.textb.data$C.bss$C.commentu.text b.data$C.bss$C.init_startenviron @$@(@_mcount3exit_ck_ver,@versio0@xvernum4@vernum8@verwho<@@@hlptxtt@srvtxtx@ptab|@spsiz@spmax@spsizr@spsizf@rpsiz @urpsiz@maxrps@maxsps@maxtry@wslots @wslotr$@wslotn(@timeouts,@spackets0@rpackets4@retrans8@crunched<@wmax@@wcurD@srvdisH@srvtimL@timintP@pkttimT@rtimoX@timef\@rttflg`@mintimed@maxtimeh@npadl@mypadnp@bctrt@bctux@bctl|@ebq@ebqflg@rqf@rq@sq@rpt@rptq@rptflg@rptena@xfrcan@xfrchr@xfrnum@epktflg@capas@lpcapb@lpcapr@lpcapu@swcapb@swcapr@swcapu@atcapb@atcapr@atcapu@rscapb@rscapr@rscapu@lscapb@lscapr@lscapu@atenci@atenco@atdati@atdato@atdisi@atdiso@atleni @atleno@atblki@atblko@attypi@attypo @atsidi$@atsido(@atsysi,@atsyso0@padch4@mypadc8@seol<@eol@@ctlqD@myctlqH@myrptqL@rptminP@whoareuT@sysindexd@myindexh@cksysidl@uidbufp@iattr$Cfeol@fblksiz@frecl@frecfm@forg@fcctrl@lf_opts@pktnum@sndtyp@rcvtyp@rsnCrlnCsizeCosizeCmaxsizeCspktl@rpktl@pktpaus@rprintfĒCrmailfȒCsrvcmd@pktmsg@padbuf̒Crecpkt,Crdatap0Cdata@srvptr4Cmystch@stchr@filehead@filetail@filenext@addlist@filnam8Ccmdfil8Ccfilef@ngetpath @getpath8Cx_user@x_passwd@x_acct@x_login@x_logged @nfils$@fsizexC(@clfils,@stayflg0@ttname|Cspeed4@parity8@autopar<@sosi@@flowD@autoflowH@turnL@turnchP@duplexT@escapeX@delay\@tnlm`@mdmtypd@myhost̛Cnetworkh@nettypel@p@tt_rowst@tt_colsx@|@&@tlevel@remonly@protocol@2@carrier@cdtimo@xitsta@fncact@fncsav@bgset@suspend@filcnt0Cfilrej4Cflci8CflcoCJCVCd Cn$CSP(Cx,Cacs32map0Cacs_map4C`C8C_endwin`Ccur_termaCcur_strs aC(aCcallocPb\XC`CDef_termaC\Cttytype|CCtCCaC@Ccur_numsaC C$aCmemset"b$memcpyUPCBCCPCCospeedC'fCnumcodesfCstrcodesgC1dCB0vC_cleanup $S@`{_cerror ,@_bufsync$H + C [ lseekr   _wrtchk($_xflsbuf-$ memccpyb8    memchrb4 cfreeU , @9 @D ^ v   ulimitX]_findioph0 C $@_doprnt$   ungetc$\ @atof<'( > V _findbuf$l (@{  ,@ D@ldexp'     3 `|C__is_xpgh|C> @K @X @e } times4Ysigsetrsigpausehsigrelsem sys_nerr~Cfrexp' execvlJexecveJ  altzone0Cdaylight4Ctzname8Cstrchrb, freopenh  # < S k strrchrb,  fstat reallocJb @sbrkObrkK  getdents]0@*BZfwrite$ecvtnb fcvt}b q8@ "_sibufC_sobuf$C_smbuf,C_lastbufC9Qisysisct_sigholdY^4@endD_allocsC_aaa'b2a>afxstatalxstataxstatbetext bedata$CJ__setosinfoostype_failedostype_okayisabsoluteinitprotodocmdlinefailcmdlinedotakeinifailtakeinidocmdfilefailcmdfilesetprefixnxxsysidssyscleanupttsetflowmyfillbufsplitpathaddresulttilde_expandgetreasoncmdclrscncmdchardellinebeginprotofielddoshodialhexdigitsfreelocalshostrdefshokeycodecmdinitedck_errstrck_sndmsgapclengthapcbuflenparent_idgetdialenvfail_codefunc_codedial_whatnonverbalMULTITECHMICROLINKrseqtracecc_executealrm_executecc_alrm_executeforce_doupdateinitscr32_homefirstnewscreenbaud_convertreset_shell_modesetupterm_blast_keysreset_prog_modedef_shell_mode_stripdelaysbooloffsetsnumoffsetsstroffsets_branchto_ccleanup_setblock_settimeouttypeaheadvidupdate_change_video_change_colorwclrtobotwclrtoeol_updateln_setmark1_setmark2_turn_off_backgroundcolor_markswcursyncup_chkinputdelscreen_init_costs_countchar_tcsearchwnoutrefreshwsyncdowndelkeymapwinsdellnfgetpwentpopen_pidbin_shell___infinity___is_xpgcatch_alarmbin_shellexpand_rulelocaltimeAlt_startmonth_sizemonth_wdaynotnamechar_lowdigitsetchrclass_verifyclass_ctype_initfirst_call_sigreturn_cvt_old_stat_cvt_old_lstat_cvt_old_fstat__compat_stat__compat_lstat__compat_fstat__os_version__prognamecopyrightwildxpandisinterruptedtt_escapeexitoncloseprefixingbye_activesendstartprintfileprintpipesysidlistzinbufferzoutbufferrejectionrttsamplesrttvariancerttstddevcm_recallon_recallin_recallcmd_quotingDeleteStartupFilentollfreedialcapasdialmprmtdialdcoffdialecoffdialpulsedialaaoffalrm_datealrm_timeapcactiveapcstatusinbufsizeinsilencelocalheadlocaltaillocalnextm_cautiousreadblocktapilinetabntapilinethermometersys_errlistfilesinlistactivecmdtelephonyis_rockwellis_hayeshispdtn_duplextn_binaryCOLOR_PAIRScurs_errno_quick_ptr_do_slk_ref_do_slk_tch_do_slk_noref_rip_init_slk_init_y16updatecurses_versioncurs_parm_errterm_errnooutchcountbit_attributesterm_parm_err_frst_tblstr_first_term_frst_boolscur_bools_frst_nums_frst_strs_called_beforeboolcodesterm_err_stringscurs_err_strings_libc__ctype/shlib/libc_s[ctype_def.o]/shlib/libc_s[atol.o]/shlib/libc_s[]/shlib/libc_s[cerror.o]/shlib/libc_s[chdir.o]/shlib/libc_s[chmod.o]_libc__bufendtab/shlib/libc_s[flsbuf.o]/shlib/libc_s[stdio_def.o]/shlib/libc_s[memcpy.o]/shlib/libc_s[filbuf.o]/shlib/libc_s[fread.o]/shlib/libc_s[lseek.o]/shlib/libc_s[fseek.o]/shlib/libc_s[atoi.o]/shlib/libc_s[memccpy.o]/shlib/libc_s[write.o]/shlib/libc_s[strlen.o]/shlib/libc_s[fputs.o]/shlib/libc_s[fgets.o]_libc_malloc_libc_free/shlib/libc_s[free_def.o]/shlib/libc_s[memset.o]/shlib/libc_s[mall_def.o]/shlib/libc_s[calloc.o]/shlib/libc_s[creat.o]_bufendtab_libc__iob/shlib/libc_s[doprnt.o]/shlib/libc_s[printf.o]/shlib/libc_s[fprintf.o]__fltused/shlib/libc_s[ptod.o]/shlib/libc_s[fpreal.o]/shlib/libc_s[atof.o]_libc__lastbuf/shlib/libc_s[read.o]_libc__is_xpg_libc__infinity/shlib/libc_s[ldexp.o]/shlib/libc_s[biglitpow.o]/shlib/libc_s[infini_def.o]/shlib/libc_s[isxpg_def.o]/shlib/libc_s[i386_data.o]__infinity_libc__sibuf_libc__sobuf_libc__smbuf/shlib/libc_s[isatty.o]/shlib/libc_s[setbuf.o]/shlib/libc_s[sprintf.o]/shlib/libc_s[frexp.o]/shlib/libc_s[strncat.o]/shlib/libc_s[time.o]/shlib/libc_s[strncpy.o]/shlib/libc_s[open.o]/shlib/libc_s[findiop.o]/shlib/libc_s[fopen.o]/shlib/libc_s[access.o]/shlib/libc_s[fcntl.o]/shlib/libc_s[strncmp.o]/shlib/libc_s[strrchr.o]/shlib/libc_s[fstat.o]_libc__allocs/shlib/libc_s[sbrk.o]/shlib/libc_s[malloc.o]_libc_end/shlib/libc_s[gen_def.o]/shlib/libc_s[ungetc.o]/shlib/libc_s[unlink.o]/shlib/libc_s[utime.o]/shlib/libc_s[ecvt.o]/shlib/libc_s[memchr.o]/shlib/libc_s[fwrite.o]/shlib/libc_s[ltostr.o]/shlib/libc_s[dtop.o]/shlib/libc_s[close.o]_libc_environ/shlib/libc_s[getenv.o]/shlib/libc_s[ioctl.o]/shlib/libc_s[strcat.o]/shlib/libc_s[strchr.o]/shlib/libc_s[strcmp.o]/shlib/libc_s[strcpy.o]sigignore/shlib/libc_s[signal.o]/shlib/libc_s[kill.o]/shlib/libc_s[getpid.o]_libc__cleanup_exithandle__old_stat__old_lstat__old_fstat__new_stat__new_lstat__new_fstat