7JH rt1L.pad.text .pad<.data@.bssr.pad`.loader B92i2HO,A  hH%A| |A!7c;0e@aL\0!`N eH` ,cdW:3^@@zH"EO|,T:|3A|cdW:@ zKcch0!`}AN Agetsysid|a!7;8`@X0!`N cHT ,c33@4}H!}O,Ac|c3@ }K8`h0!`}aN Agetsysix|!7;c,A8 0A|8`;|+c3 @}U>0c|HuO0(/(~08`A@;cHuOcX0!P}N DL0!PN @0!PN A isabsolute|!H,A8`0!@N H)AH0!@}N A@is_a_tty|!H\8  $(88T:|0.b<00(8`HtOH0!@}N Ainitflow|}&!p6daTh 6}@aU`a.`U :} H h`,/ /A @:`,,.- A @:@,,/-A @:,x샢A @9,0,0?$'HVOHkO0t08`HkIO,8`A0H}OTd?A H O8`,@008`HjO0!}N A$ dotakeini|!bc,0@HO0HO8`8HgEOXL}0!PN A` failtakeini|!b8,A0`HO,A\88 HHO,A<8`H%OT`?~A H O8`,A KԃHOH8`H~OT`?~8`AH UO8`K Adoicp|!HH/Ob8800(8`HiOH0!@}N AHfailicp|!0,c8`8HhOc0}8HOc HO|,;A48`H}OTd?~A H AO8`,@؁X}0!PN A docmdfile|!bc,0<@HuO0xHiO8`8HdOXL}0!PN A` failcmdfile|}&!`bc P-Td 6-| .bT:|(00c8`Hg)O,Ab8AAAH̀b8X88` @8|i0e8!B|0eBb<<@xc,0d|c8| |.|#.@H&"&"H4b<c$8.b<X8( `0|9@CB8!0e| |CB|#.|h@|.0i|cA|.|iH|.**A$~,@x&"&"H~,&"&"@H 2044<:8 <:8XT|0!P} N Cp setprefix|ܐ!BL; PBTXZb\[!8`|"+`|0c @|T>00!8`|+`0c @|T>0}\||P, ԃ@`|b0`HߡAw|C|0, A!;|+c3 @|T>0||0,AP3!||+`f0c @}AUJ>0|fP!|+3 |*0c @|!|+`f0c @}AUJ>0|fP!|+3 |*0c @|H|0HޱAH |!;~|+c3 @|T>0||00@p,@h3!||+`f0c @}AUJ>0|fP!|+3 |*0c @|!|+`f0c @}AUJ>0|fP!|+3 |*0c @||0!;~|+c3 @|T>0||00@,@0x!|+c3 @}AUJ>0P!|+0c |*3 @|!|+`f0c @}AUJ>0|fP!|+3 |*0c @||0d!8`|+`f0c @}AUJ>0|P|00@,@3!||+`f0c @}AUJ>0|fP!|+3 |*0c @|!|+`f0c @}AUJ>0|fP!|+3 |*0c @z [fF08`8H`Ox0!p}N A pmakever|}&Б!`v:hd08HO8cHO|088HO,@8|H |088HO,8@|088HO,8@0H08`H_aOHRO00 8`8H_AO8`H%OK18`HA,;`@0uHqO8`H}A,~@0u,HIOi9 8; |0&1)|80BHpyO,@ 0uLHO0`H80`8`H^YOHUQOHnEO,@4F,@$&, @`\F'K0p0x0;1151U8`8K0001151U8`8Km0001151U8`8KI0001 151U8`8K!0 0$0(1015<1U@8`8K0D0P0\8`899 9@KKH O0hcHO8H yOHOH,@0uHAOHԹOHA8cHOc08`8BH\O,@ ; 0;|+|*3 @ $,A9@p`&H Fp`&pg_&K ,fA\cc88HsO,@<0uHOcHQO3;|+|*3 @H O0HO<0fl`dHG!O,@0uHO PfKɀ,@(b,A008`HXO,A08`HOHO,@ H RO8,AH ,AT>HEOHW1OcH O,@ D,@,A( ,@8`HTO,A,@D,A8,A(H)O,@8`HT)O,At/@L,A8b |0;c $W:,,AlA\|.,@ |.`'1G|H@@4}F.,@(b|A.0c8`HKcH$|.30cBL8`0!PN XL}0!PN A autoexitchk|A!HO`e,,/bA<0{ATTzTTA`,T8TT0{Ap0,Hl0{H OhaL}0!`N HOhaL}0!`N 0{HOhaL}0!`N 00HO,0{40X@0\HO,0{`0@0HqO,0{0@0HUO,0{0@0H9O,0{0@0 HOh0!`}AN Axshomdm|!`f08`HI00$8`HI|0(008`HIi040<8`HIQȈ0@0H8`HI90L0T8`HI!0X0`8`HI 0d0l8`HH0p0x8`HHՀ0|$08`HH008`HH008`HHT008`HHy 008`HHa008`HHM0Ā08`HH5 t0Ѐ08`HH 0܀08`HHX0!P}N Asdebu|a!``c8`0HG 000T>8`HGb008`HGi0 08`HGU00 8`HGA0$0,8`HG)H00088`bHG 0< 0D8`HF0H0P8`HF݀0T0\8`HFɀ0`0h8`HF0l0t8` HF0x08`HF008`HFq0|0T08`HFU 008`$HF9008`HF008`HF 008`HE008`HEဢ 0؀08`HEɁh0!`}aN A rdebu|A!7cȃ 0B8`@3zce0HEU,@ HWOccHOce08`HE!,,Ace08`8AH 8``HAh0!`}AN Afatal8 3|;|+c3 @|T>0|(,^0 H;@ H||+|*3 @|dN @tbldlen|}&!䑁!```|b`-,.B 8`#A; @$HYA4{0{ @ K)`,0$@3,c,@30@34APKɈ`d,cA4K`d,cAK088`H088`8HCdh0!`|!8`g} N C(setgen|!!`~ 0Dc8`HB@;,;`A HA; !8`|+`h0c @}!U)>1} @0hHA,@@h0L0d8`8!THB9x0!p}8`aN 0p0|cf8`3HBWh:A. cc(H B ccH}O_@A<c\+ ( A@8c3<(( ( OB3@3<(( K!8`|+`h0c @}!U)>1}H/1@X}>@( + A@DA,1<@,}>@,+ ( OZ@A1" ;+ \( , 0a<@TH5O,<1(Az<3Z(Kđ!<<3Z1(!<(KA@}cf3Zc0h8`H@QA8~`A1T~, ,8^8@hc@h0H,a08?@1H h0`N @dbchr|a!``0}HA;`,0a<3A `9 (gHAA,cc0\A H)O0},@$HYA4ccA HO}0!aN Ackhost|}&A葁!pā8`,A,@;@T>3 HO3~-;;ccHOcH̀A8`HOTe>.Q/ ,YA`, / -NALZ3LA,A@0~HT/n,q/yALZ3A @40~HIO-;@H(0~H1O-;@H0~HOAHcChd0!`|A} N 0!`N X0!`N C`askmore|А!`{cf0܃0胢d8``HHOHTc>HO008`8H8H`08`H8Tc>HO},A,H.!O}",0~@ HuOh0!`}aN Astptrap|a! 0``,`(AA,Tg:|8|8|N 8 |8`|+`g0c @}|U>0|h88|+`0 @}U>0|@|80,,@0 cHAcH$08cc`cHAc8`HO,8@āh}0!`N `0DcH=Ac8`H5O,8@xh}0!`N 8 |;|+c3 @}U>0|@}81G( 9@}9, ,@c0LHA0hHc0`cHA0h8`HO,8@ȁh}0!`N 8 |;|+c3 @}U>0|@}81G( 9@}9, ,@0lcHAcH 0cc`HـAc8`HO,8@h}0!`N 8`HO,8@䁁h}0!`N 8 |8`|+`g0c @}U>0|@0,,@0cH)AcH 0cc`H Ac8`HO,8@Dh}0!`N 8 |8`|+`g0c @}U>0|@} 8( @|!|8`|+`g0c @}U>0|@|80,,@0cHIAcH 0cccH)Ac8`H!O,8@dh}0!`N ;` a8`|+`g0c @}U>0|@} 8( @|!a8`|+`g0c @}U>0|@|80,,@0cHiAcH$0ccc`HEAc8`H=O,8@`h0!`HX`0cHAc8`HO,8@<h}0!`N h0!`}aN P0!`N h0!`}N Adotlog|}&̑! `= C0;88`z,```a!98,@8HO,a<3!TA$; 8|+|*0 @H$; 0;|"+|*3 @0a0|(38|+3 |%*0 @0|H38|+3 |%*0 @,@3c$|"+H3c$|"+`0 @}!U)>0|H|+3 |%*0 @c$|"+`0 @}!U)>0|H38|+3 |%*0 @8cHpUO,A3$c$|"+`0 @}!U)>0|H|+3 |%*0 @c$|"+`0 @}!U)>0|H|+3 |%*0 @3(c$|"+`0 @}!U)>0|H|+3 |%*0 @HDc$|"+`0 @}!U)>0|H|+3 |%*0 @c$|"+`0 @}!U)>0|H38|+3 |%*0 @3T0,ccc?HA|+c3 @}!U)>0|Hc|+3 |%*0 @c$|"+`0 @}!U)>0|H38|+3 |%*0 @cc8HeOc;|+|%*3 @8cHn!O,A30c$|"+`0 @}!U)>0|H|+3 |%*0 @c$|"+`0 @}!U)>0|H|+3 |%*0 @34c$|"+`0 @}!U)>0|H|+3 |%*0 @HDc$|"+`0 @}!U)>0|H|+3 |%*0 @c$|"+`0 @}!U)>0|H38|+3 |%*0 @.A38c$|"+H3@c$|"+`0 @}!U)>0|H|+3 |%*0 @8|+`0 @}!U)>0}%HH0Dc%a&8`H+@\oɀ!(!( $HyO `h0Tc08HـAH0hcb08HAc$8`HO,@ 0聁|0!ມ} N "C doxlog|}&!䑁! 8`,A t,A lЁ,@ \HO`c0t0|8`H*,8`@ 88`HO`0W~0c8`H*],8`A 1(0~+9A "U:|ic0|i|hN A Tc:|c@c|c@|hN " ,/,AL8`@ a@ 9},Ap,/LBA 80`8` H9},A8,@,y/A 80`8` H},b xc,.A4/,/AATA AHAtbĀc,@dy/AX80`8` H}b,H8A0bĀc,@ y/A80`8` HM}b,HAbĀc,@܀y/A80`8` H }b,HAbĀc,@y/A80`8` Hŀ}b,HlA003|8|+`0 @HO0W>|0|}03Y;|+c3 @|T>0|800| 0t X ;@HO;|0t \,AH%OcHO|+c3 @|T>0|80|0| 0t d@ H]O0t h,AHOcCHO0t pH!Occ,0 tA,HՀAccHqO0t ,H0t HQO0t ,/,/A`,AH0t A(0t A0t A$0t H,HOHHOHHuOH0t HeOHHO0t ,|0 ԃ<@H5OH| , |T8@P|0| T8|dHmO0t HaO| |0T8|dHOH@| dH-O0t H!O| |0T8| dHO0t ,@HqO0t HeO ( 4}0!!N Adpyinit|}&ܑ!, .AK>H O:/- x @H T,@ %H@%/c@8A ,@ dH#8`Hn!O;,,LFBA䀄T>HOH, , LA` ,A ,A,@ ,A | ,A ,A \,A L ,@,cCc$ccfH4i0!}N 8 |8`|+`g0c @0}!(U)>0I8A T:|(|(|N ,@\0w d,@0 lceH0 tceHO0 HA0!}N cd8P0~,;HuO{}̛| (0!N ,A |,A4cd08PHuO8}0!N cd0|8PHuaO8}0!N ,@ x.e83 HJO`d@0 cH 0 ccHqO0 HyA0!|} N ,A (cd8P0,;HtO{}̛|0!N (WA|(|(|N 8`ZK,@p (l3 !( $HfMO `fcHyO0!}N 40,N 4@0w HO0w HO8, 4@ 8`ZHO 4}0!N ,@$0w HO0!}N 40 ,N 4@0w H!O0w HO8} 40!N ,@$0w H}O0!}N 40,N 4@0w HO0w HO8} 40!N ,,@$0w H O0!}N @,,A0w H9O,,@0w HO3,cH@0w (HyO3,cHiO|3|,A0w 4HMOcHAO3,A0w 8`HwO} ,b\A9 #=8`HwqOv?,,b;A88`0A0 8Kݛ8`Hw%OH0$0@8`8HH AO88` , A[XHvO8` HvO8` HvO8`HvO8`HvO8`HvO8` HvOA0t",8`A̛ITHvqOxHl,0D ~APH=O,}#^}#HA4U):}*H.0LI8HO,8`A H O| ,;@ ;AHeQO,bc@,,btc@,bc@,AЀb>`{, 0c 0@HuAb0}PHQO8`H+O>0}`, @0H-O0{ H5AA|+H0A|+|*3 @|HOb0d8`H9b, A HO`fb08`HyH9Oxt0!p|} N C |doclean|}&A葁!`~`c008`Hc008`H008`H0ȃb0B8`8H8`K݀.,;A@d,,A$0TA8`HhOx,A`A,A HOc,008`AH8`Hs9OcH Adh0!`|A} N Cldoexit|!b؀,e c@|c4Tc~~H8`A8`~H=O,88`@(b,c|c4ATe~H}X0!P}N Abgchk|!b؀db,00,8`;A;AccH,/,/A(b 8A($8`A(b A,H0H]OH$H\IOHH\=OH H\1OKXL}0!PN Asetint|}&ؑ!@B`}`,``:@8`0!N 8`,@0|d(8|+`0 @|/T>0| 0.,/@A430+H,/dA 0eA,@37DA3X+AW:| | |N ,,@@ /A/,. /L!A$0lW>`c%cHy5AH,A@(0@T~0x`c%cHy AH@0,@(0T~0`c%cHxـAH`0c%ccHxAH@ ,A/,. /L!A 0W>`c%HxyAHpA@$3@0W~`c%HxQAHH@,,@$30W~`c%Hx%AH`0c%cHx A8`HyO,@8`HmO,Ad,A08`8;`HbuOHp`0cHwA8`HyO,@8`HmMO,A d,A08`8;`HaOH`0cHwA8`HxO,@8`HlO,Ad,A08`8;`Ha}OHx.|;;`@`.;AT0x!H]A70 8[A89@1_108<;L8`F8>9`N9 U@( , 0@0a30@||a1a|~|)1HDAa1|H4030@<|a}~!}>)3|1|A@( ,Kt3 ,8.AA|a3|10;]|~ ac0HuQA,@37,A,c$8`HvO,@8`HjOc8`Hx O,@8`HjO,A,d,A0c%c8`H_OcH[AHpc$8`HwO,@8`HjaO,A4d,A$0c%8`8;`H_ OH`0c%cHt!A8`HuO,@8`HiO,Ad,A0 8`8;`H^OH`0c%cHsA8`Hu%O,@8`HiaO,A4d,A$08`8;`H^ OH`0$c%ccHsA8`HtO,@8`HhO,Ad,A008`8;`H]OH`08cHrA8`Ht%O,@8`HhaO,A4d,A$0\8`8;`H] OH;`z8`ȁ0!|} N C  Tdodebug|}&ԑ!B``,`;;A.8`,@HHXA4u@48`HgaOT|0!A} N Ad`0dccfHq=A8`HrO,@8`HfOT|0!A} N `0|ceHpA8`HreO8`HrUO,@48`HfOT|0!A} N ,}: @|2c|.; @H@,b390a@|@ 0H0LPa.A 0H8`HeOH0HoA~|`|+`f0c @|T>000a@~|+0c |*3 @AT@3`~|+`f0c @|T>0|f8~|+3 |*0c @8`HpO,A4}@c|.KȀ0!|} N Ah0!N T0!|A} N C  dohexdump|!DTd>bH,c( /A|,+@+OAdLӂA\8`Hs!O,;@,0}HuqO0}HueO8`Hd OX0!P}N L0!PN Alogchar|A!BD`,,/H;L3;OFBA3c},3( /@(+A$L^LӂA8`Hr%O,A4|@},3Kh0!`}AN 0HtIO0Ht=O8`HbOKPAH0!`N Alogstr|}&A葁!`}c8`00 K9.0$088`K~,',A,hd0!`|b 8} N ,OBL1AAh8`@;,@pHS5A~0<0T 8`8@K~0X,0p8`@4 8Kmdh8`|}0!`} N 0xH1A7C;bc;@3_zcD,cE8`A0~HlA`|cEc08`K,H 0K,{,A\bĀc@P,cD0b @8HO0HO0,;A HOcHahd0!`|A} N hd0!`|} N CHfxdinit|A!`~ ;,c4Tt0PA 040LT8`80!`K0`8`K,3c0d0@88`8Ku0}08HJAA,c0Al08`KI;@ 0}08A|+c3 @}U>0|0, 34;;`@A|+|*3 @8HIA,c008`AK0}08A|+cf3{ @}U>0|@, 3T;;`@A|+|*3 @8HIEA,c008`ATKMA|+cd3{ @|T>0|0,@c3t;@A|"+|*3 @h0!`}AN h0!`}N A, ck_termset|!HTc>,AHSOH0!@}N Hl}OH0!@}N APck_outc|!``|,8`'@Ktc,c0t@0HOH$00HG݀Ac8HGAX0!P}8`N A ck_curpos|!`34,8`'@K4c,08`@0~HaOHK1ccHGAAX0!P}8`N Ack_cls|!8`',@K]T,0 8@HOXLH0THFAXL}8`0!PN Axck_cleol|}&a쑁!``b(c~8`00$(Kc0(048`K{8 8HF5Ac0}8HFIA|,A-dp8 @${8HEA{;HF-Ap|08 Al{HEA4||3@03@c8/HEA43@c8/K,0}D8-A HEAhd0!`|a} N hd0!`|a} N Cpupdpct|}&!`<`C0,,aP(|f(;OA)A0|c8||"+0 |*0c @H@00a8||+`g0c @|aTc>0|g||"+0 |*0c @H@Ȁbc,@00a8||+`g0c @|aTc>0|g||"+0 |*0c @Hp8` 083|a;|+|%*3 @ ؃,@H3|a|"+`0 @|T>0| |a|+3 |%*0 @H Ԁ<, |@p|a8`|"+`g0c @0|aTc>|d|a}'8|H}]}=PT8U)8|})0c80H[AHl|a8`|"+`g0c @?|aTc>0|d|a|| T8|8}IH})PU)8} H0c80(H[uA(88H:040D8`Km0H0X8`KY,,/ A/@|.@$؁|0!к} N (EA OR1AD0w\HaO8`?H^ObHamOԀ0!|} N @L;0`0xb8`KޡH;MA0|0b8`Kޅ0H;p,AH<O0`d`H7A,A1@A"T:|8|8|N (}88<H 8 8H3A}H3ـA}8 8H3}A}H3A}88H3]A}H3A,,@` ,@,}88 H3A0wH35A.9Hx}88 H2A0wH3 AHP@,}88 H2̀A0w H2A.9H(}88 H2A0w,H2A.9}88H2A@ b0w8H2A;9}Hb0w@H2uA}H2AKI}H2AԀ0!|} N 3}81,:(@,~08H1Ab0wDH1AHL.9~88H1A@b0wLH1ŀA;9Hb0wXH1A~|8H1A~H1AԀ0!|} N ( ~8 8H1-A ,Ab0w`H15A~H1MA~8 8H0A ,A00wdH0A~H1AKр~H1IAԀ0!|} N b,@8B(pz88H0qA3tT>H4O`dcH0qAzH0A,@z88H0A,@̃,At0 ,AHz88H/ՀA0wxU:|@T:|cH/рAzHDzb8H/A0wT:|@T:|8cH/AzH/AHB(H,A,@Ԁ,ADH,A8z88H.A0wH/AzH/-AH=b1M0|8|6p@U H|8@(T|@AXz88Hz88H.qA0wcH.Az@TH.A,@0,@9@Hb@H TP|8A8z88H-A0wcH-AzH. APz88H-A0w,@HH-AzH-A,@bH,,A,Ah0ad0HLUA8H;,HH8|8A4,0ad0A8 t;HL AH,A4z88H,̀A0w0dH,AzH,Ab؃܁>}8LH|8A8z88H,qA0wcH,AzH,ALD(Y|8@+NLB3LӂAL00axcHK9Az88H, A0w0xH,!AzH,9AD/S,%,TAHA(.D,E/QAAAAzH,Z/qA A0AĀzH($8}@LH|8A4z88H)A0w`cH)AzH)ŀA,,LLB3A`z88H)QA0wdbH)eAzH)}AzH,($Hw8 ,KMz88H(A0whH)AzH)-AH܀z88H(̀A,@2x,@2|bH(ɀAHw8 ,Kɀz88H(yA0wH(AzH(A>}@LH|8A8z88H()A0wcH(=AzH(UALzH(AԀ0!|} N 00c8`K˅0Ѐ08` Ki008`KU,@00$8`K9 0(0D8` |K0H0d8`(K8 8H'9A0,Aw<8dKH 0whH')AH'AAH(8 8H&݀A*H'AH'QAA,W:|P||N $ 1$(|8(88H&qA0wlH&AH&AH&݀AԀ0!|} N 88H&A0wxH&5AH&MAH&AԀ0!|} N 88H%ɀA0wH%AH%AH&5AԀ0!|} N 88H%uA0wH%AH%AH%AԀ0!|} N 88H%!A,@ 0wbH%%AH%=AH%yAԀ0!|} N 88H$A,A0b00aHCA0w0H$AH0wH$AH$AH$AԀ0!|} N 88H$-A0wH$EAH$]AH$AԀ0!|} N 88H#ـA0wbH#AH$AH$AAԀ0!|} N 88H#A0wH#AH#AH#AԀ0!|} N ( |8 8H#%A0wH#9A|H#MA,Ah|88H"A|H#!A,A<$(00aHAɀA0w40H"ŀA|H"݀A|8 8H"A 9p *HOH'O08`d`H"qA|H"A|b8H")A|H"aA|;b8H"A|H"=A|`H"uAH"AD@,LPTA$ P,A0wP8H[uO0g H@uAԀؒ|0!к} N (`88H!EAb0wTH!YA,A$ P,A0w`8HZOH!EAH!AԀ0!|} N ؁0!|} N (<888H A0wdbH AH ŀAH!AԀ0!|} N (;~H A~b8H -A~H iA~b8H A~H IA~H AD@LPTH AԀؒ|0!к} N (88HA0whbHAHɀAH AԀ0!|} N (88HAA0wlHYAHqAHAԀ0!|} N "C screencP C0$$$$$tlP`,xDX, htTLTɼ<ʼ?$@|(8T?,@0`(,@ 8`N `,A`,K`N @LckrcharT>,,@ 8`N @A8`eM 0c,@AM 0c,@K@M 8`N @hckstrchr|!7~;,@cH0!PN A4H!A,3~AH!A~~,@cX0!P}N Acklower!p,L0T|89,@ `90G0a,|"+c&39 @|,T>0|80/@`z0A,,A< A,|@X7;`Ac$ccEcAH5,3{39||A|c$ccEcAdKccEc@`|,33cA4H,0{3{A$3,ccEcc@8`h0!`}!N P0!`N !D0!`N Ackindex|}&a쑁!`,| @/;;`A`; 8@(A HmAh}0!`aN |+`0 @|T>0| |h8.A0HAA`{.8A|+|*0 @,A HAAhd0!`|a} N XaL0!`N Cmakestr,M KN @xmakestr|!7`,/;A|@|AOBB,|A@`@`cHA,AH0,`1(&B0A BA HAX0!P}N D0!PN Ackmemcpy|}&a쑁!,,/@88`0!`N 8`H08`H(8`Aphd0!`H`@0gP,@0T,@8`@8`0!`N 33@X8`0!`N 8`H,3.A~,,AdAXc@HH-A,cAH=AT|>ccH A,ccAHAT{>|@8`A,43AA~,,K8`hd0!`|a} N 0!`N Cckstrcmp|A!,,;@@0fX3@0\3~,,c3LB3A|HA,cAH)AT|>ccHA,ccAHAT{>|@@c~,KcCh0!`}AN cCK Ackstrpre|}&!p69```@ 2`,,8`@xH0!N aH aH@8`0!HaHaHaHaHA@,@9aH@1d0haH0haa8`KqO0xba8`KYO,@tn(.@t*.Al0({*[,LBNFAL0aa8`KOa|0!} N nH2a-:: ,.(*A@LcHA,AcHɀAT>ccHA,AccHAT{>*\,,A ~@0@<`1H0+?@T8@(cH)A,AcH9AT>|@1@$2nK )[0*{LBA`1nK(*@@8|a0B2ba,0A~aHdc@$HuA,cAHAT|>,/-,\.]A`}@0A\APA~,H ;,`@,0Kx|خ1,AnK;Kĉ5a(]@U?@a@a(|H@A~A1U>~H@A~A1U>~H@KKh@@|b6b,a`A\b+ {1 * }3@a 1 @a , @0'c,A+ {1 * }3KH,@ aA43~;|+c3 @}U>0}8Ha|}H)A,aAbcH-Oa`}0c\.c3{A ,.0@4:`K(\,+,0@ .H A@-@:,0y-AHmA7cbFac;Aa~|+|*3 @~|+c3 @}U>0@~|+3 |*3 @}ɮb&bEK`g-cHA@$8`HLK1|g4T~-,0@a`@`K0}82aHUAH@Ĉ**@(b2(*@2(*Kb?a, AXc* ?)*(\+ [A@* {1A4OZA,A('a, 3A* ?)*(\K,0}@PHŀA7A4bcHO}cabG88K`~cH]A,|0@}8~H܈,AcabEb&K]$|T,A`a1b&bEca,ALK!$|T,bEb&cA1a,KȈ8`,@Ha0!H@@ `1nKX9aHnK@0!|} N Cckmatch|}&H1A!@7B4~`0||@3a,A0bbc>bHA |.c4`@0s@H;,A8}|+c3 @|aTc>0|f||q@0s,b8@X8K,c8A(ˮKy,A8`H8`A8`,H K,@A0AA(|no|n@A aWf:~1.Ata|1.20x2|239@a|KKhd|XPˡH0!`} N ! 0!`N "C@sh_sort|}&ԑ!`7``w`aYa:ab,/8`8@3H,0@3@3@3KO,@(,@,@,A|bHfO608`8 @2|;|+c3 @|T>0|.b`KO8`@c,bA4KQO,c08`8AKO8`Hc,bA4KQiO,c08`8AKyO8`Hpc,bA4KQ%O,c08`8@K5O8`H,b,cA4KPO,c0 8`8@KO8`H.,@AbH,O`c0008`KO,8`A|A(cfb048`AKO8`Hx,|cFb0P8`L@+A$KQO8`0!|HH,b0ulA8K,b0x8`8AhKO8`H|.0cf8`KO0b8`8KO8`Hcf08`8KOH.,;`Ahb30|81D}@"@8|:0|3d101)鍇||9`U@.8@8Q@.3T@.|@9`P@., U8`AdUUvU־@9`@,}iX3hA }i`H 9@}i`h}i(h}i hB`|c@鮻aN @8b8tob64`,`;;@ , 08`N 8 ;@(||+c3 @|T>0| 0|p|,|0|8,0@|01+=@a01@|0(=@a@8`N 01,@|10|8HA008`8KO8`ȁ0!|!} N Czclose|!`,,/A<,@4A@,8`HO,8`A8`XH,Tf:b@8 4dA0cHHHd|d0.0|d0.,0@H A,Td>8`Hd,Td>8`A 8`XL}0!PN A(zchin|}&Б!7$``{;@;::A H i,c5,28A0!}8`N YHLA; cc,0H3;AHK,H/ . A<c,, @@A\A392bHtLHLb008`KyO,@h;Y0bH`A,@2A392H392b,2Acc,KLY0bb8`KOc0!|} N C zsinl|}&!`,`,/At,L1OZAA`H O78`;@,3@43~H eO~|@8`@3~KcH4Th:|@.c8H AX0!P}N XT0!P|} N X0!P}N Czxin|A!b8,A,@|(@@HO7Bb 8`A<\;@@38`H @08`H )O|})3||A@8`,08`AH0eH4 BL008`K}O,A,@D00 U8`8A(K5Oh0!`}A8`N U2,Ax,p;Ad,00(AD8`8KO8eHO`c0,0<8`KO,8`AD\<~08H eA `f0@0P8`KEO,00@0T0dT,T8`8AHKO0h0x8`KO8`, Ah8`h0!`}H`,0|0AKO8`h0!`H400KO8`Hfh0!`}AN h0!`}AN h0!`|AN ATzinfill|}&!``}H,,8`@8`,AA,b,A8/,L1OZAA XD}0!P8`N ,W:. cc@D|}.8 c|;|+c3 @}!U)>0|HAH4|.;H EA,A;@|}.H1AcXT0!P|} N XD}0!PN CXzsout|!`Ky,8`Abg,,/A,8`@ AA,W:L@ |}.0Ȩc8HAH@|.0`H =A/, , 8`AA@|}.HA8`X0!P}N XL}0!PN Azsoutl|!`,,/A(,L1LZAAcL0!PN Tc:|e.ccHA|A;cXL}0!PN Azsoutx|!ll,T>ahA,,,/@A@8`0!PN ,Td:L@8| .8le8HрA,8`AP8`XLHH| .0HO,8`@$h8`T:| .T@8`XL}0!PN Azchout|A!\,bAhL008`K~OHHc_;A<008`K~]Oc0048`K~EOH8`,A9 @$h;aL}0!`8`N ,A@/" @,1) |H@@ h{}aL0!`N cBL@t gHA`},c,A008`A K}]Oc|(@ gK8`H8`h0!`}AN haL}0!`N Azoutdump|!H4, /T:A8`A(L8`08A0LK|O8`H| .,A 8`0!@N H0!@}N 0!@N Achkfn|}&ܑ!`}; ;@; 8`|+``0c @|T>0|, Lc0P@K&O,8`Ac(~3P;@(H_,L@0`\,@c0T;|+|*3 @c|+c3 @|T>0|(0<3@|((/@?)78H mA,\8`T&A|@̃Lc8@=0aP8HqA`c0`0P.8`KzO,0aP0T\LBAD=ApHA,\8`T&@@0!|} N 0|pT&;|+|*3 @<0`|4T~c008`KzO,;Ab=c0aP8;HA`~c.00P8`KyOc@ 008`KyOH08`8KyO,8A@ =\,T&(@A;@ApcC0!|} N 0!}!N 0!|N C <zgetfs|A! 7;8`A9 }!;|+c3 @}AUJ>1)}*Hc, @Lc0@K#QO,8`A^= (~cB3i@$H\7@3>,@cc0HHA!P4c0U)&@8`KxO8`H(@B`J@;,,A@<| @(08`LB3A$KwO8`0!}AN 0 8`KwOc8xH A4cc!d@008`KwUO8`HD=08KOc0H8`Kw!O,@8`0!}AN Ѓ0!N ؃0!N 0!}N A,zchki|}&!7;c8`AT; 8`|+`e0c @|adTd>0e"Lcc0\. 8`Kv)O@00dcK O,@chd0!`Hc(~@$HZ%,@0yp,@c`~,3@Ha,8`@`cKA7@$b0t0c@H 5O8`hH08`|+|*0c @,|{@,H A`0(/BA`00cf8`3Ku O;.00cF8`KtO,/LBA鮈,AcH`,3@8`|+`d0c @|T>0|(cc|(@,|H Alae$1e(/BATae,@, H _, AXH`M,@8`|+`dKt,H,)Kٮ0{,H ,@ 0y8|+|*0 @c8H -A`f.@$b0c8`KsOH0c8`KsuOcKɀA@;chH;@K,chd0!`|} N AHXP0!`N Czchko|A!x`bL,;@d;@HɀA`zc08`8KrO,,Alxc38cATHdec08`8KrUO,c08`@H{AhH0 H{݀AhcC}0!`AN Azdelet888H @zrtol|}&ȃ!`6`~```,;::`:A8@L3 ,HL0 0c8`8KqUO(~@(cHU,@0u <,A`~`0 @cKO|`4T~.,,@@0c0LHɀL3`c8KyO_Hp@ c3`c8KUOHLcKUO,A c3`0 LcHـAHc3`c8K O_0 Pc8`3`8;Kp=Oc0 `0 x8`8Kp!O;`,0a_A8|HA3,+/33{@D(/;A@cA83,(/A$A 3,(/K@;c3,BAc0`8KO_cf0 |c8`KoMO,AAbccEKOHĒL~b,A,@+ (!@:,@AXKA,2sAbaLH$~H녀A,AbaLL0L~,A@+ (!KxaL0L|@+!L)AHaL0L@(!@(@$aL0L@(!K܈,,@(8 3 |8`|+|*0c @HX@TLw,ADKрA,aLAcK݀ALeaL0Lc,@0 b8`8KmiO0!|a} N al0!N C nzrtol|!!`L`c8`0 8KlO,;`;@@ h0 }0!`AN 0 (~x03(8`8c<@`cKlOc%,0 (/8`8A@/3Z@c<;@H3@/,(/3Z@Л|>Kl!Oh0!`}!N Azstrip888H @zltor|}&!P` ``}:`9DT:|8(BL`:c0 8`8KkQO,`c@00HKH2`b8KO_bH.3 2`cc8HA0,c0 8@ `KHA,0@`ccKcbc@8H\Hb8K-Ob0 8`8.KjiObe,bb#-x@(KO0!|} N W3,c;.;X;-L‹BA(;X; _HA2cCb~AHATz>cCH敀A,cC+~(#+*AH晀A{3{H(?@3{W,H+ @3{W,HA@3{W,Hd@;3{W,HL(.@3{W,H0@;co3{W,H[3{W,AA,becb#A(.@ 0cKQOb%0 8`8KhO0!|} N CPnzltor|!`~Lc8`0 8Kh)O,0 $A|@A,@ H`~c0 (8`8KgOcHL!70 88`8@3 4,@ccKgOcH =A,8`A8`X0!P}N Azchdir|!L0 DH1A,@0 LXL}0!PN A@zhome|!Lx0 P0 h8`8KfO0`8H A,@0 lX0!P}N Adzgtdir|}&!䑁!p``"Lcc.0 p8`KfMOcKe,,8`A-, 8`Ac0 x;A8`A A;cKeO,0a@AHOW:,c0 @ H A,|.\@,!t0!|8`} N 8`|f.!t0!|9 &} N HMA,0 0 8`A88KeO!t0!|8`} N H!A4y,3 @0HO,8`A HnA0 0 8`KdOa@HA8`HA0y 8HmA,8`@,!t0!|8`} N HAaDH =A,8`A,!t0!|8`} N HQAaDH A,aDA,!t0!|8`} N H A0y HA7@LHOH A`}c0 0 8`KcqO,A,@cccIa(, 0 0 8`8A4(/H1), @a>(/1)AH, KKbOcc8`8KbOccc0 8H A8`HlـAHH0 0 8`@88KbO!t0!|8`} N W:0 0 8`KbQOaD;HAa@\.0 $HAb |.@ 88,AlcH⍀A7CcF0 (0 D8`ADKaO|.cEf8HUA`f0 H0 `8`KaO|.H|.8 8`0!|!} N !t|0!} N !t|0!} N !t0!|} N Czxcmd|}&!䑁!`gL-`T:0 d;. 0 t8`K`O0 x0 8`A A;cK`eO|.b,,czL3Ap|z.;`H A`y'Fpc&0 0 8`K`O0 0 8`K_O,z z..8`@x8`Hp|.0 0 8`;K_O 0 0 8`K_O0 ,0 A8`K_O8 `HiqA0aLH)AB,8L3A40aLH A(0aLHA,8@A0aLL0 T?0 |Fp8`A`K^O0 0 ,8`K^OHB|{.H yA ..0 00 D8`8K^O8`,A@0!|A8`} N 0!|!} N 0!|A} N Czclosf|ؐ!p7;c"Lc8`Ad0 \8`K]O H0 l3aP0 |8`K]O L0 0 8`K]Oc(~c@,HA`dcc8K!Oc0 ceH cc8KOc0 ce8`K]=OPc,0 : A~8`;|+c3 @|T>0|}; 0(/|@3Y p@Hc~~|+c3 @|T>0(~|+3Z |*3 @H@(.9@*@$ (/L1A$EcceH8*@ @cceK\EOccHHU;@`~c0 ce8`K\O,0 8`AX~|+c@3Z @|T>0|`1%9@/9`*@$};H(/A }[)|}{)0)cceK[O,,@T|<AD,0`@@KA4A<cc0H+`}HL|<0`@,@KA4A<cc0H/`},,ADc0 0 8`@`KZOH0 8`KZOc0!}N !t0!N 0!}N A zxpand|A!``}LccFW_80 W\z8`W[KZ O00|4|4TT~,WE P X T0 0 8` H LLB3;A H L8KYO L0 0 8`KYO P0 $0 88`KYyO T0 <0 P8`KYaO X0 T0 h8`KYIOcK-h H L P} T X0!`AN A0nzxpand|8`L,M ddN @,zxrewind|!L`|8`,00 l8@88 |;0|+|*3 @Hc`KX1OX}0!P0eN Aznext8`N @zchkspa|}&Aȑ!@7`9 2:@ "L3 t: ~;|+c3 @}AUJ>1)|H@Lbxc8`0 xKWMO:0 0 b8KW1O0 0 b83KWOcc8HH7AP~;|+c3 @}AUJ>1)P`0 c8`3KVO.0 cc8`KVO@3 ~;|+|*3 @c8K!`|0 cc8`KVIO5<3@hc?3I1)}XP?0jHA|,c3@`t@ ?I1)}XP?0jK30 ccHA0 c8`8KUOH#_0 0b3alcF36 KUO0al3`~|8;|+|*3 @1 H3~2;|+|*3 @K`~c$c0l8`KU O,A ,@0al3`~Kx,3@hc>3I1)}]P>0jHA|,c3@`t@ >I1)}]P>0jK,= ff1)fg@4})})pU*}IPUI8}*H}*H}), 1=@H3c0ccHuA3~;|+|*3 @0$c8`8KSO"ȁ0!|A} N A0!N 0!}AN C8znewn|}&ܑ!`}bL`c;@8`x088KS5Oc0D8`8KSO;,A8`,@PcH? ,c0`8`8AT: A@~;;|+c3 @|T>1 8|@~|+c3 @}U>}@|g@KA`x.c0@8`Ac~;|+|*3 @c(/c3PA@~|+c3 @}U>0@~|+3 |*3 @K~0T@|+c'39 @}U>0@~8`|+3 |*3 @c8KQOHKQO.ccH A7,dA;,Alxc38cAT^HC!^ 3 cc8HC ,cc0p8`AHZAH0HZAcA K1Ac0!|} N `0!}AN C zrename|}&ԑ!`|;`;@L`cVc0cf8`KP1O0c%cf8`KPO,A<x8`,A(X0!}N cF-HX0`cH9A,@$0c#H!A,@``|(@@Pd~(@@@00cf8`XKOeO0!|8`} N xc2~b8HA!,Ab0 ccf8`KOO2 ~ c#b8H@,Ab0c%cf8`KNOcc$KO,@<0$0Dcf8`KNO0!|8`} N cH:,A<0Hccf8`KNQO0!|8`} N c#H:A,A; aH8`|+``0c @|T>0(|0(/9/A|( |e 0HcK|wH;|+|*3 @0dc%cf8`KMOccH 1A`~kphpI|+xccdceHVEA`}.c0pc8`KM!OAcc#8HV A`vc%0b8`-KLOAc0H8HA`f-@L`b0HHV!A,c0H8AHŀA`f-b`0HA008`KLiO008`KLQOA;`czH-AcH腀AAbHuA,@0/,. AdA@;@,H ;@,A.Ad,A|A`0bb8`HU]AH\;@K0cX8`KKyO0!}8`N 0bb8`HUAcC0!|} N C Pzcopy|!0`~Lxc8`083KJO,~,@0H0Ap,c0@AH A,cHHA,c0,H@ 0 H(HŵA00c8`8KJAOc0!}N Azgperm|a! `}Lxc083 8`8KIO,;`,@ 8`H@8`0!}H̀0@,AcH ՀA,HcHA,@0@0!}H|H<U &/ `1,@AA,/ /@AA\AH9?0 HH10|@ 8APA\Ah9?0 HHx9d0 Hd9c0 HT9b0 HD9-0 H49l0 H$9s0 H9p0 HH9 -U9rA0HH'0HU19wA0HH'0Hq @/ @,/@A A0A@APU9 -9rH\9-0HH<9x0HH(9S0HH9s0HU9 -9rA0H '0HU9wA0!HH'0!Hq(/,/A A0A@APU({9 -9rH\9-0!HH<9x0!HH(9S0!HH9s0!HU({9 -9rA0H '0HU9wA0HH'0Hq/,/A$A0A0|( H0X 8`TS\ $S(,0s483<@DHLPX3,0@: ;@AccHـAH,ce0|TA8`KD=OHc:0;`THyA~|+b2 @|T>0|0PTHTT0Tr1A;@,AcZ,AcZ0 sX\TP08`KCO\X08`KCyO}3d`hlptx0!8`N Atzsattr|}&!Lax`f008`KBOx8ax,@h0}\0!`N H A70c.@<08`8KBOdhP|00!`} N 008`KBYOc3l@00@8`KB9Oc0D0T8`KB!O,, A@(hdP|0X0!`} N ,,A@(hdP|0\0!`} N ,,A@(hdP|0`0!`} N <, ,;Acx0h3$c@ 0dH\0, ,;; A@9@H}A08`|+``0c @|aTc>0|;.c`8`K@Oc@5hd0!`|} N Ctzdtstr|!! 7cL(~@Ѓa0g0!N ,x;@a`0e0!N B@8H$e7c"L@3y,@c$ceH`$ce08`K?Occ,0@A8H A`c008`K?O,ce0H4HA`c008`K?iO,ce0܀h8`A 08`K?=O0yH0K?)OahK0!}!N Azfcdat|}&ܑ!p`y`Lc%cF0,8`K>O,,NB3BA@9 ( * :@,(:@ ;cFc%0Hc8`A@04c%cF8`lK>MO0!|!8`} N K>%O3~3;KA,,A@c~3K3.cFc%0p8`K=O@D3}KA,}AhKA,,AT3@ }KcFc%08`K=mO;H AA03;03c8K=AO@ 0a<BH A`~.c00<8`K=Occ@400KpU*})P)})@81>N>m1>}+H}*.p1>}+H1~O},>pUI}*H}kp}kU})X}LP})P33-|- <|3x0a<. =HрA,AP,/A/. Td:Ad.|@0@0}$ |HcxT 6A|HT 6|HT80PH,0c%cF8`K;iO8`H0NQ BA(| ., A0@`3H0c%cF8`K;O8`H,;A0A@0aPHP08`K5QO00 b8`K59O,A;00 b8`K5OW;WAc,Ac0$04b8`K4OW{Ac@c080HHsc080H8`K4Ox0L0`c8`K4O0d0pc8`K4qO,A40t0c8`K4QO|:T&x|H|00aHA00b8`K4 O.008`K3O,hdAX@Xce0l8`K3O00b8`K3O|@bcHDH00b8`K3qO|-T&(@.@8008`K3EO|0h@|0 8`K3%OA,|ccHA`f00 8`K2O@bHDHp0dccH ـA,A$b0$ce8`K2OH,0Lceb8`bK2OH :bcHD0!@|a} N C zstime|!`ebx`x,L38`0@0cH]AcHa8`XL}0!PN L0!PN Atzmail|a!`bx`bL,c8`0@8`8K1iOc08`8K1QO08`8K19O008`K1!O,A,x,3c0cAHIAHH,xc3c cA0HAHc0HA0c8`8K0OcH8`h0!`}aN aL0!`N AXzprint|a̐!`: `~`~:8|+`0 @}ALUJ>1)| H~80|+`0 @1 4,}AUJ>}HP,}@P3;@@3{3,AKA4,|H3@{,Kؒ,cKA6c8`Ac"x03Lb0( ( A@ccK,cAHŁ4 H,, AA4 L, A@p~8|+`0 @}AUJ>|iPKA,3L8Ax3|~|+|*0 @z@TH |3;5);A?1Ii_HKq,ATi>( ( K cbcK-A8`K,c0!}aN 0!}aN A shxpand|}&!L`~ Tc8`;0tK-9O0cKO,; ;@3(/@c3,AD33_8`KeA`xcE.cdc8`K,O,9@A ,c18@0cH,008`8K,O8`H~c(/, LA@1Ji. 3@,h(/, AA1Ji. 3KQ>AD(/, cOFA4(3(/, A A(3(/, K(/c@ 3(, @,A,c$0`KpEO`08`8K+Ochd0!`|} N C splitpath|!!``L`cc08`K+ OKbx`e0`8`8K*O;@c[L^h^l^pK]7#c8`A$3L(/0~\c9.9 /A 0M'3g[Ko)Oc08`8K*iO\00,(/8`8A,1&,@a&(/1&A,KdK* OD^X,H,2@0gB@@KeA,~DH@D|p}|p||8,2H0gA0z@04A8HQO8`HH0008`K)yOH,2KĀ~\H ~h~\K O~p~`Hh\~l0T8`K)-Ol`0`8`K)Op0p08`K(ODcecPLc#THuc#K-A7?Ac#KX008`K(O~Xh0!`}!N Afgen|}&ȃ!6c``1L@D80ba 8`K(Ob8HUH0!@}N  T8`,A bH`0bc8`K'O P,@T`9 (.@ 5 P, @4\(.@((/A5 Pd08`H\d08`K'UO:` P08`K'9O0be8`8K'!O T.,LA81(/@$0b8`8bK&OH3~@d043b8`K&O9AT}71)})5dH@`|H@a^_0( /1^B@`|H@a^u\ Pc8KoO`c0Pc8`K&)O,@ 0lb8`8K& Ob8HADH0!@|a} N 3K0b8`8K%O; ,@; bcHI`x0-b.c&8`K%O0bec8`K%iO T,@$A@Lp,@h,A4,@; ;|+|*3 @;|+c3 @}U>1}@@0bHQA,@X0b8`8K$O9/}|@sbK1DH0!@|a} N 0b8`8K$eODH0!@|a} N 0b8`8K$-O T,@bH1`,A0 b8`8K#O0(b8`8K#ObH }A7c@<0<0X8`K#ODH0!@|a} N H }ՀA,AD.;@ ;/0 ,90a8A9,AKO(.,@8(.A,@$@ 0\08`8K"OHb,b P1A(H3, IAH3, K,+.@A< Tb,AH T,7H 8`7@L`AD((*,@0b0p8`@ c&K"9Ob8Hq T\08`K"Oc&be08`K!Oc&b08`K!O P008`K!O Tbc, P08L“A$u\KkAO`|c00HKk%O`|c008`K!iOcbe008`K!QOc&be0L8`K!9O, Ta ,@AAP,@H@AA8|||@0~PX@ XH`3;|+|*3 @,0PXA(|1^(/9 /8A}:||P_Lh0!`}N A addresult|!L"x0i#P,@tHO0H1A,3@; 8A`|+|*0 @cH wA,#A4āBx|@0j#P8@|+|*0 @HH wA,0@; ;Ad|+|%*3 @`H w)A,A4|@0@x;@$0`#P|"+|*3 @H\H uuA,"x89@@ #P_8`H,8 3#Pc|8|+|*0 @X0!P}N L0!PN Awhoami|!!`"Lc08`KOc(~cx@0|$PKAO,0|%T;@ 8AA;;|+c3 @}Ac`yUJ>1)}*H0|&Y0@4})1<&WHA$I3E(/BA I3,|&X3|$P@KYH uaA,HH uQA,;8AtA|+|*3 @c#A|+|*0 @A|+c%39 @}!U)>0|HA|+3 |%*0 @H4c#c}A|+|*0 @A|+|*3 @h0!`}!N hP}0!`N hAH|0!`N A tilde_expand|!`HA7AT0a<@8`X0!PHHA|A0a08ccKO,,|8`@A`Kt5A68`8Ax|+|*0 @b(~@K708`8@3c,;AKEO|+c3 @|T>|d8KsA4b;@\KseAx0!p}8`N 0<0T8`KObKs%A8`Hl8`Hd`Ks A|+|*3 @b0 8`8K}Ob0(/x"@ `, b A䃢 \(/8`@,@؀,@,AL,AT@@<TA0AT@@TAbK,b0,8`8@(KOb8H jA,2A/A(/8`K0bKqAbx0!p}N x0!p}N x0!p|N A  zmkdir|!Hx,A8`0!@N H iAH0!@}N A@zrmdir|!`}L0X;c0`8`KaO~c8H 0A,@;Xc}0!PN Axzfseek|}&Aȑ!07c``2`:,:@;@ ؂A0!}8`N ,@ ؂A0!}8`N @ ؂A0!}8`N bcdbKpO; ;|+c3 @bL|T>0|cedhl0pb8`K O(~@PccK1`0c8`8K O,@3,Ac,H ,A3cec8`8K O+.(/@`cf@X3{+/cf@$3{(/@3{(/K,Acec8`8KH,@0!}A8`N (/@LcdbbKnO0~1;|+c3 @|T>00HK7A0c8`8K OcbbKnO|+c3 @|T>08;8/|80b8`8K !O|+c3 @|T>00||u@0!}A8`N cdcKmqO0~10b8`8K O.003c8`K O@ |0(.@|0+/A<,c@L|00+.@<|00(.@,|0+/@ 0|8/@|0~1,3u;;@;@<3a3|Ю0(/0ad8@0c|3:HA ,BAHaA,00ad8@ c:HH=A,00ad8AH!A,0|@H,3ZAd~IH A$`0(/BA `H8`~H,@|Ю|2R~|Ю(/@b\3Z@|Ю0(/0adK3bbcKkMO~8/,@;:@0|0(/A,bK,8/LBA|2R~,|AlhSdb0bF8`KOl0 8`8KO0sdH@0bFb8`KO8`H 0!}A8`N 8`؁0!|A} N Clzfnqfp|!`~; 8`;|+``0c @|aTc>|cKiA7L0`@HIO8`H=Ac|+|*3 @X0!P}N Asgetsave|!H aIAL`c0<0H8`KO,x8`A}'\3'\,A1@b0ccKO0!,8`;A4{,A(H(0!c8`8KO8`H0}!H !A`zcF0!8`KiO,cE0aD8ADH !A,3}!cd8`Al0D8K%ODc(#c0aD@H̀A,APDcE0aD8H !Acd,0D8`8@cCH yA0!c8`8KO8`x0!p}AN x0!p}aN A checkuser|a!L8`3 0!cK)Oc,ȃbx;A0!0!Kbqh}0!`aN Azvlogout|!bd~,,Alb8c@\,L8;A 0}!H0}!H XA0"0"8`8KAOX0!P}N H0!PN Azsyslog|}&ܑ!L`y;,@,@!Td`8`0!pN b.0" ,AAc%8`H0"(H0"08`KqO@3<"8,Ad,@X,A$d,A0"<8`HՀAxt!T0!p|a8`} N @̀,@0"lc#H W=A,A ,AK}O,AP0"p0"8`8KOtx|0!p8`} N ̃ DH R}A:g H VA,GAdH{AT0"3 `e`cHvMA,@0"cK_Ac0"8`KO(,@Kb,AԀb,,A`0"HcDK?O0"cE8`8KMOcCH UA,@ 0"cE8`K!OHГ0|"H RA,@ 0"cE8`KOH0"cE8`8KOH4cCH R]A,@ 0#cE8`8KOHP0#8cE8`8KOgH P̀A,@$0#T0#l8`KQOH0#p0#8`K-O,0|xA| Dc$8K[O0#,Àd,AT0#,@0#c&8`H]AbĀHbē^cd8@K[%OӀ0|#HO,APd,A@T0#Ȁ,@0#8`HՀAHbHBx8cCKZO3'x0#cecHs1AcHtMA3+0#cceHs Ac3'Ht%A0#ccEHrAcHtA_bcd8@KZ OH QA8`HěK8`xt0!p|} N C zvpassPA L| N TA L| N XA L| N \A L| N `A L| N hA L| N lA L| N pA L| N tA L| N T>8 |8|+`0 @|T>0|(`|8@(|HA$0|@|8BA 8`N `N @pxxlast|!HH80`HOH0!@}N A4timerhb8N @cctrap|!0\HA`~c0d8`8K}O,cAxH}A70t@dHEA`}c0|8`8K9O,cA4H9A,@e8`H8`H8`X0!P}N Axttgwsiz8b| 80tBx|N @0le_initK @le_clean|!;tx0|8|800A|fp|T`&c8`KOXc}L0!PN Aple_inbuf|!Hxt0|(0|fp})U)`&|(,0,0@8`8KuO8`H,|f9x88@x|8`0!@N H0!@}N A le_putchar|}&a쑁!`;``}cc0KMO,c|3@(3}~K`{@3}K00cf8`KOdhcc|0!`a} N Cle_puts|!`~b8 c0c|;;|+c3 @|T>0|KiO~,A(HA K`~,,AAXc}0!PN A le_putstr%tx0| ,8A4}Ht|I@ t`|@|8H`N @` le_getchar|!0<,<@8`AK%h\}0!`N 0thHA`~c008`KO,<@Kفh0!`}H(>(@L0@<08`KEO00$8`K-O8`H 0(0@8`8K OKUh0!`}N Attgwsiz|!b80D0T8`8KO0X0h8`8KO0l0|8`8KqO8`8K1OXL}0!PN Asighup|!!Ѓ8`008KOHy 7;`WA`,WA00e@H,WzA00e@Hm,A00e@HU8`KA8`8HA8`HрA8`;8HA(;|,@$|00 8`8K1OHD@$00(8`8KOH 0,0D8`8KO8`H5A8`HFHg}8`8HA8`8H A8`8HA8`!8HA8` 8HـAKq8`HA0ahHA,AԃB܃08 cCKNO0h"8 cKNO0c8 KNO0c8 KNO,AdcE0H8`8KOc0`8`8KOc0x8`8KOc08`8KO0|HiA4A 8?cKNO?H ?c08`8K5O0|HA4Ab8?KMO0|HA4Ab8?KMO0|HрA4Ab8?KMqO0|HA4Ab8?KMMO; 3܀;|+|%*3 @0|HeA,A\`~8|+`0 @|T>|e KLA,dA8|+|*0 @K O 8|+|*0 @c;|"+c3 @|T>0}L 09`/A~~H| (/A}~Q|(~!0c8`8K}OK80!0}!8`N Asysinit|!Hb8 c,A KAH8`}0!@N A< syscleanup|}&Б! `y```008`KO0c%c8`KO00088`KqO0<0D8`KYO0H0d8`8KAO0h08`8K)O008`8KO00:8`8KO;,dA,c#08HA,AuHi,b @t$"(Г;0ēc%c8`KmOc<|KK=A,A,cz3KK!A,Az3K,@,@", ,Ac#HA"4u;`f0Гc%8`KO0}c$8KIaO,AHb8"< , A00H(, @0vH}A,@0vHiA,A$0vH~0!}8`N H]A,v,A(@lvHaAvHUAv8HiAvH9Av8HMAvHAc#HYA8`HqAvHAvHAvv0HaA,v@$0vH}с0!}8`N 8HMAc$80`KGO}0!ກ8`N vHAAvH5AvH)AvHA0vH})0!}8`N cc#cHUO7A c$80`KGOH00(c8`KIOc}0!ກN c;{KHA,A,c||3{KGA,A|3{K,@c#HŀAu;`f0,c%8`KO0~c$8KFIO,@"H"b$}"(b40!ກ8`N 8`H~A;Bā"zp8`HbA,;`AccHaA,@c|(c0@0P8`KO"$0T0`c8`KO,@8`H}ـAvcHaA`f0d0t8`KQO0~HaO,A vHc#H uHpc0x08`K O008`KO008`KOH"c#H 9u`f0c%8`KOu,@0Ā08`KO,@"Ѐ ,@ c#Hyɀ8`H|A, @40c%8`8K)O0!}8`N 8`,@D0!}8`N H_݀A,@0c#KO,Ap00`@c%Hta"0c%8`KOu;H|ـA8`H{ɀA0!}8`N (@c`"p0iH8"p0ic$8KBO,@0(c#KO,;@(04c%8`8KOH8`H^A.@,ccH^A7@8`H^A,AA8`H_ՀA`0aH@,A$ccH_A`0ac8H 8`H_A`0ac8KAOc0D8`8K OuH_YA7,AXA08HzA,@8c0LHcfc0L8`KޥOHvcfH0aH_A0X08`8KmOuH^A`08HzA,@8c0dHcfc0d8`KO0p08`KOH,@d,@8008`8KOuHzA,H$008`KݑO,@8c#H7@$c%0c8`KYOu;HyA8`HxA+A;`,vp8`@<c0c8`KOcH7AD0vcHrc0 cHX%A0c8`8KܱO8`HЈ8`,ADK?A7A4"0 cHẀAcKOcK>A8`Hxv,A u08THw]A0(0L8`K Ou3c8THw-Au038T:Hw A3Pcu8XHvAc0a8HwiA,2u8X@`0,A K0T0h8`KQO0l0|8`8K9Ou88H[ŀAT`!A008`8KO8c8H[ATe^c8H[yA,@$008`8KڹO0vHs008`KڙO,A$u`c8THuA008`8KUOc#8HgyHvA68, A00,8`8KO"c 0|4T~Hb000D8`8KO6ހupq c8THtA`f0H0X8`KٝOH&݁"`fi0\0l8`KyO0p08`KaO008`KIO08`K1O8`Ht}A(@0vp8`聁H00!}8`N ;`vp8`聁0!|} N 0!}N C @ttopen<0,@8`He @$do_open|a!00;8`KO008`KOK94,8`A| ,@d,A,~;@xHsA~bHsA~8K}A0a@HX5A,|8@U>L3A,}Fp@`Kē8`H,00AP8`8KOHO00 8`KOx0!p}8`N ,0 0 (8`A8K֩OHa,A0g@0 ,Hj=,H ,8`;AHqA~8`HUmA`f0 P0 `8`K5O0|HUmO,0 d0 |8`@08K OH0 0 8`8KOH90 0 8`KOHrAHdUH;0 0 8`8K՝Ox0!p}8`N x0!p}aN x0!p}N Attclos|!!"8`,A$, @,A0K,8`A h!D}0!`8`N 0 ,0 8`8A4HO,8`Ah!D}0!`8`N K}O3c8THoA,8@ h!D}0!`8`N 8HT̀A70 0 ,8`@ h!D0!`}8`N ?` W>cFKO0 00 L8`8KOc8HTYAcD 0 P0 `8`8KәO8T 8HnA,@ 0 d0 |8`KaO0 0 8`8?@KEO0tn8HniA,3zB@ 0 0 8`KOc8THn)A,8`,@<0 0 8`KOc8HSUA8`HHHcf0 0 8`KґOHn݀A8` HHcd0zH_0 0 8`8KUOc8THmuA,W^8@ 8`HHRA,8`A8`h0!`}!N !D\0!`N h!D}0!`N Attthang|a!4,8`A<,8`@8<, AL,8@ l;,AHwOlh0!`}8`N ,0؃@`8THl-A`{cf0 0 $8`KO,@ 0 (0 48`KбO~T0 88X;@8XHkA`~0 <0 dc8`KmOch0!`}aN X0!`N X0!`N T0!`N Attres|}&a쑁!`H7c8`A\0 h0 |8`KO;`8HPA`g~8`0 0 8`KϕOc@8H,8KuA`{0 0 8`KYOcf0 0 8`KAO,@c,c0 8`@xKOc,c0| @HeHZcHOA`~H[Ucc0 8`KO,8`@c,@Hg8`hd0!`|a} N h0!`}N Cttchkpid|}&a쑁!p`|c8`0 ;8KO,8`,AAHYcKUO`{HZ].cf0 0 ,8`KO,8`A;A`HYc8K֥A.`|HZ c0 00 <8`K}O,8`@@cec0L@THNA`{cf0 @0L8`K9O,0 T0@0aL@ @HkHNeAH0@,8@8HN%A.`f0 X0 l8`KO@X@cHP0H8@@HMA.`f0 p0 8`K̙O@@cHaHa@cHh̀A@0 0 8`K]Oa@0!|a} N }0!N 0!|a} N CHttrpid|}&Aȑ! BB";`2 r|`xyHLA`wc8/K,2@c0tcHLA,:8`Abc3sbc.8HLـA`~sc0 c8`KO,As0 ccHc~.0 cc8`KOA8c8/K,0@c 0 cf8`KʩOb0 0aHEAaA 0 0aHEՀA0 cb0HEAc0 08`KIOAt,Ah0 c#b0HE}A0 c%cf8`K Oc#cKtO,@ 0 $0 0c8`K-OHlHMYA`}c008`KO008`KO,008`A(8`T>cKO*c00;8`KOAbHW:| .||N ;H|;2Ht;KHl;nHd;H\;HT;HL;,HD;XH<;H4;H,; `H$;H;%H;KH <30 0c8`KOcXT0!P|} N L0!PN H0!PN X0!P}N C ttgspd|!bL;c,A;K|A~ X0!P}N APttpeek|a!``c8`000@KO(?,1|@@,A0D0X8`Ah0!`}8`N  bKO 0},@HqO`e3* `008`KuOA`HW:|(@|(|N 8`HXH98`HLH98`K8`H888`H(8`H8`HȀ  W,,ALA@,@8H9i008`8KO8`XT0!P|H T ,,@,008`A8KqOH98`Hp8`Hh8`H`H88`K,8`A8,8@,8`KO8`HDL8`0!PN XT0!P|} N CTtt_tnopt|!8` ,00;;A 8,/AA@,A;KIO,} ;Ap,3@d4c} }$@K%Tc>(H0c}$|Tc>(@K} ,@4c} }$KH X$}0!PN A ttflux|a! bbL,9 |#A H b,;AdK,0a@@P@K,00@@8`K O{|,AK,0a@@ @K008`KOK{,,@A8}0,0(8`8@KOHt OxHh0,0<8`KeO0@,0P8`8@ 8`H$K9Oc8T 8HB]A8`x0!p}aN Attflui8`N @ttfluo|}&A葁!p`f;D.H)A`b<@;;@0D0twcCHAA,0X0t8`@ D,0@c]@;cK=O0x08`8K%O8`HAA4~T@8008`KOcF,A8TH008`KOT008`KO008`KOT,8`@ T,@,@T,LA`pcD,@PH@A`f(c]^p00A;8`KOc008`KO8`,A0!HH#̀A,cCcAH#A,c[@;`cf0 048`KO,f4T~08A@,A;@_H `cF0H8`KIO0!|A} N Cconbgt|}&!`~`8`Kc8`H?1A0L0\8`KOT0`0l8`KO;,TAl,0p08`@XKqO8`8H>A8`8H>A8`;8H>AXp}0!PN *008`K Oc;8`H>UAT,,A;p8`8@;AcH>AH H>AX,AXXT0!P|} N Cconint|!8`008KAO8`8H=A8`8K8p8`8H=iA8`8H=YAXL}0!PN Aconnoi|}&A葁!B``;,c.8LbA,00a``m a,`cT>99:`8`@,0!PN 0,0<8`KmOH$.008`KMOc008`K1O8 @ .;2A88`H2aAucHA`f008`KO0HO,b008`A@008`8KOH%1TX0!P|8`} N KuO4h,008`;@;`8@8,d; :@`K!O8,}3@3-`d58, 0 b&0A08`KOH, $@K6#H0$|x86#@Āb&0 ,088`A$KiO0<0P8`KQO,,@<b/0T0l8`LZ AKOHH#b#H.@0p,08`8AxKO8`K: H`,8@d,/AA8,A@<,A,b#KQ6#/,AX@ (@Ԁh},A\|bT,@,@tl3Z,A`d~ 8|8@L|ADA H", 0@0uT>@H)8`H`0uH)8`HP;@,~ 8|@@b&008`@p;`db2~ 8-@-,,/@< 0T~0T>,a08`@dK-O:`HT_LA T~0T>H4$<|,TV ~|8@Aa008`ApKOb0 0(8`KO 8`,@THe`f|@T>0@0PA8`KqO 8`,@K`0T0dKIOh8,|A4bb,a@H0O440hg0|@p8`KOa0;8`8KO,da@ 0| 0T~B08`8KOH 88hAH ,a088`AbKQObHa08`K5OAH8`HKOHb#HLZ00A08`T~0:`T>|81aKO@0T?,?L@+At0-|L BA,V ~|AA}@58,KHb#XT0!P|} N Cttinl|}&A葁!`~;`,a@|8`AL,,;@A.8A /A@,A;@008`A} N |0a@,AHK,00܈@@08`K)Oa@0!|A} N , ,@̃8`@4 .$@K,H0$|@g,Tg>LA$0!|A`} N Ad|0!A|8} N H)A|cH eA`0}H yO,.8A;Hh 4 $@K `}cH0$|8g`}c008`KO,@W>@;HA,-,B@@008`@7@ ,;cAKiOcH }A;L,LsBAHVO|,W>L@A d88c0!|A} N al0!N 0!|A} N C`ttinc|!`|00$8`KO8`, A,,/8`A KفX@}0!PN 8`,A$H\IOX@}0!PN @c0(08;@Hl0~DqMaJa(qD008`KeO9 QR>MN0D8`8THqA`00c8`KOch0!`}aN h0!`}N Aconcb|!`8`HA,@8`XHKE008`8K}O84p828``p2T<4}~?~@8ě<;028`8THYAX0!P}N Aconbin|!8`00KO;,8`@|HA,00@ 8`HD8`8K}O00,8`8KaO0 8`8THAX0!P}N XD}0!PN Aconres|!HaXaX,Tc>8X8A(,@KIH0!@}N 8`KAH0!@}N Apconoc|!H`eb,8`,A@``0!@KxKAH0!@}N A\conxo|!`db8 |;8`|"+c3 @|,T>0|(A(,@`L`0!PKKAXL}0!PN Aconol|!`,A; ,A@8,@0|+`0 @|T>0|8K!HK,8`A$,A,K8`X0!P}N Aconola|!H8 88 ,89:AT8 8,@<||+`0 @|T>0|(KI0a88K=HK088`8KQAH0!@}N Aconoll|!Ā08`,@ HA,8@80040D8`K|]O8`,@T0,,A<A,,@8`KEX0!PH`dK1X0!P}N Aconchk|}&A葁!;,`}A8B,,@KI,@,8`ALx0!p}N xX}}0!paN xaD0!p}aN x0!p}8`N L@,0H0P8`A4KzOx}D80!pT>N |0aD,A@K,0X0pD@(8`KzyOxaD0!p}N ,̃bA|c0D8`8HeA,@0D8`8K0t08`AKzO8`,@`X,@0D8`8K8`H%A|c;@HՀAc008`KyO0{HO,0D@8`8HA`z.HcF@$xtaD0!p|A} N -008`Ky)O008`KyO@4,@(X|,AXxt0!pH(8`@,AcCxt0!p|A} N x0!p}N x0!p|aN CPconinc|!`f008`Kx1OX}L0!PN ALttscarr|!``c08`0KwO,8``ApH `X0!P}N Apcarrctl|!;00c8`Kw9O ,8`@@,@8,8`,AAc0<A$"<@i0tjH A`|H<@0tjHA`|c0 088`KvO,0P0\<@$0<0L8`KvqO8`Ht8`Kv]O0|(@0 ( (:@(:@0a8AX0!P}8`N KwIA,0a8?;A4H ]A|1\0||0|0|H0H A|1\0||0|0|00ccd}1cUc8|k|k|l0|00T8|`|0k|00T8|`|0k|  0T8|`|0k|  0T8|`|0k| 1`U`8| | 0c|04aCX0!P}N A$ cmdate2tm|!b ,8a!A0;A(3 |@0@|0@A0|@A(A$H yA`~c}0!H; ?F3z,3:cc;H aA`~0z,88|+`0 @}U>0}(8c1Z,88@ <19`9 h3+|H,/ @8|P8A,@ 0|Pg0|PgH|/ 8A08@D|PA,@ 0|PgHD|P@ 0|PgH(|P8A,@ 0|Pg0/@ @h3+|H,K(,}A,@ <0`H Ac}0!N AL ckxfprintf|A!a8, `kad!A0;@$`H mAt}0!N ;` ?3,c3^H Aa0~,;`88|+`0 @|T>0|(0,0 9@ =1(9@9` 3{+|8, / @8}(9A,@ 0}(H0}(HH|/ 9A09@D}(A,@ 0}(HD}(@ h0}(H(}(9A,@ 0}(0/@ @3{+|8, K(, |8A,@ <0`H A0!}AN A, ckxprintf|!`K1O`fc,0`0 @0$KuXL}0!PN AX ckxperror C0>A.?tzG{ |h@!HAHA8!8|mx|#x!HA8!8}kx}sx# CH,|`| |#x@8`N A L| N A L| N A L| N hpx#Ccʃʣ#Cc˃ˣN A L| N A L| N A L| N ȐA L| N ԐA L| N ؐA L| N A L| N 0A L| N @A L| N DA L| N HA L| N LA L| N PA L| N TA L| N XA L| N \A L| N |a!``~},`,/A4A@,$=3,90<08cA,xdh}0!p8`N 88H8ـA,8bpA8KO`e1,a8`KbO8`xHp(8`0PA`0pKaO0t08`8KaO<008`KaO@008`KaO8`H<@||@ch8`08A}DHcc0D88H8A,dhAHKO`e1a8`KaO<@8`xHdD0048`K`ODH8`H00\K`O!<d@&h8`Hx0!p}aN A` ck_linger|a!`~}`,,/A4A@,$=3,90@0t.H0tbH,At.@0txbKO,@18q.@\00`@bKeO0b8`KUO|0!8`} N 0Ā08`KUUO&008`KU=O,AH&U>|@@A000D8`8KUO|KMA80H0\8`KTO,@|2tbi8;889|0`0x8`KTO~ ,A$H+At 0|H 0| 08`8KT9O8`88H+UA,|@40tKyO008`KSO8`H008`8KSO|<08088H*mA`f00 8`KSO0tT>KO|bd8H*A,@T|K鹿A8&000Hc8`KSO8`H$0L0`8`8KRO0tdK O|8H*QA,@T|KA8&0t0c8`KRO8`H008`8KRiO&T>HT>0tKaO.9PL@ PHLc00 8`KQOA83T| 8 c88899 9@9`98`||*0c B8`T}?@.~2|Kx|A.c0LH)!A,<9`a @U(}@.~I2}(@9A9`, T~28`@,}?@.0T|Kx0L|A.88K,@|00H(ɀA,bs@L|K=A8&0 0 c8`KPO8`H<08088H'UA}K0 $0 <8`KPmO~dK0 @0 X8`hKPEOKe0 \0 p8`KP!Ox|h|@8, AH[O,@`KQO,@P|KـA8&0 0 c8`KOUO8`H\c0 0 8`KO1O,@t H%A3 `ecc#HUA,,A@ 0t KO0 HA0t 88HA,tA 0 0 8`8KNO;*,@ 0t KO0~ HɕA0w; 8N;KO0 |+c3 @}U>0|; PbHYO|+c3 @}U>0|@ PbbH!O,@x,@h0t bKO,HL,@80t $KO,H(@$0t 0KuO,H ,A,@bc$8OKO; 0 88`|+``0c @}U>0|@; PbH1O|+c3 @}U>0|@ |w0 8cc8889AIP|HA70 0 8`A8KIO0aDA H9O0 Ѐ0 8`KIO0 0 0D8`KIyO 0 0 8`KIaO0aD88HƅA7A00 $0 H8`8KI-Occ8KO0|:cc; @d;;|+c3 @}U>0|8#|"+c3 @}U>0|@|HO0 Lce8`8KHOtxcc|0!p!} N C4ckgetfqhostname|}&!@`:`o:@p`;b.0 X0 hLPA@8`KGO8`@lH"a8db#KeO0 lb%8`8KGO/;( *@4abdb8K!Ā0!|} N b=], (:A8A8cI3, (:AAI3, (:K(:@0 b%8`8KFO=( :2@2=(/@0b I2( /@ I2( /K;` a;|+c3 @}AUJ>1)}*H1)}WH( /@~I0 b%8`8KFQO0 b8`8KF9O0 b#HA,@$0v b$8d8KO,@Wb. bb(@A8A8bI2, (@AAI2, (@K(@@0 0 8`8KEO:37, (:A8A8cJ*3Z, (:AA*3Z, (:K(:@ 3Z0 c8`8c=KEOcE0 8`8KEObc8@KOHc0 1I})X}JX~H cb0K%OH0 cHQA,Ac0 b%8`H0ab$8OKOb<c;0a8OKOb#08dKO0 08`8KBO0 08`8KBOa|+c3 @}AUK>1I})X}JX~H cb0KAO0 b%8`8KBOH2 0 b%8`8KBaO0 b8`8KBIOwKA,A$bKATi>3!h!p.H܁"), A0 0L0Pb#bH,AL3V };` HAb9`e;cDb#H Aa|+c3 @}AUJ>})P~H0 bHՀA=3!haL!pKALPH0 bH-A`y.@0v $bKO,@3!h9 q.9H,0v ,bKO,@3!h9 .9@\"b0 40i@K}O0 T0 p8`K@OĀȒ|0!8`} N 83b8OcKOOc0 t8`8K@MO8, @̈wKA,@d0v bKO,9 @81!|8H0v bKO,@X1!|88HlHX9. , P,/ qAA4A(A1!|88H,9 8HH 9 81!|888;@9|0 0 8`K?IOb#HIA;``i~ @0 b%a&8`K?O@́"Ё), @ 0v ăKO0 H!Ab#HA7A0 0 8`8;K>O?0a!}? H%O?0 08`K>}O0008`K>eO 040<8`K>MO.@X0L0x8`8K>-Ob#H-A`;0|}@0c8`K=OAț}9a!~HA3`ecbH!A0b8`8K=O., @04,A$0vbKӡO0 HA8`88HA,;|A,AP08`8K=O~HAa|08HEA,AX|0|8HA,;A9U)>,6(, q@$8, A,X= |0@H$@8, @X= |0@088H!A"idKhK}x|KU1)})P; PaHaO|z+c3 @}AUJ>1)})P PabH)O., @?. Ax"),@hc0vbKϵO., HH., @P0v4KϑO., H$., @,0v@KmO., @"0i HeAa3HH1A`ebcHeAHDiO,@,KO,@8`ȁ0!HXH|c0P0h8`K8O0vlK O8`H |K݀A|080Lc8`K8eO8`H0vKO008`K89O8`H"b%00i@KO008`K7OĀȒ|0!8`} N XK\(0L0\8`K7O0`a8`8K7O3, @S8`ȁ0!|} N ȁ0!|} N Cnetopen|ؐ!bp0t0|8`K7O;,;8`;@Ap0,"@,[p8`;A08HO_H6O~KA`008`8K6qOpcx0!p}N x0!p}AN x0!p|N A netclos8`N @nettchk|!Hp8`008K5OKEOb8K OH0!@}N APnettoutN @ failnetinc|!H4b8`,p0@008K5 O8`HP@HH0!@}N 088`@(HU,,A0|0d8`A`H0!@}N Anetxin8`N @netinc|!Hp8`008K4AOH8`}0!@N A<nettol|!HTc>KOH0!@}N A(nettoc|!HKOH0!@}N A$netgetc|a!b8,8`,@P@KO,3;;A hP}0!`8`N ؃bp8`KO,Tc>@<HaO,,@ H @K}O`|4|3@8`h0!`HKUO7pc8`0@h0K2}O,38`ALK9O,c38`A0,A(KO,c38`A ,K8`h0!`}aN 0!`N Anetflui|!9 0a@!<8889|<3P| .p, })8`8;9 9@9`9;@; T|*3 B||*HA`,p9 8`AaR!Q0}H9AaTc0P8H]A,c0<0@@tHeAcKEA!DaD, 3,AHHA`eccHA00c8`8K0O8`0!HDh0ahHA,ccATcc3TaDHeA`eccHA0Xc8`8K0%O8`H8`0!}N Agetlocalipaddr|!Hb<88`,8,@h888@X89:0a8KO,8`A$p8`0|08K/eO8`H0!@}N 0!@N Anetbreak|}&!đ!``:```:`T8`KmA`q.:`:@@$ 0! |!8`} N 8 |:8|+`0 @|T>00|8|+`0 @|T>0|80|8|+`0 @|T>0|8|00(A<pc00accH]A3\0ac88!8HqA`, A`43hab3]AtccDc08HAcDc0a\08H5A,00|@A,3@AxcDc0a\08,3{]AccD0a\08HрA,||@A(0@A1`|@A }>G1 Q*@.A,!@G'QI@.A/ 'G 0 Q*@.@L1A$@0|@A 3P@.A@ & ccD0a\P@.A|08HA,S@.}@AP8`AHKA6c0aT0AD3 KpOT,3A|Hb/@buHP,AD|HA(A$`/,A |HKܐgH}@43{AAccD0a\K8,Atb3}HiA7,A;9@@VG 6|ư.}1:,b#888A9|c 3||P.03A `V 6HA`q.AVG 6W:|P.b#,}1:88AHc89|3 |0|P.3Kx,@,A@ubKuAbcKaA,:`AubK,AbcK5A,@Ab#KA8`H7X8` 0! |!} N Clocate_srv_dnslA L| N tA L| N A L| N A L| N A L| N A L| N A L| N A L| N A L| N |!8`0 0 8K'O8`KAA,@K7O`,,@b@,@HX0!P}N Awinchh|!8ɀb|8`,`fcA 1$0 0 1 ,,0//A@,A@@/0A `@,/,/1F0lL+@A85`UD8| T8| ,@A@c@:`, A HHQ`y3c&0 \0 l8`*K"O,AhW:|(.|(|N 0t KO0t ,AH88`H0t pKO0t ,AH88`H@x0t ,AH8ic#H,ALHD,A4H, 0}) HH 0|{) K`yKO,`0@` ,/,/@(@@@KUO,@ /@ 0t ,AH78`HȀ,,@( ,@0t ,;@K]O ( |00 @t |0 ,A@0t 4AH78`H<0t KO0t @,AH68`H0t TAH68`0!|} N 0!}aN C,tn_wait|!䀼 c,0| h;<;A K)O cK.O X }0!P8`N Altn_push|}&A葁!<`{`,8`@8(+/@+A@@./0/,A@/-A@@-@lA /0AcET8|0H4//,0O\˂@0lA85T8|0T8|0 8`,@/@lA /0AcET8|0H4//,0O\˂@0lA85T8|0T8|08`,@/@lA /0AcET8|0H4//,0O\˂@0lA85T8|0T8|0 8`,@/@lA /0AcET8|0H4//,0O\˂@0lA85T8|0T8|0 8`,@@/%8@h쀥,AA /0@//,A@@A /0AcET:0H4//,0O\˂@0lA85T:0|8}0+1(@@̀,@쀥/A0 pA (@ +@(,0T:@ 0 H|(.H0 A ,0@/,/A@@XA ,0AcFT:|0.H0&(|+3 |*39 @H,/b,,38A/.Ab38APb38@|+c3 @|T>00|+39 |*3 @H|+c3 @|T>00|+39 |*3 @Hpb38Ab38Ac0H Acb|+c3 @|T>00|+39 |*3 @3{Ah; 3b|+c3 @|T>00|+3 |*3 @HX|+c3 @|T>00|+39 |*3 @Kp|+c3 @|T>00|+39 |*3 @K0;@|+c3 @|T>00|+39 |*3 @K0A ,0@/,/A@@XA ,0AbT:|(.H@`,A HH=Q`-c-0(.088`KUOAX,ADA$@xz,,Ad|H`,,AHHD,A8H8v ,0 H A< 0|y! H,A KnqO,@ ,Axt0!p|8`} N C tn_flui|}&A葁!ȃbĉ O`,,/AB8`0,@0<8`(A :bKq,8`A @008`8KOF,@pD8`(A`8K%4:@0008`KOx0!p}8`N H00 8`8KOG,@pE8`(A`8KЭ4:@00008`K]Ox0!p}8`N I040L8`8K)O,@08`(A 8K5,:8`A̚,@08`(A 8K,:8`A ,A<,@0 8`+A 8Kϵ,:8`AL8,A<,@08`+A 8#Km,:8`A,@08`(A 8'K5,:8`A̚,@08`(A 8'K,:8`A-3y33233Y ;0(/'0@A,0(+LA//,#O^ӂH(@//,#O^ӂL3Ax./0,/A@A@@TA ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T8|0,@A ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T8|0(Atc8`Ḱ,8`AA ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T81:A ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T8|0,@A ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T8|0(Atc8`KY,8`AA ,0AcT8|@T8H4,/0L˂@@ 0lH85T8|@T81:3-A0(/'0K ,A40vPK,@ K18`xt0!p|H(:Kꑀ,A8`xt0!pH O,@0 M8`(A 8/KU,:8`A Q N,@0 L8`(A 8/K,:8`A P,A00v\K%,@ Ke8`xt0!p|H\KKE90x08`KyO008`KaO8`xt0!p|} N x0!p}N x0!p|N x0!p}N C tn_ini|!`~c08`KO,,@cA KlOX0!P}N Aptn_debug|!7<8/8`,@t/ @l8`Ad,9A`/|"9!9;<?@,AH0cHcAcc08`KOc,AK!0a88KK=O,8`@ h0!`}H 898/:8=88;<>@,A( "W:c} @A\L} @}N 0HD0H80H,0H 0H0H0 HbuAcc0@8`KOc,AK0a88KJ!O,8`A8`h0!`}N X0!`N PX0!`N Atn_siks|}&!``~"x`8`;0D@0XbD8BHK-Oax9:c+8`HbQAT`>`,b-T`>A|n,2.A`,c@ KiO@ 9Ac,H9H@@,@c+8`Kx.00a8`KmO@Tc008`KMO,A 0q KQ0!|8`} N bc,@b̀c,Al83L0a |B,@$2P!a:`H 0P( :`A |bW:tN ,/,!@3X,&H$@3`,&H3d,&@:`( W:@L,.,.:`AXA,,A@\3p,%HP3hH@,A@43,%H(3H3|H 3,%@ b`(2sW:@bP|8.H0n( Ug:@bT}+8.,H 11,!0A L`( T:|8A 4|c8|hN ,2P@0qaH @0q̐aH ,,2P,A0A0qaH 0qܐaH 0qԐaH ,2P@0qaH 0qaH ,,.A0AH,A$@ @0q$a2PH d0qa2PH H,A$@ 0q a2PH 0q0a2PH /,,.LLZADA$@ 0q8a2PH 0qDa2PH 0qPa2PH ,,A$@ <0qXa2PH `0q`a2PH D,,A$@0qpa2PH 0qa2PH,@0qa2PH,@0qa2PH,@l0qa2PH,&,!..AhA,%A@2P,0qa@3aPT;@ T :T:2s|X.b|8.cc~bH[AA|+c#39 @|T>0c|gA|+3 |*0c @AH!aH02P!aH,/AHA$0ؐ2P!aH\02P!aH<0А2P!aH2P,0Ȑ@30a,bL2sW:.@!aH,&,!.'AlA,%A@,3nP( U:.T:`W:}'.T:!A|c|hN , 2P@0qaH$0qaH, 2P@0qaH0q,aH, 2P@0q4aH0qDaH/ ,, . LLZADA$@<0qLa2PH`0qXa2PHD0qda2PH(/ ,, . LLZADA$@0qpa2PH0q|a2PH0qa2PH,, A$@`0qa2PH0qa2PHh,, A$@0qa2PH<0qa2PH , @0qȐa2PH, @0qؐa2PH, @0qܐa2PH02P!aH,/A(@02P!aHh02P!aHH0qanLTc:.n,,.:`AAP,A(@11!2Pa:`H11!2Pa:`H,A(@11!2Pa:`H11 !2Pa:`Hx11!2Pa:`HX/!,%,&./ApALA(@082P!aH0L2P!aH0D2P!aH0,2P!aH,&,/A(@40T2P!aH0X2P!aHh,&@0\2P!aH@,&@0l2P!aH,&@0x2P!aH,&,/A(@l02P!aH02P!aH,/@$02P!aHx2P!aH`2P!aHD2PaH,!aH2P!a,0,0/.A@,A@@HA ,0@,,,.0LD @0lA85`W:|X.H0,A1,H1,A1Q ,H1Q,A0P TH0P T,A0X$\H0 X$\,A0$`(dH0(`(d,A0,t,pH00t,p,A04l0hH08l0h,A0<|4H0@|4Ј,A2D8,H2H8,A3L!<,H3P!<,A3qT@,H3qX@,A1\D,H1`D,A1dAH,H1hAH,A3laL,H3paL,A3tTc@H3xTc@XPD\a8H`<LdbPt;Tp~Xll\hp`|tdГ!xha|AaHOyA@|nb3C; 2s( c~b~(Acc,0A,,cc0|0;@0HOAH0;@0HNA|+c3 @|T>0c|c8|+3 |*0c @AT,@L8 3b||+`g0c @|aTc>0|g||+3 |*0c @,,@P8 3b||+`g0c @|aTc>0|g||+3 |*0c @H@8 3b||+`g0c @|aTc>0|g||+3 |*0c @H,,A@@0\08`8K5O9,A 0qK5.K.9K8 3b||+`g0c @|aTc>0|g||+3 |*0c @0b8`8KѥO,A bK穀ax8`0!|} N 0!|} N C0tn_sb|}&ܑ!@Tx>(``A@c8`000KOȃ}0!8`aN <8`,@0"8,,L@0ckHLՀA,;@(ck8`HLA,@ck8`K,@0!}8`N T}>*`z((A@tApcc04HKaA0Pcc8`KO,A cKȁ0!|8`} N ,@(8`0T0x;8KωOD,A,H,c@cKOWC>KO@$ȁ0!|8`} N -@P,@(3,Ab0H̃b0A (@ (@,,3W:@0cH|@.H 03cHIA0cc8`KuO,A cKy( A W:|0|0|N ȁ0!|8`} N KKKKKKKKK80fK1)OKKKKck8`HJ A,@$ȁ0!|8`} N Tw>,A Hb,c@ KOB,@̀,AA "0A (@ (@,,0T:@0,H|0.H0,,0./A@,A@@XA ,0AbT:|0.H<,,/0LD @0lA85T:|0.H0c#HGрA0c$b8`KYO,A c#K],,.A"AP,A@, ,0/,A@,A@@hA ,0AbT8|@H4,,/0L @0lA85T8|@T8|0,@b8`K,8`A+pA ,0AbT8|@H4,,/0L @0lA85T8|@T8|@ ,A+A ,0@,,,/0L@+@0lA85`V8|0T8|@ H*A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0,@A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0 8`,@bK9,8`A)A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0 ,A\A ,0AbT8|@T8H4,,/0LD @0lA85T8|@T8|0 A ,0AbT8|@T8H4,,/0LD @0lA85T8|@T8,|0;,'8`AA,A@(,A(A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0 ,ALA ,0@,,,/0L@+@0lA85`V8|0T8|0 8`H'.0,,AbT8H$/0L @0lA85T8|@T8|0,@'A bH(,,/0L @0lA85T8|@T8|0,@'XA bH(,,/0LD @0lA85T8|@T8|08`(A'bKI,8`A&@,,,/0LD @0lA85`V8|0T8|0H&,/A@&A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|08`,@&@KA ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0,@%A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|08`,A%xbK,8`A%hA ,0@,/,,0LX @0lA85`V8|0T8|0H%0aP08H@uA0P8`'88K]H$888KIH$A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|0 ,A$tA ,0@,,,/0L@+@0lA85`V8|0T8|0 H$(ce0bKݹ,,0@$/,A@0,A@$A @0fKaOH#A ,0AbT8|@bH4,,/0L @0lA85T8|@bT8|,@4A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|,@ԃ@0|8XK}O,A"A ,0AbT8|@T8H4,,/0L @0lA85T8|@T8|,AxA ,0AbT8|@T8H4,,/0LD @0lA85T8|@T8|A ,0AbT8|@T8H4,,/0LD @0lA85T8|@T8|90XA ,0@,,/A@@XA ,0AbT:|0.H<,,/0LD @0lA85T:|0.H0cH0|0~`,A4A8`|+``0c @|T>0|00~s,A4A8`|+``0c @|T>0|00~sA4A8`|+``0c @|T>0|00 ~sA4A8`|+``0c @|T>0|00 ~sA$A8`|+``0c @|T>0|00 ~sH000aTKDO,@D,A8A8`|r+``0c @|T>0|00~sH080aTKD1O,,OFBA8A8`|+``0c @|T>0|00~sHD0<0aTKCO,,OFBA8A8`|+``0c @|T>0|00~sH0D0aTKCO,LBA8A8`|+``0c @|T>0|00 ~sH0L0aTKC9O,LBA8A8`|+``0c @|T>0|00 ~sHP0X0aTKBO,LBA4A8`|+``0c @|T>0|00 ~sT|; (,@:2xHD:A4:2xH,`x@,@||ɮ392xA|߰0,,K0sKՀA6@t008`8K-O,A 0qK108`'88K],8`A0!|8`} N 8,T:8A800 0 02t2343 2ȃb; ;@ȍ',, / AAH,AL@008`8K)O,A 0qK-8`H,A@L,,/AA șTH(OZ1A0T}1T,@,Ax}|s2Q8|+|*0 @W|y8|r+|*0 @8`|r+``0c @|T>0|00~,A|}~S0q$8|+|*0 @F|w8|+|*0 @8`|+``0c @|T>0|00~,Ax}~S0q(8|+|*0 @W|8`|+|%*0c @8`|+``0c @|T>0|00~,Ax}~S0q08|+|*0 @V|x8|+|*0 @8`|+``0c @|T>0|00 ~,A}~S0q88|+|*0 @F8|f|+|*0 @8`|+``0c @|T>0|00 ~,A,}~S0qD8|+|*0 @V|8`|+|%*0c @8`|+``0c @|T>0|00 ~H0L`K=mO,@,A|}~S0qT8|+|*0 @W|8`|r+|%*0c @8`|r+``0c @|T>0|00~H0\0aTK0|00~Hx0d0aTK<1O,@,A|}~S0ql8|+|*0 @W|8`|+|%*0c @8`|+``0c @|T>0|00~H0t0aTK;O,@,A|}~S0q|8|+|*0 @V|8`|+|%*0c @8`|+``0c @|T>0|00 ~H@00aTK:O,@,A}~S0q8|+|*0 @F8`||+|%*0c @8`|+``0c @|T>0|00 ~H00aTK:UO,@,Ax}~S0q8|+|*0 @V|8`|+|%*0c @8`|+``0c @|T>0|00 ~șT8(,@80H08A 80H0T}'100xAȍ',K(bb8`'8Kw,@$bKA8`0!H bKA8`0!|} N D0!N 0!|} N CHtn_snenv|}&ԑ!<;8,;8`@,ȈF@,@xBA쀵",::;;`;A808`8KAO,A,7d;.H$0008`8K O,.;@0y4K'݀A7c8 A4|8|+`0 @|T>0|,A3y<{3,A83@ H EA,{A H UA{,@Ѐc,,@ATᮃ`0Dc0HqAc0d8`8KOc,AK~3c0KO,8`A8`xt0!p|} N `h0!pN PD0!pN C Xtn_sttyp|ؐ!<;8,@8`@,Ȉ@x,B@8Ap,`; :;#;@0b0h,@3a@ccHA0p8`8KO:,/;A003,A3,Kc@ ,ATᮃ0c0HuAc08`8KOc,AK:3cC0KO,8`A8`x0!p}N d0!pN PH0!pN A  tn_sxdisploc|!8`@,98A$8,c88@ 1H1<,;9`A(}iHAIH0, BA}!`0|!0KO,8`Ax,񮀝@ ,AT\0c0HAc08`8KIOc,AKM8`X0!P}N @0!PN A` tn_sndloc|a!<,A8`0!`N 8ȁ',, /8`@,At'@8@@8|H@APb@|Fp;;(889@,[8@ [8|9};81(|Fp9 @ }[A1}{Aa}{80+ ~,@ }[90|9}{81+ @ }[A1}[A0};93@AH0cHՀAc08`8KaOc,AKecccKO,8`A8`h0!`}aN 0!`N Atn_snawsc,AL8A/Ȉ@ ,@(Tc~,,@A `N /e,m/o,sAAxAN x|dN `cN |hN @doparb|,M  b$8Bb8@|&(008`deBN @trttinit|ؐ!|`,@H8`0!pN ,W:,@H8`0!pN /,@"8.a(Axc0@ 0H8?T:}8.0@ 0H8?T:,,|8.O@#A$c008`K{OH8`K{O00c8`KzOx0!p}8`N 8.x`@ 1H9?U:|@.,,c00O@#A(008`Kz}O,H48`8Kz]Ox0!p}8`N ,^Bb 9 @aI,_9`@aK,1e"@9H}H,00a8`9 @ '9|B},a}+H|8} B} @KyuO,A8M|*|(|p|00 8`Ky9O<b003M8`KyO;, , <y}IH}*H})X}?H})6pU*})P/@00|p})@ |(H0@|(0 0,8`A$"),@|8,H@",)1F,OF AVaF|8,H|8,@ `|@@@4aH(@$U8|8|8|8@ `KwO8`x0!p}N A 4getrtt|}&!bx"000@: 8`KwO9 !p"0D0T8`Kw]O"0X0h8`KwAO"0l0|8`Kw%O"0̀08`KvO= UU1)UV܂B!x"BK}O,A"i.@d"), A0/. @t0T:H.08`KvuO-0U):|H.08`KvUO,A,"W8)}_PU_:1)}).~ 0A8HC`q,e@H33b&cc8`KuOHCQ`q,e@b&cc8`K؁".D), AD@$"08`8'KuOH "0(b&8`Ku}O.z,,AXAAHsO5.Q, ,TNRLB3BAA70s1)7: EH,.E,Q,TA0@7V1)79 !t1*6"oI-1J}iX}i6p})U)02X"0I0c8`KtO|A33ccc8`Kt}OW:}..c, 00(8`@8KtUO}2., U*8})PU*:A01)})P.. A1]}I6p})U)02P|ccc8`@|!t, @$0D0X8`KsOmH%,AlK/,@4b), @$0 0 8`8KsOKO@"I, Ap"ȁ)}JKx"Hp0s\: EH+-.EK9 0,0@c8`!tKs)OcH%K$@ " ), A" $.@́"B܁)j1I"I"1KI008`KrO008`KrOKMO,AADmH$e,@: E008`.EKrYO0sH*)KHlO" 9@8`qIHB " 9`j9@I0p08`KrO8`qHd-|HA0048`KqO808U):H.0Lc8`KqO,APxHkO`00c8`.KqyO,@(5. @ xH$yxHk!OK@xHk O5, @"<). A0mH",@D0s: EH(.E/,K"}JXI?.EK,AP"ā). D@@00 8`KnEO": Y00(8`Kn%O-8!p, @܁/. @Mb0UI:}kH., @ T5. A"ā), DA H;-`q".e0tHtKBO,: Y@: z0X0pH0K=O" )1)|H@ H:`q0X0pb&8`KmUO".e0tb&8`Km5O@H33b&cc8`KmOH:m`q,e@b&cc8`K.z,A (A A @HkEO5.Q, ,TNRLB3BAA70s1)7: EH$q.E,Q,TA@LW6m1J1)W6H,@0s@: EH$).E/,K@"܁v)1I"0TI1+60t8`KlO0x08`KkOmH,Ax-U):}2H.. AU+8P})XU):1j}kH.1) , D@}*H.1)}&p.@9 48008`KkiOK"t008`KkIO0sH#8`EH 9 .Yx-N!pHeaO`-008`KjO008`KjO00,c8`KjO,@@"). @ 9 6800U*:"0P.})P.0@1i"0c}iQ.8`KjiO,AW8}_H0U^:1)|.0D.D0X8`Kj1O@9|H@0\0h8`KjO"), A`P1>|H.0l0|8`KiO03 |.008`KiO"008`KiOP1>}jH.1> , @D}JH.90~H@0:|H@ 9a&008`KiAO"), A8008`KiO"80̀08`KhO" ), Ad"8Z)~ PAP"), @@6, @40|008`KhO4~ 0H", @X9t1I~ P}+H@DAx0}*HU*})P|X08`Kh9O4~ 0Ht/. 1)},J} NBA`Y1&| H~ 0}*0L@AHAx0}*HU*})P|X08`KgO4~ 0H ~ 0@00,8`KgO"), A$"|). A"iKMxHaOxH^ OMUI:|PA0T0h8`KgOKHb09}I.1J.E}I6p})U)02|P000P8`KfOK@l/, @`61)0l608`KfOxH`eOmH,@0s: EHQ.E/,K008`KfQOxH`OKt@TU6, 1)6@(008`Kf OxTi:}2H., AdU*8p})PU):1K}JH.1) . D@@}+H.1)}&p,@9 4800 8`KeOxH_aO,@0 0 $8`8KeqOxTi:}RH., A$UI8p}*HU):1K}*H.. @mHQ,H HE,@T0s (: EH.E/,KL"L)1I}I6p})U)02})P~H@/, @D0 <0 \8`KdOmH,@0s `: EHy.E/,K0 t0 8`Kd}O8, 1I@9@?, @("ā). S, IA@8`H]Kp9 X!pK`@\: E0 0 8`.EKd O0s HK@0s: EH.EK,8M| P@0 0 b&8`.EKcOK"0 0<8`KcOK0sHm: E.E008`KcuO008`Kc]OL008`KcAOHaOKt"), AT"ā),@D" .), A0@08`H 08`8q8KM}OH.A H]IO8`qH$: E" `9@I.E0sHyK: Yb09}I..E1j}i6p})U)02}iXm0,0T|P8`KbUOKB9`jb9@IH" 9@0I08`8KbO8`qHp9@"ȁ)}JKx"ȑI0 0 8`KaO0 0 8`KaO0 $0 .0 @0 L8`Ka)Oc0 P0 `8`KaO8`T~|@@A^>~|Sx|Kx|[xT1|P8}'888`A}g88T0(UG~U(~8`mAl} Ud~|`@@,|8|0@@ |@8`e 0@@| |0@A4A,|8| 0@A |@8`o|0@A| | @@8`XT0!P|} N C<parchk|}&A葁!ԃx``~0 d0 x8`K_Oc,0 |0 8`@d8`K_Oc0 B0 8`K_O,cb@<0 0 8`K_eO0 0 8`K_MOKO,0th@=ff,3fg||p@T@|@}8}pZ;U |}P|8@a:~cF0 0 8`K^O@L|}8}pU }H,0 0 @9|@|8`@`cK^uOchd0!`|A} N h0!`}N h0!`|AN Cchktimo|}&!pD"`r`,``||VS>TAx*Db8`0 0 K]OA40 8``K]uO0 bb8`K]]O0 0 $b8`K]EO0 (0 4b8`K]-O, ; 8| 0,^A8.3;;`A;`V:.Alx-c8`0 80 HK\O0 L0 `c8`K\O@4Ԁ,@$0 d0 b8`K\mOH-A8W8|T:| | | d<T|ٮ0 ^;`|Ah8_|"0 8 |0 ||(||(T׾| T0 ;`H 0",|A8,0|0A(0,3{0@H` ٮ,,./AA`A@80~0H|`6pTTd0!|ٮc`3{0!|ٮ3`x,|ٮ2@t,A8/A$,@t/Ad( @XȈ/A(.,H$.,/LƑORBA(A8 |2@(8`s,AcfbcH9ep,,eAP/m,o.sAA\A @40|"|@0A |0| T~B̀d,A KO,A ,@bKO`|,A܀|(N,@@@,K!O,0A8?T:|e!.HKO||.A W8|T:| ,@$,AKyO,A$0 0 bf8`;KXOHcKO`|,@x0 0 8`KXYO0 0 c8`KXAO,@,,L#BAdĀ,@, ,A0 8`88KBO \ $HRYO0 8KiOcH0|"|@0A|0| | hBK0|"|@0A|0| `BK0|"|@0A|0| | BK|2K0~0HMT`>0 |ٮT`־00 |!T`00 |!3{K0~0H|`6pT0 |ٮT`00 |!3{K0~0H0 |ٮ3{K8|@,AlK O(1!2H O3 3 `fcc8`KVO,ĀgH ,Āg`0؀|(|(A$HQ}O0 cb8`KUO,Ap 8(D/.A8(YL2NRAA8,A0Ā,LZ3BAbdbc8`K?O}|0!} N "C spack|!40x0c8@,0|0AT׾|fT0 00 8c8`KTyOXc}L0!PN Axchk1|!400x8`@,0|fAT>0 <0 Dc8`KSOXc}L0!PN Apchk2|!40x9@@@0,f}KFp|eRxTT|g.|(.0|c*x}jxAU_>0 H0 Pc8`KS=OXc}L0!PN Achk3|A!xL̀0 T0 d8`KRO0 h0 x8`KROb1}6p|T02D@cF0 |0 8`KROcC,@hHLO`}c0 0 8`KRIO,8`@@cCHE5O40 0 8`@KRO8`hH_8`h0!`}AN Anxtpktb̀xc0 H\ @ack|}&!䑁!bx̀Ѓ0 ;W:8.;@c0 8`KQYOcHHOcHDEO`y.c@0 0 8`KQOc0 8`Y8K4[0 0 AT8`KPO,cA HIOc#A HGO8`0|6p|T02|8hd0!`|!} N C$fastack|}&!䑁!``xcc; 0 ;`8`KP%OW:G@.0 cF0 (8`KPOcHFOcHBO`y.c@0 ,0 @8`KOOc8`Y|+cg3{ @}cU>0|8K,0 DA|0 P8`KOmOc0 T0 \8`KOUO,|8@@cCA HGeOc#A HEO1}6p|T02|@8`hd0!`|!} N Cacknsx0 `K\ @ ackn|!78`8@x3 dHx0 hcKNaOcKX0!P}N Adack1|!7,?Axc0 @8xc8`0 p0 KMOX0!P}8`N 0 8`KMOW:}.c,@8H@O,c0 0 8`@KMuO8`HX}.U 8b}H#U:} |cH"t1HC)c|H8`0 8A 8`NKX0!P}N A nack|ؐ!`x"xBc0 W:0 8`KLOcHFO7@./@,/,L3BA(@/?@b@,A 88 |8|+`0 @}U>0|8cf8`Y8K,A`c0 8`#8H+%H c0 8`Y8K,A<(,0A@Ā,@0 ,A L0 Ԁ8`8%K5O8`Hc0 08`hKKO00c8`KKOx0!p}8`N c00,8`KJOW8|T:|Gt}@1*(|8@$ȁ'8`}KxH00|8088`KJYOHF!O|8, @8`,AcK?, 1A@Ā,@0 ,A L0<8`8%K4iO|8gH@,AKUO|,@KiO|.|8g KO`,A@KO(:!2H O3H3\`fcc8`KIOc0`0t8`KHO,0A@Ā,@0 ,A L0x8`8%K3EOc|8 8`SH'|8gxh0!p}N xh0!p}N "Aresend|K!P`qx Ԁ :@L:bXF 0b%D 08`b \8" |KGOB,ԃЀA(b%,08`8A KeO ,,A0 8` @ ,b&88A K1Ob#HO8`EK `vob$8KOwH{Oy" H%O,wX/Ay"|fi,@ ȀA /A,AA008`KF]O,A8 ,,@ 08`8A8K0O,ă"|bA ˽"KOyA(=*H Owy,8`2A KOH`},T/z,LӂA@A4W>/@$0,8`AK/O,@X,,A8 @,,08`8A8K/OH,cc_@ |3x0!}KM{"Alerrpkt|!T>`HAO,8`A$bLXbDcKQXL}0!PN A`scmd|}&!p: D ,xx7b2b:b<@0萷00b&8`KCO0!}8`N bKA08`Hd000@b&8`KCiOx,A䀿4eH130 ;` ab#3c-KCO*@vHO`~bc$c8`KBO,c0t8`@|b=bb&0d8`ADKBO-%HpA KAcKA,4e@0D48`HDcKBQO|8|(v^KAb|(@@KiA-H`-AAab#K8`,@KAA`v-8`A|K%A,v3;Aa0|+|*3 @a;8`|+c3 @}U>0c|8KA9O6AaKxb0b&8`KAO008`K@O,0@$K,@0Ԑ8`HL00*@8`K@OcE8`OKy`00c8`K@eO,@00(04HA: b?0(04c8`K@%Oc0!|} N C$sopkt|ؐ!p `wx``;080L8`K?Ob 0P0`b8`K?O0d0tc8`K?yO0x0c&8`K?aOB 008`K?EO 008`K?)O 08`8K? O,@ 0,,@,0Đ008`8K>O8`HAH,;8`AKA7@,000(8`8K>iO8`H@0aH0,KA;` 3Ja; |+c'39 @}U>0|81 I0gKA,@,040P0h8`8K=O8`Ha3H;`|+|*3{ @,@8`,AK A7@,0l008`8K=aO8`H80aH0KA;@ 3aJA; |+c'39 @}U>0|@1 I0gKA,}@,0008`8K@0|88`@08`HKA7c0}@,00 088`8K;O8`HKiA,{@,0<0X0p8`8K;O8`H9F,^`g0c1 9 @,9_}B֙#1 } 1 3H 3A;@|+|*3Z @,@gH KH`HzO,@0t8`H,,AD"LXDA8`WKܱHt8`HKܙH\A(LXD8`VKqH4,8J@8RT>"LXDK=,@00!H8`0!}N A srinit|}&a쑁!T}~( (bx@d008`8K9O, /,LӂA@0c0+ 08`8@`K9aO8@|@@cL@,9 (008`K9OH8,@;0A08`K8OL0|8,^c00@tHa`}.cc08`K8O,c@8`hH08`@;cK8]OcH08`8K8AOHXL1'}HAH( ;/^8@9 (0,048`@ HK7Oh0!`}a8`N hd0!`|a} N CDkstart|!HT`>,,8`@xPA|,eL@`g| @,0@4P0T``@(P0h8`8K7O8`HeP8`0!@N H0!@}N 0!@N Azstart|!,;,@Ȉ T@ ,AT}>g;,c@K,cxXAL0l0|8`83K6-O8` |a8`8|+|*0c @H`K ,c" 8AHc@ (T:"A |8x} @}cN 38 ||+|%*3 @H38 ||+|%*3 @H38 ||+|%*3 @H3$8 ||+|%*3 @Ht3L8 ||+|%*3 @HP3x8 ||+|%*3 @H,"x8 0||"+|*3 @X0!P}N H0!PN D0!PN ALautodown|}&!,88 ;@L8`0!PN ||+c3 @|T>0|(,(E@L8`0!PN #|P@0T?AL8`0!PN @L8`0!PN #C( * S(I1%ATL8`} 0!PN 3|HL3ATH8`} 0!PN 3|0c@ TH@8`} 0!PN ஘0K13W>|@8`@8`A8`XT0!P|} N Cchkspkt|}&!xbL008`K2eOKaO,8`zATH'O68`A`V8}@"U:}.B:,bB9AH LU>0c8`8K1O,Ac,; A41(1,39A1,K(oc%K݃p`}008`K1!O00c8`K1 O,A |A9 (H؃,Ah|008`K0O008`K0O00$8`K0yOK)OH |,@4,A,0(0D8`K05O8 H `}@((o0c&pKO?`y, ,sNB3A,4h, |XAA9 (.,AX0H0Xc&8`K/}OK-O(8!2H 9O3\3p`fcc8`K/AO@8-0t0c&.8`;K/ObH'=O@L@@ 008`K.O$008`K.Oc#H ,At,Adā,@T ,A$08`8TK OH$LFBA08`8TKO<08`r88H 8`,@ KO8`TH "ԓ)(bd}9H(" @0(1)U&?,@h(}+H})0})`}i0Ui׾}+H3W>U)| H@;AbH%O08`r88H ,A<ā,@, ,A08`8%KO|0!8`Q} N 1,U)> i_1&U&>?}k0}iXzH@00 8`K,ObH$O08`r88H ,A<ā,@, ,A0 8`8%KO|0!8`Q} N ;?}i01kz1})X,U>})A0ab8`rH %,,?A@a040P8`K+ObH#O,A0T8`r8H ́,A<ā,@, ,A0d8`8%KO|0!8`Q} N ċ>|HA$",N)/I, .SLB3BA`c0x08`K*ObH"O08`#8H 큁0!|8`e} N A@ :; }&H1):H8,N@(h:1kUk>3+}&H}9H:H`3?, A4008`K)O00c&8`K)O}8@q;}0X)0|H@`c008`K)ObH!O08`r8Hс0!|8`Q} N ,}(9@ )1a1)1B,}!`~@0 ,@ 008`8; K(O.,,/AAlAAbH O048`r88H,A<ā,@, ,A0D8`8%KO|0!8`Q} N A3.E0h0KW>1:1U)>U021)}Kx|@A<@Ha18}hc~I/0i3KW>|@A~cF008`K'ObHO08`r88Hс,A<ā,@, ,A0$8`8%KO|0!8`Q} N !1h.E1)1Ukc&U)400f}yKxU>K(x|@A@X!1x}(18|Yad~I/0i3HKѥWH>|@A~,Ap08`08K&=O0108`U>K&O00hKY33`fcc8`K%ObHO08`r88H-,A<ā,@, ,A08`8%K)O|0!8`Q} N !o1).E10k0U:4U>YxK|@At@Ha18}hc~I/0i3HK!WH>|@A4~,Ah0L8`08K$Oc&0\0l8`K$O00hKQ3p3`fcc8`K$qObHO08`r88H,A<ā,@, ,A08`8%KO|0!8`Q} N /380ic$3HKWH>|@A,Ap08`08K#O0108`U>K#uOc$0hKΑ33(`fcc8`K#EObHiO0,8`r88H,A<ā,@, ,A0<8`8%K O|0!8`Q} N 0P0h8`K"OBT:@.,A`0l(0|1)(8`K"eO08`r8HcHuO1}H}0H1 |,@0KO|Ui:|hI.~I.}@hH|Ui:~I.}@h"}@{}@h ,Ap 9 .D,,A9 @A.D@9 , A0ā.LFBAW>b8`K O|c0!} N |0!} N a}0!̃N a|0!̃؂N "Crpack|}&ؑ!`T|>,``8`ApKO,3A8bx: @`,.:;@8KO8<|c20{`dc|cCKeAcDH8KO8<|c:0{`dc&c|cCK-AcD~8`|+c3 @|T>0|0K O,c8`;@ Hp;;@@(~|+cF3Z @|T>08cKO,08`8@ HKO,@0!|} N `0!N 0!}N C logpkt|ۡ!P"xb 3Yˣ83y0@ 00 0 8`KUO<C0`008`K5O,@H=H rO0``f0`8`KO=7HKOKO7<3 OD3@ H ryO`fcecD8`KO7ld`($ @0a@HH r%O0a@K)O},,AP008`A8KO,A(0,@8`8A KO,,@H`/@ccA8,0A$08|08`KqO/H̀,A0<0X8`AK9O/Axb,0\0xA8`KO/ADb,0|0A(8`KO/HH|0,@A,,b3#A0H pmO`f0c`8`KeO/Ab,00A8`K1O/HA,33A07H oO`fcc8`KO/Al 3,3A,H oO`fcc8`KO/A(0,0 8`8A KuO}ˡ0!N "A Ttstats|!\KO( b 0} 80B9 /@4}{8ce(/|P0888`A};A|9KO,cc0H88A,8KO3aHce0L8`8KQOce0X8`8K9Occ@KO`-cHKO`-c0d0p8`KOcC,@@0t0A0K)A,]cD0|AKOcH3@0| ,Hcb00A 00(A0,K}AHbK}AH K}ՀAb8`KYO,Ax| @ub}K*KHLB,"̀0XbK}uAb8`K~O,@08`0!H(8`H8`H8`0!}aN 0!N A dumpsbuf|a̐!p8`,A$8`0pKO,;@(p}0!8`N 08`KO,@(p}0!8`N B:,@@2xL2;`; ub}K*!< * |.Jbdb82K{ـAb8`K}]O,b0؁5A.!;|+c3 @}AUJ>1)}*H,Hc03{A0K{iAb8`K|O,Ax| @ub}K*K(HLB<"̀0bK{ Ab8`K|O,@08`0!H(8`H8`H8`0!}aN 0!N A Pdumprbuf|}&ȃ!b``c8`:00KO,::@,@,A0!}a8`N A8_|0BHQOs0~KO`~00(c8`KaO,@0!}a8`N 0,0<8`K)O ,|Vp}A8KO,8`A \d; 9.,A/@ S0|89@AxbD; 8 0  ,@<$}@0}! 39|@@$}@0KܱF:H:b\ x,9"A0/@0|0,ABD,0}ɮA48B}90|9188|A39HD9#}909A}909M}909J}13982,H`Ad,8`*@X,@L ؀,|0|8@`0|0,ADD09@!|gɮ1y}G18A|Y8392H`H؀ |T8|8 ,@0@8 |;|"+c3 @|T>0}g0aj8@0|0|80A`D01J!|gɮ3}G18C|39}i0F}Y939B82H`H,A,AXB8,AH@,A;#,@,@Z, @t0|0|80AXD01j ɮ}I}g1399@Ѐ|01J|939B82H`L;!;,Ad,@D0;` 0D;|g2Ku5Aa|0f|+c3 @|T>0|8|@1|@A0ɮ0 1Y|Q(2,H~ɮ2,A";`1,@D80; 0H;|f:KtyA|3|+c3 @|T>0|8|@1|@A(dɮ0 1Y|Q9@"2H ~ɮ2t;,,A,@z, @,@t0|080AXD01K ɮ}i}G1399@|01J|939B82H`|;-,A,@z, @,@t0|080AXD01K ɮ}i}G1399@|01J|939B82H`T,AȀ;(,A,@,@D00L; |f:;KrYA|3|+c3 @|T>0|8|@1|@A,ɮ0 1Y|Q89@2H ~ɮ2 ,@ ,A 8`+,A,@8 |;|+c3 @|T>}F@|80|8DA1|fɮ1J }FA1,A9@P}FA39H9@M}FA39,A4|39,A|K82H2~ɮ 9@+,@lb,@\0|0,ADD0;!}Fɮ1Y98R|Q8392H`0P0Xc&8`.KO;@0\0lb8`KO0p0|b8`KO,A@\B@,@L|0,A<D09` ɮ39}h10~ɮ8@.AtD0b; ~ɮ;8`KO|+c3 @|T>0|8Lc8`AKOH8`0!|a} N 0!}aN C  sattr `f,@ 0eN 0c(N( A 0e N 0߀L T>|8@T|A dN 0eN @| getreason|!`~c0 8`KOc(N 0(1@`K`e0 8`8K]O,A(00,8`8AKO8`H4,30<0LLFA8`0T>;cKO0P40`38`@(5>W8|0}0300AcKO,0d0| 8`@ HcKqO~,@KO,8`Ad &,,@<ĀA0,,  x0L3BA8`8KۡO08`X0!P}N Arsattr|}&!`b D`c: ,b ha@(b|c,Ab ,Aa8`N2EtbMm`1ub9c9,@T8`e,@(KRA4~@0~KaO8`Pe8`LqH3,Al0ea0ea0eKa0eLab |b0ct" 0a 0t߈(0T>3^|ATe:b|c(.|e|hN ,|8`@48(|0_H@ 0c|3ZB@0`}@ |cC`KAqH\,|8@48` |i0vH@ 0|3ZB@0f}@ |fZbXc,A008`K]Ob x008`KAOv(A(B+ILFLӂAPx1,9@y,Au,At008`8KOHXqc(A(B@(b x0 0(8`8KOH @b x80,0H8`8KyOH,|8`@48(|H@,0c|3ZB@@ |Z(<,}Aq 0Lb Dc,@pab$8KO,@Tx1,@4y,A(u,A0L0\8`8K}O9H`3,A0t߈(0KbHc,Ax,AaKIO,@81btc1,9@܀b 0c,Àbc,A8`0 0 88KOx,Hq,TeP*Aa`KO,@l8!btc1,9@Lb 0c,A0c|e.0 b0 ubE8`8KAO@Db |c,A4b0 2Ct8` |a8`|"+|*0c @9.8` |aQ8`|+`e0c @|aTc>0|eq@@b |8,u A D80 bEa8`KqOdha|0!`} N Cpgattr|a!`}0| }1| 0| }D}1 1< 0 1 9`;bP1\ 0 0| 0 䑝L}x} @H=dt(}0`p] $,}4<80 ,8`8; @ 0 萻KUO8`T3 |"+`e0c @h|a}Tc>0|c |cА}P0| }l0| \Xh}0!`a8`N AXinitattr|!`eb`,8`0 8A8`KyO0 ,0 <8`KaO0 @8`KIO 0 L8`K1O0 \8`KO 0 h8`KO($0 t8`KO0,0 |8`KO40 0 8`KݹO<80 8`KݡOD@0 8`K݉OLH0 8`KqOTP0 8`KYO\X0 8`KAOd`0 8`K)Olh0 8`KOtp0 8`KOx0 0 8`KO0 8`8KO8`X0!P}N H0!PN Aadebu|}&ԑ!`{"`ce8`0 8KMO | ܀0 0 (8`K-Occ cKe;,:A00cccH }xD0!p}!N ؂ ԀB @8ܐ x d0 ,0 88`KaO 0 <0 L8`KEO0 P0 `8`K-O,A4,A(8,A0 d0 p8`H, D8,A80 d0 p8`KOēȀH,@ L0 t8`KڙOL.@0,A$,A,A .0 0 b8`KEO@ D,@|,Ax,A cKO,@0c0 8`83 KO D8`H 0 8`8KٵOH,R@ ,A` D,@$8 h|;|"+|*3 @,A<Ā,@, 8`,Acf88KO0 ce8`KO0cccH7A,8`K;eA`.A$b hc8KʽO,Ac 0,A,,A0 ce8`8KiOb cdKOAcK:A,,A4A(,A0 0 8`K O xHA,,A0 0 8`8KO,,.O@+AH,A<,A,|@|0 ܀ c,8`";AXKkO70<8A;,@K4O0Tcc8`KOyHd,cCc&A8`fHHK;O`|cc" 0l8`KO,c `A8`fH0T8K_O 0cC0TK;!O`~c0|0T8`K]O,A8`fHKO7ЃB8@3cK3O,,A c0T8`8A KO00T8`8KO0c8`8KбO8`0!}!N Alopeni|!`z`,`cE 08`8Ah;c0cK0c%cKOc&00,8ȃ8`KaO\X000@8`K9O{8H"`{0D0T8`KO,||8@A(0XX@0p8`KO;`0t0cf8`KOȓXccx0!p}N A encstr\e8`0eN @$putsrv|!`dT>,,AL0h@(8de0cef,AHO,@cK=OXL}8`0!PN Aputtrm|!TT}>Dc008`KUO  88`K=]O,8@$008`KO8`H8`X0!P}N AputfilTc>KP @zputfilT0ȘeN @zdstuff|!p x`,A bp,@ @Ac80!HBT8`008K O,@|  " DBbT\ @b l"ȀbabЋ`|@08ȉ#1@@bc,A000vT>|cvȋ1|H@/W~8@L0drW~+@1(_(?A@@ uk@0cuT>T~8+ (,W>A@@q0cq@8/@o0,A0,H؀z|8 s0| 0A4K;yOH,b0؀08`K)O8`H8`,AԀ,0A@,@02xTT|y.| .|Fp|c"x|x{H0,@o0,K,@ȀbaK8`0!}N Abdecode|!Tg0|8T>f08`A K:!O,\ Ap,8`0AX d @,,@< l@,|xU"U|8.|@.|Fp|:x|*xXL}0!PN Apnbyte|}&A葁!p;`, `Tg>8c@|, `08@K0!}aN H mO48T;`@ GHc?`0@ 3[08`KO;`HT, `T@D,,0ATz>@$;`HcAx0!N AHccKO`e0 .-cF`8`KO,,.A\W_>c@@K,AtcK,Ad0!|A8`} N cC0Lg@xLH mqO7,;8`@L@0|83K1,|AL@|83K|c0!A} N , cW_>A@cCK2]A,Tg>A`K0!|A} N K,AdcK,AT0!|A8`} N g|, |8-.A8 |T8|@WH1,@@AWC>K1ATz>WC>W_>@4K ,AcK,A8`0!HcCc0X0L@TXH kO7X8`@L||83K,|A4X@||83KcH0,8`KO8`0!|A} N 0!}aN 0!|A} N Cxpnbyte|}&!p `~g`,`@$b c,@b |c,A 8`| @AT"T8`0P 0X8KO8`,Ȑn8@.b xȂ  " ؃b ԃDB d lBȀā1be`|X@0e/2@H,A80T>| 0ȉ2, 9 9@@9@A0b8c|@@0iJ2H8|X@U~1g@PqU~(@2(_+?A@@(bi @cU(>0bU#~9 ( +, A@bTc,@bc0bA|}Px,A Tc>H}Sx@T,A@H+(+@8`qH@8`q,H@8`q,H8`qs,}Sx,+ @8`n8+ @XbLc,LOBBA|,A`~OR3BW>A$e, AK-QA`~b ,|@@W>@(w/t,Ap0cp0HTs,@p,@L{/A@p,@ H XuOacH YIO,8`A8`,Hhc@K,HPm|8bTc0|m0cmAK1=OH8`,Aw/@s,Alb\c,0dpAPr,@Db @c,@0|xTT|z.|(.|Fp|c*x|xvH0,@t,KHb0\0p8`K=O8`H}8@dT>c,aAp0cpHK+=A,8`AH0,@c,K,@Ȁā1bK\8`0!|} N L0!N Cdecode|!H b,0TAdK*mAHH8, Ad0!@0cN K'qOH0!@}N AkgetfTȈe0,L 8`N @$kgetmT`0d ,8`8@N |0HL 8`T0|@BL 8`N @Xlslook|!T0t0 8`KO0,08`9 Z@ >8ZKO00,\0,`8`9@\@0"$9`\)@ ,\8\, @@ ,\8\0@3cKEO,008`@; cK!OXc}0!PN Amaxdata|}&! xT.|4,T~9:A,pP,,@DTA0!PH`,0ԂbX@008`8KQOX0!P}8`N K%a`f ,30 A0 8`KO/,@~,b;AH A\H4 Ae0cH K$ O6,@00(8`@@|ǐK]O,A`Xb}0!PN ,ԑ @(0,0D8`8;KOH0H0\8`8KOX0!P}8`N \bD,0ԃ8V >AHbB lc,|bxb@$UiUk}H.|cX.|Fp}x}#xj`8,H0,@$8`@X}0!PN ,/ A000r@|0Í2RB@$Xt}|cs0!PN AcB( l, b"Āb ,Ad||(A80H(|(T>@|z(Te>~(@@j00|c(|Hw4cwAu0cH K!mO6,@d/A 8`n@b 8Ht.|Ð0`0x8`KOs,A`pbHhb\x,0cxV>ADbc,@4 |BxTe|(.Tc|e.}Fp|x|xmbDbEb~88cT>,|P@9`9 OB3BAHnԀ,`0/^@,A0c!@DTi>~|c8~H,v,00c!@Ti>~|g~X|q|gV(~/, /* "A }0c}`j1@H A @{0c{|8@@`Ay@`, ,A|OR1Ad22RHh}s.|80@0e@} Bt|c(ssHxy2r2RAr2R2t2R|c8aQs@ln,Ab ,Kt|cssXT0!P|} N Cbgetpkt l|xTgTc|8.|.|Fp|*x|"xN @8dofilcrc|}&!T`{`,0::: @x|80f|0!N 008`KO<3Hb0Hhb0HHcC}0!N b,-/.,A@t<: H23 \Bb04A0fH KO,T}D.A,0A,@KM4A0fH K}O7CFxT>AH,0A,@ K,|@@,|@A@ c008`KOK,A00aTcKAc00T8`KMO,H`@XhH4;: A 1gH K}O`z.A \ ,0AcC,@KWC>0hH WMO4AAx4A0fH KO`z.A,0K@$|cC0!} N ,A0c00aTKaA00TcF8`KO,@4A 1gH K1O`z.A 000$cF8`K}O@cCH.AH0(0A`0T0dc8`KyOHH,-,.W.LA,W>A0h0c8`K9O8`H||0,W0@ ,@A f,AK)ATc>`~,.@W>0cH UO,,A$00c8`KO8`H(@ 0|0{B0008`KQOfH8|W>008`KOcH008`8KO8`HWC>f, AxKATc>0!|Hh4A 1gH,K OH 008`8KqO8`0!|} N 0!}N CLxgnbyte|}&!b xBTs`,: A;bD,@400@8`8KOh0!`}8`N bX8KԐa,/@b0D0T8`PKaO~,@ b c,@b 88b ؃ 0rĘ{Ѓ H Q}O|.,AP~,@DH ـATg>8`rԀ(b ~80008`HA{,@ H EO~,A b0Hb4H FO,Tp>8@t,ԀbX8@( 0X0t8`K9O8`H0x08`KOhd0!`|8`} N ~8,@\b ,0Abc/@|bKр008`Hp~,Atr80c,r@HԀbX8008`KMOdh0!`|8`} N 8`rԀHb c,Ar;KAA,@4hd|bX80!`8`} N 8 ԀTp>0gf00b8`KOHTAs,@bȀc,@<{Tc:|f.K`~00c8`K5OHb4A f0cH K}O`~00c8`KOHTb4A f0cH K)O`~00c8`KO,,8`@@`bD0c0(|xbX8`KQObX,A`hd|c0!`} N r,bX8@( 0,0@8`KO8`H0D0X8`KOhd0!`|8`} N b8c,W>@s,Alb f,0AbKATp>\},A0bc,@ cKQbc,H\bc,A0\0lb8`KO},Abc,@cK008`H@|,@tbc,A< l 0p08`KyO008`KaOh0!`}bX88`N 008`K%Or,A40@ |i00rÍ1B8`grЀr,@4hbDdc|X|cx0!`f} N , 8`uA x.P "DbT Bb ,Aht,@db,0gA8`r0H|T>@ (}0g|b,0gmHt,A|b ؀c/@lA b0Hb4H ?IO,@$,8@, 8H,@0|8Tq>HA4rȈ0c,r@ 8`rԀy|8Tq>HЀb c,A0rKaA,@ 8Ԁ|c08Tq>HAs,@bȀc,@Db ؀ ԀcTc:|f.K9`00c8`KOHn4cnAw0cH K O`00c8`KUOHLn4cnAw0cH K O`00c8`K O,,@$A/8`r@b 8bȀy,8Tq>AXbcm, 0cmAbK݀ATp>b\c,Abc,@ cK푀bac9`,9 899@AbLc/A|@,@Ad|@@Tr/@Ha1,^A@d0c!8Tg>{|c`{,HDs,u,@00!1{T>8|l{H s,@̀bLc,@LBA},ATr,AH~,Avo1bXH,|ao18`Oo8`r1bXc,A,0o8Mz10czH8` ox10cx: V0,}V~,AAr,@l8`K ,@(~/@<8`r}9@N,H@~/8`r}9@N,H 6}U)>,H ~/`H~/Av`Ti>HAxr,Al8`Ki,@(~/@<8`r}9@O,H@~/8`r}9@O,H 6}U)>,H ~/A ,/,LӂA@9PX|p|l/ ,,Az0czaj@H00b8`KObD,c|xbX8`ot,A Ar0crȀbXcHbD|x|x8@,r00@D|i02HA `0,BA `bX0 8`KAObD00c0@|8`K!ObDc|bX8`bX؀cHbD؀c0|xbX0 8`KObXc,A`cHA@x0cxH|`@@abc,AbĀc|@aAv@a, AO1,a,/ A1, AĀ1A1A1a,1@da@@8@ |@|0c1BbD|f@|8Aa@a|fxHbD|fxb0|0@r/Ab ,KЀbD0Dc|xbX8`obDbX8`KObXchd0!`|} N CXgetpkt|!p ă8; ; ȁ , ȃ ̀Ԃ?8 x" h dB&Pb t;&8Y246& | `, (? $ \? $ȓ?T$ P0T71,j$bT܀ A ԁB ܓ%*)?,?̓?ܓ+&($|A8 $l,@0X0h8`H<H$  eK)Ox`f0X0h8`KO,A,@ K O0l0x8`KQO>0|08`8K-O8`KyIO,A8`K|O`~c008`KO,cAPKO{KzO,A(,?8`A `8>0!}N A$tinit|!HTbL8008`K5OH0!@}N AHpktinit|A!`0a8 0KO~, b;@A{T,088`A8KOO~,Ab x,8`8A0,T0A 0H0KOAO~,Apb D,cTTc:A(|c(0쀣8`8KNO~,A,bT,008`A8KNOc\]H71H/K8%Oh0!`}AN A\rinit|ܐ!bXb\b`dhb؁B,; Ѐ"TB܃؂8Hb+(&$#*%')Ab x8H b x008`KOx8}:<>?7=;0!pN "A resetc|ܐ! l ,$;` 8`@ ,8A`,"pB ; @4K牀A4|T@0~K?UOdH Td0<0L8`KO0P8`8KO3~0`8`8KO,,8@ 0p,8@d|,0tLB3A`H0x`|+|*0 @y:x0!p}N A fnlist|}&!䑁!̀  9 ('K)8`,T8@\ ā,,A4 '@(9 (!9 @t39('Hd 'HX  Ā(, ȀA'c%H0, @, 3=@'c%0KOHB`~c;@008`3*KOAtXW:}@ h|@|N 3]HP3]HH3]H@3]H8cKlO,3] @ 3] 0 0 ; `;`0 8`KOT:H8.0 cF0 8`KuO,@0̐gKr]O`f0 0 8`KAOK֩OH( `~c`|+cg3{ @}U>0|8cK Oh0!`}AN Asipkt|!bЀT0 0 c8`K~O,cA KvO8`K1OXL}0!PN Ahxsinit|}&!đ!PT `t"P0 bt:Bx\0 8`8K}O~ 8Ky,8@$1 ,@(8 3 |;|+|%*3 @b KOw(~@8Ka}O,A$8 |;|+|*3 @",A \T,@l@ \T@X0@0gKO@0gK'}O,A( D1 }0!!8`N b;3[z,3;8A<KO,@ (c,38@z,KȀ.,A0|8,0@ wKO,@@0 8`83 KymO D |88`H (,A<Ā,@, ,A8`88KcO0 8`8 0KxO,A,,A0 8`8K@Ob ܃ ,Ax0 cKA;|+|*3 @ ccKOb cKO0 c8`8Kx5OHL,A c8KڵOH, w `c8K%O؀,A8#@`8\0 8`8KwO`0gKA,a\A`{0 8`8KwqO|0\0`H#O`0 8ce8`KwEO`,A<0v H8K MO D1 ccKqA8`H䀗8`|+|%*0c @ccK9A|0 c8`8KvOcKbO`{0 0 cf8`KvOcKO0|T0 c8`KveO0 cK!%O,A ,@,@ ,ALB D0 ̀c8`Kv OcK*Oy`e0 8`8KuO(A؁XT:|@ |8|N cbDKOb |H0 0 8`8KuO,,AP D1 A,,A0 80 \8`8K=1O8b |HdA\,AL0 `c8`8b |KKO,A$b ؃ Ԁ{H O@䀢 ,A/ALĀ,@< ,A, h8`c8FKLO/H hAĀ,@4 ,A$0t8`88KLuO/A\,@P ,A@ ,@ x`0 `8`8KLOH hc0x8KSUO,A3x8 0$|;|+c3 @|T>0|(c8` 0Ka O,A,,A0,c8`8K(Ob cKmO,A4,A$040t8`8K(}O,,A4Ad,AT080H8`K(AO H,|܁ @9 c(H0(8`B1 }4U1 0@a,}@cHb|9 c,A1(}jH1?} @|@1 @chHH@D#8,A01(#0, A(#0, K0d|@@ch0!`}Hbpc,ABHb8&K 9 ,A9 ! ,@a)1) }=!,AP0c8`8;KPO|+c3 @}U>0c|@cKOb@8|+|*0 @ch0!`}N Atrpar|}&!pT`t: bȁB ̒00b8`KO9O008`KO!O,|LA!A`00b8`2KNO0b8`8KNO,9@P@0T> 0b,,. |x8PA@,BR H(AaGB`H BR "Q,,A |gwH8A0T?H g,@ g|wKO,Ȑw9@A(,0T>\Ah@, A@;@83}3K%O~|8@}3K$|4T9@ A0T>UK>(G( 9@ A@G,9@#AT/ ,?, _. @ALA@9@#,ЙGAH 8,Y, /?@D;H<,_.@A LAAD8;HD;H0(048`KLaO080D8`KLIO0H0X8`KL-O0\0l8`KLO,.,A |A @@p^9`|P,YA@9`, gA@p0p08`KKO,@9@s4^G"T.@9@N_,;@A0;@(B0A`,,@@;@ / BGA||t,Ah( )?T>(Y@(x|8@@< b$H4( _+ @A LAAē g b$ 8A, ; AP 0T>00cF8`KJEO9@|9A ,A9@\9@|9A,A9@]9@|9A( x,A9@[H x[9@|9A,A9@ PG008`KIeO008`KIMO0Ā08`KI1O,AL|9A4,A(,A80H8008`; KHO008`KHO008`KHO 0TAD, 0 A8G31JUJ|A AG31JUJ|K00 c8`KH)OH x008`KH O1^,|PA0@}V80|81J; #@UJ>0J_T>J8z0 0,cF8`KGO 0,#@|x,A, 8PHAcY2c&, 8P@8P H ",,8LB+BA 8000H8`KG O0L0\8`KFO ~wKOw,0A@|80`0T>;@ 0lb8`. KFOAb t_|8@ `,,A,;@@ tG1z|P@gb0p08`KF!OHH tcF008`KEO008`KEOH t,@`qH3р|8@D],, q`f8LB+BA008`KEqO0~8003b8`KEMO@(|00T>08`KE%OMUGUG8A,A`,,A0@H,.A@0,@ ̒8H ̀008`KDO00$8`KDqO,@ TH 0(088`KD5O8`,AKܑOB|0 @|80<0T>0 80Lc-8`~KCO0P0`c8`KCO0d0|b8`KCO,LaLFAx|0 cbcK!O0be8`KCaO,A~AЀ UJ,A, 8AX 0HXp,A(,,&A@9@&_KK8 008`KB]O~UgA0B `,@  _, H_, UG:}GPÀ 0UK:B ,|PA0.A 08`8K O,@|H00be8`KAObc0KeO,@HX008`8KAqO&"&"20 |G,@\, @,AbKIO܁|0!8`} N Cspar|}&!ЂT  008`K@O8`00,8`K@mOb9900:`0<8`K@EOb8b x,XAXb ,@Hb ,@8 b<,@ b x0@0\8`K?O 0`0p8`K?O,Apb h,@@ 8 |;|+|*3 @80!0}8`N 8}0!08`N ,,@d8 3tb h|;|+|*3 @8b, }b  x0!08`N @t ,@L 8 b h|;|+|*3 @8}0!08`N 80!0}8`N b ,Alb 0,A,b,A008`8KO008`8K=O80!0}8`N  " h BBȃ b 0; ::,@|b Ā,A8b$8` 8KO,Al0b%8`8K=]O008`K=EO,0Ab Ā,Ab ,Ab Ѐc,Ap,Ahb#8KOb Ѐ,@0b$0b xb% b Ѐ8`K,0| AL|~(,@80KA8|+`0 @|T>0|  T}^(d1=K`e0aCa$KŀAH 1=(d0HKa`ea$cKAHd 1=pd0K5`ea$cKmAH8 p1=d0K `ea$cKAAH \1=d0K`ea$cKAH X1=0d0PK`ea$cKAH x1=ld0K`ea$cKAH |1=d0KY`ea$cKAH\ (1=d0K-`ea$cKeAH0 `1=,d0LK`ea$cK9AH 1=td0K`ea$cK AH؀ 81=d0K`ea$cKAH 1=d0$K}`ea$cKAH 1=Hd0hKQ`ea$cKAHT H1=d0K%`ea$cK]AH( 01=̀d0K`ea$cK1AH l1= d0,K`ea$cKAHЀ 1=Td0tK`ea$cKـAH 41=d0Ku`ea$cKAHx$B@d1=KI`e,A0 a$cH0 (a$cKaAH, ,1= Td0 tK`ea$cK5A8 |8|+`0 @|T>0| @8<X0!P}N D0!PN A,nxthlp|А!T: b d;:3B ԃb " xԒ3 ~8c|+|*0 @0 K9A;~|+c3 @,|T>0c|@|`A<0 KA~8`|+``0c @|aTc>0|@ 䓴<T̓Kx0!p}N A (sndhlp|!H088`KEO,a8@8`K1O8`H0!@}N AHnxttype|A!; 0<T;;`|+|%*3 @~<00a<;|"+c3 @}U>0|8@KUO,8`@h0!`}a8`N 00|8@H8 ,AD,@H0"@,A,YP,A,L,@4̀g`eH,LYPHL̀g`eH ̀g,0"D@0"x,H 0"|,@19",H 19",@3"a<8cH3"a<8cKAD9 0<D}8`|+`g0c @}U>0|@@H<@80"0"8`K'!O0|88AT3c`;0"0HK A<~A|+c3 @}!U)>0|H@bKO,b d;`@KqO,0#8`A3# (/b3#b@D~A|+c3 @}!U)>0H~A|+3 |*3 @H@~A|+cG3Z @}!U)>0H~A|+3 |*3 @b8K#O /,b,8A 8A `K!OsD`eq8889KwOD0#(0#@8`K#%OD8`,@~Ab|+cg3{ @}!U)>0|H,0#Db3#T@K%A#`H ~A;|+|*3 @#`ԒK`0#d0#lc8`K"yOc0!}N A snddir|ؐ!bT;;D<@, |(0@ <|@`alg0!N 0aH0`v@DK-OH,0aH3; @(DKqX}0!aN KO`yB;|+c3 @|T>0|((|@c,0#:A8|(c(/A03@A(/A3@K舾(/@3cAh0aHKO,cc0#t0#AK!AH@PL|8P0L0#0#KAHKA<|+b2 @|T>08@HaLP@3,/c0#@ 0#H0#`1;#; ;A1;#KUAD<0D|+c3 @|T>08@H<@,8`8@ <|0!}N A nxtdel|ܐ!0,bT@a\8`0!pN : 00| @88 A 8 KAO,{D8`@P d  $ x3$~;@|+|*3Z @̓KYx0!p}N A Xsnddel|!! 00T>08|!3,䀄A,,BTc8`0$A8KuOHBTcK%O,c0$`8`8AKUO`c0$,8`8K9O"D,bA43~;K%O,3,@@ ~KcK\yK=O,A4, 8`@ ,c88A K9O,,A c0$H8`8A KQO8`Hcg,,A0 8`@ ,c88A KO,,A c0$08`8A KO8`H\KO,A$,c0$l8`8A KOhAH0!`}8`N h0!`}!N Acwd|!";`y,C,@!DaL8`0!`N BT8@@8`0!`N c c1 HCa', a'1)AHCK8`,0 A$,A,K0$KuOc8` KO,cԃ d@@0$8`8K9O x8`}~|ygKIH 0$8`8KOy8`h0!`}N Apsyscmd|}&!30T>ecz;cKmA`}3ԃ"T)c.;0$3|c3p8`KMO3Z0$cE8`8K1OAXW:|(|(|N cCKA x Đe h98`HcCKA !# ȑ% \(98`H,A(x,A8`hd0!`H`cCKUA,A xT,@<@ xT@(,/A@8`hd0!`H,,@09@ 0 De8`HcCKA8`HcCKA8`HcC8KA8`HdcCKeA8`HHcCKIA8`H,cCK-A8`HA(0+A<XW:|@|@|N cC KA8`HAXT:|@|@|N cC KA8`HcCKALHeh8`HdcCKiA\Xeh8`H@cCKEA@1@a|+3 |*3 @a|+`h0c @}!U*>1(})P|hP@LKl A6#3\;A4c~;@̃|.K)O,c@43~@ KO,0a\@3~K1|}(@@p}HU:}=a a aAT})5}iP})@.1J+ u}(X)}k`+51}hHk})i10B}}@U:3a2|+|*3 @~(.~.8}9H})pU*})P1}(.~@A0a\,0Kԁ8`,@$KjA,@0sKYO<9?~A<1,<@?~AHD0LbK~!A0<0DbH%.A<DU>Hu:,@d3T"";;\;`%bc0a K}A-|.0a HB-2,,-AAA::@H0\@p.cKO,c0`AKO,c0d@:HKO,@:@3|@HdbAP2, 1(1V:0a A  a !  |.HAM||A|.KEO3|@@bc0a KH",A00shcH@AHbcKEO;H40slH@AbKEmO;A,15@9 XB0(]H}00aK{ـAcC0KEO08`8KUOz,KDcCKDO08`8K!Oz,KX09 \00pX08`KOKqOth840!0|!} N A0!0N C (cmdini|!|;t;@,@K,A4hAH0!`}dN "Pb 008`xKO008`KO,A@${,@ ;` a8|+|*0 @H,A0{;` a8|+|*0 @Hg,A|8 |8|+|*0 @(/@P3||"+`0 @}U>0|8||+3 |%*0 @H;` a|"+`0 @}U>0|@a|+3 |%*0 @08`8KQOy0H ՀA,4;gA ha;@8|+`0 @}U>|g@K_mA,T:|h9.A a;|"+|*3 @耙g8"tK_AO @0T:9.9U':9.܁Y0T:}(8.UG:}(9. Y0T:}(8.UG:}(9.`Y0T:}(8.UG:}(9.hY0T:}(8.UG:}(9.Y0T:}(8.UG:}(9.xЀ(U:}'A.008`KO9|H|HT:9._}(@}HU:|@G>}8|@T:|8H0,A$KO3`dcK1O,d@h0!`HAHa;|"+|*3 @ca;|"+c3 @}U>0|@1G@8, |8@,aH} HA'1 (/1JBAth0!`}N A0doinit|!p|t4,"tbx:@KEv0H A, @A؀P; h:B܃ B`hЃbe!8|+`0 @|T>|f(K[A,T:0|{).A !v; |+|*39 @0|0|0T:~1.|0|8T:|0|(|0T:|(T:~).T:~).0T:|0.T:|9.0T:|8.T:|).0T:|8.T:|).0T:|8.T:|).0T:|8.T:|1.T:|).8`8K OH00 8`8KO0!}N 0!}N Ap doiksdinit|!`y|` H;@c<cf;0 ;0 ,Y8`K]O0|c830 cEc8`K!O,@;b @c,A0c|8|g,|z8A@c,T~>H8`,T~>|z8@c@H 8`@T>LڑAHb ,A81#|8@@+ @,a#1#,|8@@܈z3,qA0cC2,3A2,K2=@0 0 8`KO0 $0 8c8`KO0 <0 Xc8`KO,@0o(}@5@(-+{A@hH(-A +{@()\+{0oAD@`o0 \0 hH@2=20 \0 hHxc3@0z@`z2KȀb0 8`K)O0r K=OaKPmA8`H`@8K48K(aKP9A8`H0 0 8`8KOaKP A8`H8`,qb0c20 \0 ha8`KuO0 l0 8`8K]OK,Ap@ 21bHO0 b8`8KOaKOmA8`XT0!P|} N Cgetnct|А!btb|#<,xctB@3Th x||T:|8.c,3/3@T|.T:.cKAO,c$0t |.AT:|0.cK9OH0t @|.0gT:|@T8@.@|.T:|T8.0g,A|.c,0 @KO,c0 @3 cHdK]O,c0 @3 cH@K9O,c0 @3 cHKO,@3 cc$0t KIOH K=O7=@||T:K0{ $8@ K Ox0!p}N A shostack|}&!a,8 89A$t.A8,A@,A 8K,@T>Kf=O ,A4 |cKO`f0 @c8`KO쁢t,A| H0 X0 p8`KO0 t0 8`KO 0 0 8`KiO0 0 8`KQO0 0 8`K9O" KO,`AЀ.@,,AxB .@lK,@`|0} K~O0} K~O0} K~O0} ( `K~O0} @K~O,A$0} P K~O0} tK~qOKO0 `d`K~UO0} ,A 0 H0K~1O.,A8@$0}K~O P;,Hd0}080K0cE|KO,;L‹BA4,c_0;@T,cdcCAK9O|HcDccKWO|@܀؀D;,Hx0,~AK|h8K4iA,}A~۰.|+|*3 @8`,AX~|+`g0c @}U>|g@K4 A,};A~|+|*3 @H}|{.wHe39,@W6:@$.,Ac+\K8`H00r$KgO8`H0rXKg OqK8`0!}N ȁx0!}AN A`dolocal|}&Aȑ!`t`,;;A$t,A8.A@,A;|; 0;`|+cg3{ @}U>0|8b8`KO,AK0}O,@Tt0w,A00H 00KeO0!|8`} N 00@AbcK2OHbcKOIO|8`A8`0!|Аg} N Bt-; WxBh bȃ($33t.,Acfcc8`K1O,,\/n/NA|,b,A-BA /l@dtbCKq,; 008`A8KO8`,AK4=Ot,HKMOH/LA@@tbCK,; 008`AX8KaOKB!OHA@@tbCK,; 00(8`A8KOKAOH|,\0,088`@88KO8`\KO}OK,; At,H<8`\KOUOK],; AWc>H@; t,HWc>KOOK%t`bE0<8`KeO,, AD9 8@,A9 AL,A,,/H,,/LOBBAA a'9 , U#>-T>AKNmOKu,AcAKNQOKY,AtbCK!,At,Acfcc8`KD/2H;A@8`\KMOKt,@bCK,A$8`0!HKFO~888899 HUO,A0|| 8`(>M 8`N (<8`M A0,(<@N @isaa|}&!``~`cKO7,8`;`A7=@|y|yTz:@3 ccKqO,cccAKbA|c4Tc~.ccA| KbaA,@\3{|@H@ ccK|~.ccKb%A,8`@ c#hdH8`Hcchd0!`|} N h@0!`}aN h0!`|N Cdmlook|!!`~``cKO7#,8`;AA$h!D0!`}N cH3;` ~ a3]8|+`0 @|T>0|(|c%c@~K`A,Ac]|@~ a3]8K8`h0!`}!N h!D0!`}N A mxlook|!!7$`@ |3%T; ;|+c3 @}!U)>0I(,;@A!D8`0!`N cH3 3}8`|"+`e0c @}!U)>0|H|cEc$@~K_A,Ac}|@ 3}8`K8`h0!`}!N Amxxlook|!H4|`d0`XAKYyOHH0`hKYeOH8`}0!@N APtraceval|}&ܑ!``{; };;@:8|+`0 @|aTc>0@"||.3|`cc8`2K…OV:|.X`8|+`0 @|aTc>0@`cc8`KH"|b008`3KOc008`KO0cecF8`KO,8`AcK$MA7@D0ycdKWO0ce8`8KOx0!p}8`N ,Ahc|+``0c @|aTc>0|`|"+0 |*0c @,Ac|+``K8`|+``0c @|aTc>0|~0c`8`KO@cccH`~cH00008`8;KO0y4KVOcK"ՀAcxt0!p|} N x0!p}N C addmmac|}&ȃ!P6c`; ;8`A;@ A8`|+`v0c @ H|}U>1@bec0P8`KO,@$0\0h8`8;`K}OHDA8`|+`h0c @}!U)>1hH0xbcf8`K9O.,8`AD@@(\@bh2s(%(&@4bcH8`,A@\0{K!UA7@00xKTO0!|a8`} N A8`|+|*0c @(0(9*!+~L A H1ЀU:,T:W:}&H@8"00A.08`K-Oc|hKOHU(8}=@ x0I.08`KO"(U:} @.c|hKyOHX8`AAcK̀A,AcK݀AT~>"0W:0A.08`8KyO,AbccK8`HH@@0be8`8K=O0P0TbcHf,8`A~8A@HU T8|fTi 6|}I.|.|i}_.|.2HD|i.0_,T>8@(HTT8|fTi 6|i|22393{3AX,A(8 b H9 $#,HPx|f0|fTc:|d./,@ 0l0|8`K=O8`,T:Atb4|c .H ̀AT:|.,AKYA8T:|.0f~bc4T:| .bАH~,H|@x H008`KO8`,A@bBK)5O,b Lc,OF BAx|f0|fTc:}D.}$,/ @4a#cTc:|.0|`KBO,H8@4i xTi:|cHTc8|.0|`KBO,A8xt0!p|`} N C popclvl|!K,AK,@HAO,AH1O,@LHOX8`}0!PN Apdostop|!`d(T:|(A$|(|N |,0,0@8`A(0gKAYOX0!P}8`N 8KO88`K=OX0!P}N |,0hD8A K@OX8`}0!PN 8`KOX0!P}N D|\,0h`8A K@OX8`}0!PN 8`KyOX0!P}N 0؀,,A0|A0d|K@OXD}8`0!PN ,|;A008`8KqO8`KOH䀂؀,,8A,|A0dK?}OX8`}0!PN 8` KuOX0!P}N ,; A; cK,)O,8`@\cK1OXL}0!PN |0eK>OX8`}0!PN X0!P}N XL}0!PN Adoclslog,|0`L 0`N @showoff,,/|A0` M 0`AN 0`N 0`N @8showooa|}&a쑁!|`~c0(K=O}|TT , .A\@ 0TA,0,) )W>A,0K0|0K?A,0r HAK9OH0r TK9Ow|"+c3 @}U>0|@K?QA,0r \AK9OH0r hK9}O0r pK9mO0r xK9]O0r K9MO0r K99O0r K9)O0r K9O0r K9 O0r K8O0r K8O0r K8O0r K8O0!}N Alshover|}&a쑁!`~`}|~0 K8iO@,0 K8YOdh0!`|} N }=}]H|~}>bT:@ 0#H|P.K4uOuK̀|bK`ecK4MO0!}N Ashotrm|!b|c3$@,0`#䀂0AK3OH0`#K3OH95O`dcK3OXL}0!PN Atshmdmlin|}&ؑ!KEO,A;Pb| x0{$DK3IO3[$~3?8 (Kԥ ,1$H;`daK3O |h1$hK`daK2O0{$K2O0{$8K2OcCK2O,@ 0{$K2Ob,H0{$K2Ob,@0{$K2O3,H0{$K2iO3;;3,$./ A`( ;9@A0(3, @9@( A(3, K}P|-0{$AK1O30{$A0{$K1O@3,Kd,@0{$K1O3,A0{%K1Otx0!p|} N C (shopat|!l|0~%hK1%O0%0K`d`K1 OX0!P}N A\ shooutput|ܐ!|e"K)`dB0%P`tK0O`y K3~%`d0%p`K0iOT:|0.",0~%0%@0%K09O0~%K0)OzK`dccK0O0~&K0OT:|0.0~&(,0&H@0&PK/O0~&X,T:|@K/Ox0!pHX0~&K/Ox0!p}N A Tshoinput|}&ԑ!`|:0<0x&0&bHO,,NFB@P: a<~;|+|%*3 @>!1)}+H1)}i} bA9 }+HHa<|@KXO,bA$3|Ac,0x'KD0!|8`} N "X-b\3;<.l, -A40x' @ K,O0x' 0_|.@8@K,O-230x',@ K,eO@<.l, Kt0!|8`} N |0!} N t0!|} N C | showarray|}&ȃ!0`,//@HmO,A&|0~'DK+O0 KAT>KqO8`KiO`T>KAO,@(0~'TK+-O0!}8`N P0~'hK+O8K0!}8`N ,;`@B ci,@z0,8`8~@l}c~c|c.K.EA,3{}@||c.H%,A(zc|3 @}|c.K0!}A8`N cc}0!лAN 0~'K(O8`,~@Tlc~3{||c.H$,3 A(z|3{@||c.KЁ0!}A8`N Pb8 |c8|+|*0 @H9O,@ā0!}AN L3AH O,A"L(AA W:|dch|d|hN HO;@H!K;@H!|t0,K&OHT%O0,K&O~,@KEAO0,K&O0,K&O0-K&O;@0-LK&OH!HHOb|;@0c,K&eOH!(HO;@H!HYO;@H!t܀b|;@T:| .0c'K&OH ؀b|a0c:K%O0!}8`N | @0~-PK%OH}OK90-T`d`K%O0-tK`d`K%Otbhc3-T:3~-|c .3-K`dcK%]Ob D3.4cK`dcK%=ObT:c|c .3-K`dccK% O|3.Ku`dcK$O}KU`dc;@K$O}3.TK5`dcK$OKK]b 0c|c8||"+0 |*0c @K O,@4b,@$b,@b`\,;`@\| 0~+0c|c 0z+0| AKO39;c0`KOaH0Hc,@P0z+KOv390cH H0z+KOv390c@8t0c|@,KA)O,A; 2| H2| @u TcK;@HK;@H܀b|0g0,h@T>T:@ 00H |@.;@T:|8.KOH|K0~0KOKO4,"@ 0~0KO,H<@ 0~1KiO,H0~1KMO,,/@01 HH4@01H0~1$H$@01H0~1$H01H0~1$KO,@4b,A0~14KO0~1XH0~1HKO0~1XKOH`]O,APbtc,@@0~1\KqO0~1KeO;@8`DH$HVO;@HKM;@H tH~O|,01A 01H01KOblpc;@KM01KOH HU;@H HYO;@H b|01,,A@ 01H01H02KObȀc;@K02`d`KYO02 KIOH b|02<,A02L,H02P,@02TKO02`KO;@H b |c PKE02d`d`KO02,8A8KOЀ02KO}32K`dcKiOb32Ԁc32K33`dcKAOH OKҩ`dcpK!O~`K҉`dcKO03(KO\03@KOb,33Xc33pK=`dcKO}K%`dcKO038KO038@;@K}O 03ȀdKeO038KUO0386KEO~34Kѭ`dcK)OH bЀ|c;@,A 0d4(ԀKOH 0d48KOH b ȃ,@ b|;@0c4HKOH ,A p|34d,}8@14\K`ea`cKmO 8,}A ,K;@H HWyO;@H ,@@|0~4K݀A4aHA,c8KyO,0~4H|H ,0~4A cH04KO,AD0~4,@04KO 0~4,@04KmO0~4KaO;@H ,@@|0~4KA4aHA,c8KڡO,0~4H|H ,0~4A cH04K O,AD0~4,@05K O 0~5 ,@05K O0~5$K O;@HH|;@05(K mO8`HIO05,K UOHKy;@H |~,@$058K %O;@8`DH05LK O3;3.,05XA(K O@3,.05XK05` K O;@,A 05K O8`DHX05K yOHK IO0~68K =OH0~60|3@@3;3,A3|;0\`/(0/),,@`03Z0|;(@`,8,@;,LA KO0|;,8-KO8 . ccT>KO@d0v K捀A0|;48 cKeO( 0;@@t3+ @3+ KHP0|;80|8-@8KO0|;<8 KO0v KA;@0,@40@ K,}O,8`A<;@3,A/(0/),,K`0|;@8 KiO00|(@,K, O,8`@xt0!pH<8`xt0!p|} N C shomacT>,| @A8`eA40c,| @AA0c,| @K| @M 8`N @Xwindex|}&A葁!@|;HgKA,A8?;Hi0;HKA,A?;Hi0;HK;Hg1#1C+ * /<,!-^OYAA,/-.>AHAl//. A,A@|ȁ|8`E} 0!N LA0HP/|A$,@/~AL3AH0A@(ȁ0|;H} 0!N H %A,t;` ;AԀ;H3LgcH A,3AK;HAp3gK݀A,?;Ha'AiKA;HzH gz1'g?;HH A,;HA3gK;HgKmA,;H`AgKuALH iL-q/h,t,A/o.xA A$@D;H;`0;HH0A@(;H;`0;HH;H;`0;H}{֓;LAL1$, 1D8@aI X@0}{,;LA1$, 1DK8`NH"t;D)H, ,@0;X@ KYO8`NHl'H, ;@ ,0;x;H@KO;H;D0;HaKĀ0!|} N ȁ0!|A} N Cgettok8,,|`@ 8`N T/@`A8A8H A`T|)|pA`,|@A`|e1N @xexpon|!|H;P;T(^@ K;PKр;TcK1;TX0!P}N AXfactor|}&a쑁!|;P+*(/(%*&ALB3A@H;K-%|;P|;T.&K5,*,/AAdAP@h|;T+/,@$0|;,@ KO;TH8|{}Aa|;TH |;T|{֐|;TH|;Tc8|;T;P+*(/(%*&AXLB3L“ALhd0!`|a} N dPX} 0!`N C4termp,0,8@| |!0c@`N @,fact|!HKK]H0!@}N A$term,|,|8@4`@`A,T`@ |c N T|+x,@4|cp|pT`T|+y0@|cp|pT`K,,/LӂAA/AT`T@|cpT`@|cpT`K,``@|pT@|pTK| @ ``|d/,/A AA,AT`TKH,A,8@| |00N |00N @Hgcd|}&!|3;;PcKm,A;PK-<};P.#;TK/>A,+,-/@A@A,A;T|@|;THt;T|;THd;Tx;THT,|A@cA;Tx@8;TH0;TKѐ};TH ;T0;TH;T0;T;PcK,@0XT0!P|} N X0!P}N C<exprp|!HKKH0!@}N A$expr|!|Ke;PK;Pbt(Ec;,A(bHc@,0;@ KO;DX;T}0!PN Axxparse|!H8H9X}0!PN A<evalx|!,|8@0;ܻH0!PN ;D;HK`ec0;KA;D,A3;cX0!P}N A|evala|!|;P;L(N((@ ;THbt;c@PK;PK;Pbt()c,ATbHc@,0;@ KO;DH,,bHc@,0<@ KO;DKEX;P}0!PN Asimplest|!|K;P(!@K;P;TK;TXL}0!PN ALsimpler|}&!|;P+-(~(!*+ALB3A@DKe.+;PKMAD;T,-,!||d4AT~A ;THTH} 0!PKXT|0!P} N Csimple|}&ؑ!Te>`(?([0 8`@T>@`(_(z0AT.bXA|{.T>,0T:\Ah^.:,32;A(\@939H<;\;&A0KA,38a:AKAa:89(@0([@8`4`/@ 8,L@˂AA8`h0!`}N A,xarray|}&ܑ!p;`,a!Aēa8@"|0i< a#,@a|8`0!N KI7C; @c#}0!!N !@`_!D, ;A([+ ]1?@a8a?H+ ]c1!`X@;, 0X8A,X!HO0a`K a4$0a`,8OB3A KO0a`K]O,0a`A 3A;KՀAw@H0a88KyOc#HA a?_1?, ([+ ]@0a8KEO,!8!A?(]@`7;;;c_c, .(:A,@A+ ]1AȍIa, (:@3/2,@@c_c, K!D0a88KOA@!cCI!)0!|} N C  arraybounds|a!p`; `;88|+`0 @}U>0|8@`3c0(]8AH`|+`0 @}U>0|@8@0(]8K,@$|`d0g<$KO8`H`d0ah8KMOh(\0h@i+&@0i(&A$|0h0g@ a*+ _(zOX+A([A88`,A|0h0g0|8/|@(0g=|KOx0!p}8`N @8|,A(0h=KaOx0!p}8`N +&@8+[|A(0g=K%Ox0!p}8`N ;@DcKA,08`A`x}0!pN 0@0D|@K`{cf0=.0> 8`KNmO,,a@@0D@ KH|c0|>A K]O8`H`DKY,0|>0@@K5O8`xtH8D8`Hx0!p}8`N xt0!p|a} N Cxparsevar|!`ee`(\3@b|;A0>`0a@KȵA0@`8<080h0>t8`KKOc0>x0>8`KKuOb0,blAH0>0>8`KKEO0v>0KQO0!}A8`N |T:|8`KJO @0,AH0>0>8`KJO0v>0KO0!}A8`N T:;Q.T:9.܁Y0 T:|8.UG:|9. Y0 T:|8.UG:|9.`Y0 T:|8.UG:|9.hY0 T:|8.UG:|9.Y0 T:|8.UG:|9.ЀT :}Q.Bx|8|8T:8|A. ||8T:|8 ||8T:W4|8B |T:|8.0?8` LKHOWb( ;%@@0?$T:|8.8`,A$KHO8T:|z:KQO0?8|.8`8KHO0v?D|.;@K]T:|{@.|.KO003Z. cKU@003Z. Kb888H!0v?H,A|.K O8`0!|A} N Cdodo|ܐ!`ww``|c}ce30?d;?8`8KGaO8+ 8@$3{( @3{( K+{,,0@198`AH{?X( h`/1y;`\@$0( @0( Ky;{8`A071)@H8`,KA71)K1I,949`1;}A+{0g((1 @`g()+}0@a ` ,8`@H4@@a 3*1 1*Aji1 1J30H$@ 4AD7 1J0@,A+{0g((1 KT,Hl8)0 1J0K0AO@(|u.||u.@8|.0`K-OH$|.0aL|.|.@|.|.K~E|2s2139333@x`U:T:3`|AtcB(000N}@,, |r|@,0`8KOH|.0aL|K12R22@8`A\|.||.HX|840!0|} N 84|0!0} N Cdoshift|!,|؃@HO,l8;@,ALKOa<lKuO,a<`d@KOxH0lK=Ox~}0!pN ,c3?@0x@0KEA`fcc0&(|@H0@dK8O`0@h0@x8`K8Oc,(0@HA8O|00{@|@PKuO30|(@K!O,8``~A0c0{@K9O;@HH0{@K%O8`h0!`}!N h0!`}AN Aprtopt|!|9@D,A8|0PBT:| 00dT@D0@K|O@D0@T:}@00hT@DPK{O@DT:| 0dT0@D0@K{O}0@8KUA@DT:}@00hT@DK{}O<}30@cKA@DT:}@00hT@DK{=O}c0@K݀A@DT:}@00hT@DK{O@D0@T:}@00hT@DKzO@D0@T:}@00hT@DKzO@D0@T:}@00hT@DKzO@D0@T:}@00hT@DKzuO@D0@T:}@00hT@DKzQO@D0AU:|1@D0`TKz-O@D0A T:}@00hT@DKz O@D0AT:}@00hT@DKyO@D0A T:}@00hT@DKyO}0A(8@KaA@DT:}@00hT@DKyO}0A48K)A@DT:| 0dT0@DKyQO}0AD8KA@DT:}@00hT@DKyO}0AT8KA@DT:}@00hT@DKxO}0Ad8KA@DT:}@00hT@DKxO}0Ap8KIA@DT:}@00hT@DKxqOЀ}0AK A@DU:|1@D0`TKx5O}0AKрA@DT:}@00hT@DKwO}0A8KA@DU:|1@D0`TKwO}0A8KaA@DT:}@00hT@DKwO}0A8K)A@DT:}@00hT@DKwQO}0A8KA@DT:}@00hT@DKwO}0A8KA@DT:}@00hT@DKvO}0A8@KA@DT:}@00hT@DKvO}0A8 KIA@DT:}@00hT@DKvqO}0B86KA@DT:}@00hT@DKv9O}0B8KـA@DT:}@00hT@DKvO}0B 8@KA@DT:}@00hT@DKuO}<0B,0KeA@DT:}@00hT@DKuO}0B88K-A@DU:|1@D0`TKuUO}0BD8 KA@DT:}@00hT@DKuO}0BP8KA@DT:}@00hT@DKtO@D0B\T:}@00hT@DKtO@D0BdT:}@00hT@DKtO@D0BlT:}@00hT@DKtyO@D0BtT:}@00hT@DKtUO@D0BT:}@00hT@DKt1O@D0BT:}@00hT@DKt O@D0BU:|1@D0`TKsO@D0BT:}@00hT@DKsO@D0BT:}@00hT@DKsO@D0BT:}@00hT@DKs}O@D0BT:}@00hT@DKsYO@D0BT:}@00hT@DKs5O@D0BT:}@00hT@DKsO@D0BT:}@00hT@DKrO@D0BT:}@00hT@DKrO@D0BT:}@00hT@DKrO@D0CT:}@00hT@DKrO@D0C T:}@00hT@DKr]O@D0CT:}@00hT@DKr9O@D0C T:}@00hT@DKrO@DT:0|@D0`T0C(KqO@D0C4T:}@00hT@DKqO@D0C@T:}@00hT@DKqO@D0CHT:}@00hT@DKqO@DT:}@00CT0hT@DKqaO@D0C\T:}@00hT@DKq=O@D0CdT:}@00hT@DKqO@D0ClT:}@00hT@DKpO@D0CtT:}@00hT@DKpO@D0CT:}@00hT@DKpO@D0CT:}@00hT@DKpO@D0CT:}@00hT@DKpeO@D0CT:}@00hT@DKpAO@D0CU:|1@D0`TKpO@D0CT:}@00hT@DKoO@D0CT:}@00hT@DKoO@D0CT:}@00hT@DKoO@D0CT:}@00hT@DKoO@D0CT:}@00hT@DKoiO@D0DT:}@00hT@DKoEO@D0DT:}@00hT@DKo!O@D0DT:}@00hT@DKnO@D0D(T:}@00hT@DKnO@D0D4T:}@00hT@DKnO@D0D@T:}@00hT@DKnO@D0DLT:}@00hT@DKnmO@D0DXT:}@00hT@DKnIO@DT:0|@D0`T0DdKn%O@D0DlT:}@00hT@DKnO@D0DtT:}@00hT@DKmO@D0DT:}@00hT@DKmO@DT:}@00D0hT@DKmO@D0DT:}@00hT@DKmqO@D0DT:}@00hT@DKmMO@D0DT:}@00hT@DKm)O@D0DT:}@00hT@DKmO@D0DT:}@00hT@DKlO@D0DT:}@00hT@DKlO@D0DT:}@00hT@DKlO@D0DT:}@00hT@DKluO@D0DU:|1@D0`TKlQO@D0DT:}@00hT@DKl-O}0E0EK̀A@DT:}@00hT@DKkO@D0E0E08`K'5O@D0T8889K{OX0!P}N H0!PN A initoptlist|!|8`a<0E40ED8`8K&OK@D 0EH0EX8`K&O`0E\KO0E`KO<~00c|;<@K%O,8`A h<0EKAOa<0c0| a<@KO,8`A (<0EKOa<0c0| a<@KO,8`A 蓡<0EKOa<0c0| a<@KeO,8`A <0EKOa<0c0| a<@K%O,8`A h<0FKAOa<0c0| a<@KO,8`A (<0FDKOa<0c0| a<@KO,8`A蓡<0FxKOa<0c0| a<@KeO,8`A<0FKOa<0c0| a<@K%O,8`Ah<0FKAOa<0c0| a<@KO,8`A(<0GKOa<0c0| a<@KO,8`A蓡<0G$KOa<0c0| a<@KeO,8`A<0GTKOa<0c0| a<@K%O,8`Ah<0GhKAOa<0c0| a<@KO,8`A(<0G|KOa<0c0| a<@KO,8`A蓡<0GKOa<0c0| a<@KeO,8`A<0GKOa<0c0| a<@K%O,8`Ah<0GKAOa<0c0| a<@KO,8`A(<0GKOa<0c0| a<@KO,8`A蓡<0HKOa<0c0| a<@KeO,8`A<0HHKOa<0c0| a<@K%O,8`Ah<0HtKAOa<0c0| a<@KO,8`A(<0HKOa<0c0| a<@KO,8`A蓡<0HKOa<0c0| a<@,KeO,@8`x0!p}H<0H̉,@0HK]Oa<0c0| a<@,KO,@8`x0!p}H@<0H,@0IKOa<0c0| a<@,KO,@8`x0!p}Hܓ<0I ,@0I KOa<0c0| a<@,K9O,@8`x0!p}Hx<0I,,@0I@K1Oa<0c0| a<@,KO,@8`x0!p}H<0IL,@0I`KOa<0c0| a<@,KqO,@8`x0!p}H<0Il0I0IKuOa<0c0| a<@,KO,@8`x0!p}HX<@D,@<0a<3PK%,3A@D0a<| @ K0I0a0| |dA K|%AccK|=A,}`dAL,A8`00,A`0KH0}h0!`}aN Ackspread|` 98`L 8`N @test|}&!:a9 ````aa<bbbb}8`|+``0c @|aTd>a0|,,.Ad,@\,@b@ 1@ 2@Wz.V:8`AKzA`sccKzA6A352W-21w bcK^O,}@T,,TzAA,A}8`|"+`i0c @|aTj>0iCPAT9`bcW:@W:|.3HH0jH3A 0H0KAbd|uK[OT9Acz|@c_A \c0`KyiA6#A}8`~|r+`d0c @|aT~>}8`|+`i0c @|aTc>||d|i_ ,A; |0A`,bW:@00qab-3b,@0a0|@0|Kb@$)b,c|9||@|0f`d|@I@<0, a|@A @0,|@@0d|@@< ,`0|@A @ 0c,|@@0|@@@bD,``0`|@A @D0, C|@@0`@0}};HB|0d( 0@$0+ @0+ K0d0`b$KOb`10|@KIO,Ab|33@b,K H,b@|3` aTbF0|̀@4KO10|@KսO,bA 3|@ aTKAX,AbcKuA,@<32,~2A KuŀA@~,K,AbKuA,Ab#KuAXT0!P|} N T} 0!PN Ckwdhelp|}&!:5``,.bbbA`Tb } 0!PN c0eKO8-HȀ-0eKmO8H,@b@ 2%@ 2e`U:KtA.aA`e3eb3|c|;@ H @b0a|K!O|;,AA|+c3 @|T>|}KtA0,~(|,A 39}xA3|A2;|+|*3 @Ah@bba8babbKeOA\0eKsyA`r-A؃: ~ݐ~;|+c3 @|T>~;|+c3 @|T>||0|0_(},A/r|0A`,bW;:@ 01(-3b,@0a0|0@0|0Kb@$}bJc|A|x|@}(0`|@&@|gKh1A,;8A{!|+|*3 @T02|g @ 8`Hp!|+`0 @|T>|`8KgA,88A!|+|*0 @T02|8g$@ 8`HT02|8(!};|+c3 @|T>|`8Kg)A,;`8A!|+|*3{ @T02|g,@ 8`Hh!|+`0 @|T>|`8KfA,;8A!|+|*3 @T02|g0@ 8`H!z`|+`0 @|T>|`8Kf=A,;;A!`|"+|*3 @T02|g4@ 8`H!zd|+c3 @|T>|`8KeɀA,;A!d|"+|*3 @T02|g8@ 8`HzLK8`h0!`}N TAH0!`N A8cmpush|A!b008`KOB,T028`A:|iP.}iPeĀkl k,k{{ATe8KdO:T02|Pe ;KdEA:T02|( :T02|P$,8ALKdEO:T02|(e$;Kc݀A:T02|($:T02|P,|,8';;AHKcO:T02|(e,KcyA:T02|(,:T02|P0~,8';AHKc}O:T02|(e0KcA:T02|(0:T02|P48',AL{`Kc!O:T02|(e4KbA:T02|(4:T02|P88',AD{dKbO:T02|(e8KbaA:T02|(80008`KO}h0!`}AN h0!`}AN Acmpop8 ,( M @,( @N @0untab|}&ܑ!p``,``, T@0|H,; (8@3,;):@ ; {;}A(0|KO0!}8`N c0@H#`zcFb008`KmO,cCA{.aD`{|@8 8@P||+`0 @|T>0||1@ |@@aD0caDK]%O,0aDA0|0|8(}@9<3`a|g@KXA5A$;|:+|u*3 @䀡䂢x08`8K=Ocb83KWOUMP,MH;A8`H^U`tH\b8Hw,@D0mKO,AaKWA0!|8`} N H.܂,b "0Ob PB|; |&3 ) 0c8`K1O00b8`KOA4|W:|8.|8|N 0mKO,AaKV=AbH,@b,,Ho,,A HHRO,oA@`~,A0cHRO,3@ c,@oK׍O,A8Hu,A <08`8KO|! L@;|+c3 @}U>|g@KUUA,aO|&A;|+|*3 @`e0,8`8KOo;KލO`~08c8`KUOAoKO,@HȀ,A0HcKO,A0LcKO,@`9,8A8 8 ,A `o;KmO`}cH؃,;A;c0Pc8`KuOH0`8`8KYO8,A8,A ` ,A `o;KO`}c0xc8`KO0c8`KO,@Ȁ,A08`8KO,@8,H8@8,A ` ,A `o;KO`}c-,8LA8Ԁܐ08`KOA$Ԁ,AȀ,At,/LӂAA$,,@|AЀaKyQO,@01?):,LAda?1?):,KMPMH:;;|+c3 @}U>080K,@8MPMHK_,@(3v;|+|*3 @H$;|:+|*3 @(/AH3|+c3 @}U>0@|+3 |*3 @|+c3 @}U>0@|+3 |*3 @08`8KO@3K,A<|! LAaKPA,AaKOA8`HЀt,@$0mA 0(H04KO|! LAaKOA,AaKOA8`Hl@`0m0@|+3 |*3 @ԁ HG0H0H c0pK9O,Ah(.@1)/@ H8*0GW,8A88 ,A `oKO`q0xb&8`-KOd@(8`|+|*0c @H^c-0b&;8`K}OTA;ԓAA@؃dH0c8`KAOMHd;}P} (, 3A|1~8`@4H @$c'3})P|`@B@c|1J@a~, HHH, A1~8`K0c8`KO,@HdH0mcK{O}஀,1 A(>1, 'A>1, K008`8K Omd8Hg,AHH0H8`KO,A0m`8KzO8`H0m0KzO,AaKFA8`HĀdH0d8`KqOmd.KyO,L“BADd;|+c3 @}U>0|@,'1LA!A }(8 |@@A}91~H9H,A0mt8KyO0mxcKyOH}0,H1'-A(1),A1),K0md8Hf),A(H08`KEOHX0m|KyQO,AaKEyA8`HLAh8 d|;|+c3 @|T>0|P,'1LA!A,}@m|X@A}9|H~_9HH dH0m8cKxOcHdmd8He=,@,0mKxO,AaKDA8`HADmdKUO,@0d0mKxEO,AaKDmA8`H@,GMPAaKD=A8`H0m,A0H 0쀶KwO,AaKCA8`HȀt,@L0m.A0H 0KwyO,AaKCA8`Ht P.,A0m8Kw9OAaKCeA8`H8 P.,A0mt8KvOAaKC)A8`H0mLKvO,AaKCA8`H80\\o0b K\A,,AmH;|+c3 @}U>0@;|+c3 @|T>1}H,||H@b;|+c3 @}U>0|@HKhAaKBA8`HԀ؈,@ A 0mH0mKuOHAaKAA8`H0m.A0H 0ȀKuMO,AaKAuA8`HHt.AX0mhKuOh0mpKtO0 KZA,AaKAA8`H0mx,A0H 0KtO,AaK@̀A8`H0mKt}O,AaK@A8`Hx80\\o0b KZYA,,AtmH;|+c3 @}U>0@;|+c3 @}U>0|@||HHtAaK?A8`H0mKsO,A@,A4ccH0| 8H(0 X0 l8`83 pK O 8"KMO,A3 t;8`H?)`v.Hc8`KթO@DKMO|@40r |KkOb|0!} N ;,8`A3 3R 2 |b P: 36 *  8H|8c 88`KObbcD8`KOAtW :|h||N KLO|8`AH>`v36 *  8K0r KjO8`H$0r KjObH0r 0bKjO8`H 80 8H؀ 8,,@A܃8@0 8`8K Otbk0@0KP9A68`A8 |;|+c3 @}AUJ>0|PHA8|;|r+c3 @|T>0|8HH c0 a8`KaO8 `|;|+c3 @}AUJ>0|P5G|@(}IH @( B@gH1bH 8a,; @`a,0r A(KhOPaHTrH8`H(0r ,8AKhO8`H~q|+c 39 @|T>0 8c%8K=O,9pAc$,0r A0r 8Kh5O8`HKh%Oc#HTP0 8`8KOH\ a,0r @KgOh0r (H0r $KgOh0r (KgO0} KLA8`H:`vK@0!|} N Ccmtxt`9 0 \H @cmkey`9 0 `HP @cmkeyx`9 0 dH @cmswi|}&!5`m8````aa0a8@"1 hH",@2q l, b9`c@(0q pKfMOh0!`}8`N 8` |a8`|z+`k0c @|aTl>0k9`|laVzaqHqP0 0 b:8`.KϩO0 0 8`KϑOb,98`@Dbc8HR-,@@0q KeyOdh0!`|8`} N A8`H8`~0 0 b8`3-K OBV|V Pa0 0 8`KO0 0 c8`KOH0 0 8`KέOKFAOa.3 qH)~0 b8`KuOApb|W:|kc|k|hN KF9Obk|X8`@ ,8`A8`H7`~K0q Kd5OcH 0qcKdO8`tH 8`tH |qH.,8@1k|k9` }a|+3 |*0c @z9}ٮz0q |XK\OzHb|X9` c}a|+`k0c @|aTc>1k|k9` }a|"+0 |*0c @|~qHv,A0q 8K\uO8`H,,V@(v,A0q 8K\AO8`H@\,ADbЀc.@4b Pc,A0q 8K[O0q K[O8`t8`HXa80 }c|cXTc:|m0 8`KōOa8V }|c`Tc:|mc8KE,Ah. V@\,ADbЀc.@4b Pc,A0q8K[AO0qK[1O8`t8`Ha88}c|cXTc:|mcK,Aa81C~ }c|cX@T~:|jP|jTc:|m1m1 .l|8@4Ka,l8@KM,Aa8|cT~:1J~ @ .l|KHa8}c|cXT~:HT~:a}..qH|mXAiA,8`Ac8HD,Ah08abHM,8`An,@ 0qpKWO!0H 0qaKWO!00ab9Ka,@ bc,A0qKWOzc,@<@0qKWeOH$@ aK 1q`dacKWAObh0qKW)Ob0c K<-AHhV tAbЁk. @tb Pc,A0qX8KVO0q\KVO8`H@0q8KVO8`H,8`H)်`~00@,HGO`~0Hc;8`8KO,@40X0p8`8KO0!}A8`N 3!8`|+|*0c @~ᮈ0ztKO,A HFiOHO`~0|cc8`K5O;(+(-A@@;a3,A,c( 0@i`,0( @@0!}A8`N ccK!A,0A|`,@H ,@0!}A8`N ccKYMA,`{|A`00cf8`K5O,AdcK A,0A}`,@H ,A,c+ 0@i`,0+ @0c8`8KOc|,AcH aA,0A}`,@HH( +-(/A (.A+_A8`A@ci3,A,c+ 0@i`,0+ @0c8`8KO0c8`8KO(0z0cHF4@00c8`KO0!}A8`N `} |HT:}:08`KaO,/,/A4AhAA0!}A8`N HC1O`~0a3$3KVрA0x|0`cK6%A,A(!$0a%!;|+|*3 @H 0z!;|+|*3 @!8`|+``0c @}!U)>0H0cc8`K=OHHBAO`~= *0a3骫KÙA`}0aKUA`f|0}?})pU*})P}IH}IPUJ:|0 A `330L0ccK4ՀA0a$,A(!$3%!8`|+|*0c @H 3X!;|+|*3 @!8`|+``0c @}!U)>0H0dcc8`KOHW`8||~HO3c!;|+|*3 @0a$,A(!$3%!8`|+|*0c @H 30!;|+|*3 @!8`|+``0c @}!U)>0H00H0 cc8`KaOH0cKO`},@|,+ (-A$(/A+.A(_LBӂA@H?O3!;|+|*3 @3$0z!;|+|*3 @|,A!8`|+|*0c @3!8`|+``0c @}!U)>0H0cc8`K]OH 0cKO`},@|,+ (-A$(/A+.A(_LBӂA@0~H O3!;|+|*3 @3$0z!;|+|*3 @|,A!8`|+|*0c @3!8`|+``0c @}!U)>0H0cc8`KUOH0cKO7@|,+ (-A$(/A+.A(_LӂA@0~H O3!;|+|*3 @3$0z!;|+|*3 @|,A!8`|+|*0c @3!8`|+``0c @}!U)>0H0cc8`KQO,AKA,AK A,AKA,A|KA,AhK̀A,ATKA,A@KA,A,KA,A,,@3c!|+``0c @}!U)>0|`H!|+3 |*0c @!b;|+|*3 @0$c8`8K!O0!}A8`N @ KـA,A KŀA,AԈ KA,A KA,AKA,AKuA,A (:@x(:@l( (-+_LFA@P!8`|+|*0c @08c8`8K%O0!}A8`N 0Tc8`8KO3 3!23Htc{a,;AX3( +-(/+.A$(_A+:A(PA +p@lci 3{,( Aci/0@(I3{( @I3{( K, AA`|3{H(AA+aL3A A@xH A,3A({KA,@c{,HL,:`AX0lce8`8KeO0!}A8`N 3{{,A( +-(/+.K|@,LA:`,,A0aK)O,,@4008`8KO0!}A8`N @4008`8KO0!}A8`N 0a<8KOD1!D( 80@D0@0P!FCTcH8A4008`8KO0!}A8`N cKEO,@4008`8KO0!}A8`N cKO,@dbDc8 8H94@4008`8KmO0!}A8`N 2\0bK)A!8`|+``0c @}!U)>0|H,@,c@cbH!8`|+``0c @}!U)>0|H,@,cAcbHpcKIA`~cKI}A, , OE BAccbH4A<, @4cK O,8`AccbKI%A`e0a\0@K(Ac0H8`8K O0\ce8`8KOcKHՀA`~,@40p08`8KO0!}A8`N ,,L1A8b0c%bcK'ـA0!}A8`N Ac`03H003ē;A3(:+P(p+AA(aLBӂA A@ce08`KO+P(p(A+aA LӂAciAp 3{,( Apci/1_@( 3{( @ 3{( K,A8A4a_}ci3{,A(:+P(p+AK,ȃa00(c8`KO0,8`c8KO0D8`ce8KO0\c8`8KOcK O,8`A8,@ ccK O,8`Acr,@ cK O,8`AccKFUA`,, 0 LB+A`.,,AA@$0t08`8KO8`HtbCKEA`},;@$008`8KO8`H0|YAHbc,/@A0KO,@ c0L8`8KOKO,bctA ,Ab~,,Ab/p@,0|;@OBA|([tAHe,AKA|E,0e@|B0~0||x|yA0{TK6OH,H<0 08K O9 : ,H9,:H H,@ ,Ax0H0\8`89 KOHp0p0xa8`KO,A,@|8`xt0!pH4U>,Hd8`H}H;{;}b;8,A P8_00 8`KO0$00c8`KO,Ap048`8KO0( @(0* @0* K`8H%,@00{PK*qOtx0!p|a8`} N }8'; KO;}|+c3 @W>33@D( @8~,3}@,( @~3}K`e0h8`KuOtx|0!pa} N B:0:c%8`8K)O08`8KO08`8KO3|@@x."ԂBȋ@,:@ăL,A$^,A,A:3;33333cc$8`KaOnHM`o-c-ca8`K5Obcc8`KO, AÁ, A1)@,A/ , /@8AALU>Aa008`@KOĒ bKiO,/,-LB@cc$8`K-@LK,@LKLBA<@cc$8`K8`8KO,HU>HU>,@ ,@ T,ADbKVO,A0;@ |cВ;H Ȓ7A@_-,,AAX@X008`K=O3,@c,Ax8`xt0!pH P}800c8`KO,- , ML3BAA(;\3;,@,\,LA4,A ;, @ H; , ,@; @;,;,#A@(P,@4,A:`-, ,@W>@@(030b8`KO,A0c0{K$O,A0 K ՀAP,@:3H{,|@@@8H,@\0{K$]O; 0;|+c3 @W>3|c8`KO8`H_P8`HLsBAt,=,:cA@`,3A,0{K#O,A0 KA{,}@LsBA L|@3|@@c3@ 0c,A,3,- , ,W>A@D-AHAT|@3A3@0;P;:`H P,A}@3H}@3@( ( A@h3038cc8`K=O}@3@D( ( c8`L@cK@3|@W>H;3|@W>@0W>,H;0W>,A,,A (\(-}@0;LLBsBAA;0<0Lc8`KYO,AX@,A0|@@$; 0,3,H:H p,,@ (@,A$;,0:H 8,?@D4,A8,,LFA K}yO,@@-@,/,-@A8 P,A 0{8K iO:3|@H {8H ,;@\; 0;|+c3 @W>3|c8`KO0{KO8`H 8`H x,A ,@|@@|He30|@|@@c3( @c@,,|@@@PHXHL P,A0{8KOKU|(@@:3|@H (8`H p-AA @h0{KO,AL( )3cLcB@;^W>KaOc,( )A LcBKЃ0 KEA:H t@-Ah,AX-,/MYRL1AATx-@8 P,A 0{8KO:3|@HW:.-A:cc$K2)O,@PA8 P,A0{8KQO:3|@H3W:.x-A|@3@4H ̓:3|@AxW:.; ;|+|*3 @h0{KOx3x8`HDLBA,@ԃx|1|@8 P,A0{8KQO:3|@HU:.x-Ap:cc$K0O,3@P|@8 P,A80{ 8KO:3|@H W:.x-@, -LQAP@:0H؃ P,A0{8KiO:3|@H,0W>AL8H Y,H@3|@@4H ك3|@AxW:.; ;|+|*3 @h0{KO8`H\|@AT P,A0{8K}OK{8`H3|@A$(0AD*9(@+Z)aH*9(@+Z)a@A(z@A@XH 3|@A (0A+9(@*Z)a@A(z@AAA|,At(0)9*@(ZA`(a@AT*z@AHADH 3|@A ,A(0)9*@(ZK38`PH3|@@$H 3|@AKz8`Pxt0!pHH0{W>K}O{8H ,;@\; 0;|+c3 @W>3|c8`KO0{K O8`H8`H,A {8Hi,@\; 0P;|+c3 @W>3|c8`KYO0{dKqO8`HP008`8K!O8`H8H,@\0{KO; 0;|+c3 @W>3|c8`KO8`HxP_8`H`;00,c;8`KmO, -?,LN BL3A4@,A(000@c8`;\K)O;30H0|0a8`KO8`H, 4;x@;v8`H , 008`@|8KOK ,-A,000D8`Al 8KQOK0`0l8`8K5O U>,K@0D0Tc8`K O,W>A cH50Xc8`-K~O,@P@$, A0:H:H:H3|@@@,:K봃 P,A0{h8KuO0{l8KaO;8`xt0!p|} N Cgtword,888 A`"I0|@1j@L1J,0A40|@@$1J,0K؁"I0`N @addbuf}&ؑT;(:A;`)EH;{;`}E; H|@; ;|+c3 @|T>0|(,'/8@8`N 3;;@v`|+|*3 @`},@h|+c3 @|T>0|0`5|0A,|H @ `0+ @@`0~)( @$0c+ @0c+ K,A@0|@* @`0+ @`,@ ,8@4A@@P+=(:@ OA<( + NBA,39,6H3ZA@0Kxc#} N B setatm|!b^c,,AH008`@8KzO^<,?,8`^L3BAHcHbc,,@bc@(b,0@88`H ,8`A8`KuOXL}0!PN ,@ H5AXL}0!PN 0Ld0!PN X0!P}N A@cmdgetc|!HK OH0!@}N A$ cmdclrscn|!HTd>0`KuOH0!@}N A0cmdnewl|!HbL0c,AKOH0!@}N 0!@N A@ cmdchardel|}&!T>L,,Ac) *AT0}8KO0}8 NLBK}O0}8KmO0}@;^W>KUOH0}KEO0| ,A KAAXT0!P|} N D0!PN CcmdechobcN @ cmpeek|}&!`g89,8`,\A 09@d0,{@`d90( /d,D-o@8A0,O/X.xA,AALA<D8`} H$09` H8A(AD8`} 0!@N 09`H09`87, ,88`A&`, + 0|@`|HLBÂ`*L+A`0e, 00(0@|A@,/A4LBA,|H@$*0e, 00(0@K,,A@lD8`} 0!@N @Pf`H4T&6f@8`HPH,T`>0|x@8`H,,0A,(}L@3BA`HD|} 0!@N 0!@N CDxxescT`>(0(9+A0`+FLD L (a0`(fO\˂L 0`LD L 8`N @Hunhex|}&ܑ!6`}``8`@4Lda\0!pN ,8`A|;xtHt; 8|+`0 @}U>00,AT@P7; @3]||T:z 8|+`0 @|T>0|0|b8@KO,Az cb8KOc|`4T~.bz 8AKO,@p@39|@||T:KP||T:|}..bc8KAO,|8`@(AfH,|A;fxt0!p|} N L0!pN C lookup|ؐ!7```8`A; 8|+`0 @}U>0~,AA,PH0!pN ,}AhH3:||T:{ 38|+`0 @}U>0|@|bc8@{KO,Ac|@||T:{ K8`x0!p}N `AX0!pN PH0!pN A Lxlookupd48`N @cmdsquobc4N @ cmdgquo} $$$$}$}}}4}4p$000088d8| 4 ,,,ҴӤӤӤӤӤ`p LՀL֌|}&!`q-V,:@bOLN3AbF0m00KO4m,@@@<0mKO480!0|8`} AȂ!N 9 1`};|+|}*3 @`( \@a(%( &A@1aMȉ(%( &A@L00aKO,m@,840!0|!} N ,E,A@KuO,mA`8` KO,A@0mKyO8|L40!0bC!} N Ԁ,@@0m K)O8|L40!0bC!} N 8` KEOАm`f088`KmO, @L8` KOaKO8|L4bC0!0!} N 9 };|"+c3 @W>3aKO,A:@0DabF_8`KlO48|0!0!} N 0mP00KO,mA䂂ā.6U>KOb" 8bKa9OB TmԃH5K`OȂb:@$U>K9ObCKcOH|KcO, 9ĒVApKaO[, @Kc)Oc@00̒^KaO,m/,@L,A,A @DK0mK}O|KcOK$M0mK]OHKO,AhNbK_yOc mĒL84H,g@cU>K OKOmU>KO, A\K]O,@0mKOĚAI0HHaK]Om`fa0 8`KjYOH 9bK^O, @0m KIOȒ_, A:@bCLHcZKOmbCKO, @p33-,3<3@c#ccbFKOАm`fc8`KiOK`O, @c#ccbFKmKO@0mLKiO, @@bK]Om,@0mPK9O8`mc LHc, @0|8,@00 (KO0!|A8`} N 3PA;`|"+|*3{ @PP(\@Q(%(&A@3Q/z(%(&A@ 33?ccdc%K O,,zA(@L0 @0 T08K O,AcKO8`gH0 X0 l8`KcOA4b0 p0 |8KqO7A@;7,,@t0 0 08KiO,A\`H=0 c8`8Kc1O0 8`8KcOЈH@cdcc%K iO,A,`@$0 KO8`0!H̀KO,8`A0 0 08KO,A0 c8`8KbiO0 8`8KbQOH@`0 $0 808K1O,A\cK5O`0!|лA8`g} N A4b0 <0 H8KO7A@;70 L0 `08KO,A0 dc8`8KayO0 x8`8KaaOHIHЈ.7,,X@(cKMO8`gH <0A@,bPH 0HH -O{,@0P;`KOA|+|*3{ @0 A;|+c3 @}`eU>0|@8`K`mOcKEO,,X/Y@80 A ,X@ 0 H0 KIO8`H8`AA Аg0!|} N 0!|} N `0!|A} N Cpdodefb̀c,L 0` N @getdname,, A|Tc:A@H0e N |d.N @@getdnum,/,,1@ 0` N ,'/Ax/_Ap,7Ah,A`/)AX/+AP,*AH,$A@/A8/`A0,0A(,A /!A/fLBA A@0d(0@`d`N @chk_ac|a!`}bc`,8`;@cKO,c,@Pc3{3@4K}O,8`Al|c3{@ KcHLc33@4K1O,8`A |c3@ K8`h0!`}aN P0!`N Acallisld|!`~bȀ 8`,"lAi HKO,c8@X0!P}8`N KO, |@8|@8`KqO|A0cTc:|}.XH 8`X0!P}N H0!PN Axdial|}&!p`Ts:`f`;`b|: |.~:`0 8`K[Op@,AKAp@-,@80o KOb|0!} N :H Abt,@2 -Ab,@3 Abp, @1 B,@2 a|<(+0gAh|s80 a0abccKA0p@0K1Ob||c0!8`} N "1\ya,O,o;@4A0o KQO|b0!} N |3( + A@8aG1JOЌg( * OF@1JOЌg( K, ((0APA KA,oA31COЈc,,AA( + Kl0aKEAO`~a3;j( + A@8aG1JOЌg( * OF@1JOЌg( K, ()0APA HKA,oA31COЈc,,AA( + Kl0aKA`0K`}G+ ( A@8`0ЍC* + Lӂ@0ЍC* K, A4}+ -,* .A A@<`0ЍC(-* .OF@0ЍC(-K, @ 0goЀy0KO,AȀbT<,o/0g@4A0o xKO|b0!} N |s: #@3 Ab,@3 bx0 ccK҅AO0 a0abcc810C8:`@bx3~!;|+c3 @}AUJ>0P|c8@ KO6oA,2s| @~!;|+K,@Vg:Bxc: |8.KOt0 Xbf8`KSYOoЃ||Ј~,(\OB3BAlcK9A,AcKIAT>(v+fA@00aac!300HOHA ,@3 h0 lb0accKAHAb,@0 xAbC, @1O |,,@00 @0 /b0ac8K͍AH 0 @0 aIb0ac KaAH3;|,AtKA,3.o@@0Јc,A4KA,o0@Јc,K؀Јg3~Ab|cg,:@,;@,@b33 3c0a3ZKyA8` |a8`|+`g0c @|aTc>0gce0a08@KO,A|@c0aK/@t0ab0 `KA8` |a8`|+`g0c @|aTc>0g@(0a0ce8K=O,@:,0gP}a0 0abccc KـAbx0 ccKAHT30 c; KʡA8`|+`g0c @|aTc>0<@0a0c8KO,<0a1G@|P9@GAX,@0 AB,@3 }|(-+.A@8a1ЍC(-+ .NFӂ@1ЍC(-Ka0 0abcc KəAbx0 ccKɁAHbT1G/o,|sP9@CLBA$0o KOb0!HL@0 0A|b,Ala0 810aHl|aЛcK,|aЛc@ 0o HcKOb|0!} N 3 4a0 810abcc KȅAbx0 HccKmA0p@0KOb|#8`0!|} N C$dncvt|}&ԑ!`7`-;A@ c} 0!N ; ;|+c3 @}aUk>1)}+H8`A c} 0!N KA7C;`@(|c0!A} N cHmA0DcKODcKIO,; @aD.KOH̀aD0 PHmA`|-@ "aDiKO.H0 TcHlA`y.@cKOHD0v XcKEO2c2H0 ;c#K޹O0 0 0 0 1 16 c#KޕOzccC8HmyA,:,Ac#0 3;@KQOKcC8|+c3 @}aUk>1)}iXai1k}+aj0L@8, 1k( A$iaj1k@, ( K8K)Oc#0 1v H @}=, B@}PTX\!`K}OK0vKO;AcHkYAAc#HkIAcCKAc0!|} N C Xddcvt|}&!4a8::`:8`A8,@(: ~!8`|2+0 @|T>0@8`K=A58`AB́ -.; :;`9:@@W:|@,|o.0 HiA`y-@0|o.3{KO,AaKA9K ,,LB3BA|.0z$K O,3{@9:@ac%88KSQO,;;@$A0c#HiQA-; :K,A~!8|r+`0 @|T>|`0KՀA7A0~!8|r+|*0 @088K5O,(;A@ :@K,(+At@;a,(=AA0488KO,Aa0<88KO,Ada0D88KqO,ADa0L88KQO,A$a0T88K1O,@;cK}A-, ,/@A LA@A܀p9,@$0z aKO0zX8H;O,3W`:Ad0|o0.c$cK,@00zxK۱O0zKۥO:c-; K:@9c-; K,@0zKaOA 0a88K9OH0a88KO,A~!;|"+c3 @|T>0|LD BORLB3BAADac8KO,@(,A~!8|+`0 @|T>0|@|`@@K݀A,A~!8|+|*0 @ ,T:A0, |h1.@u,A KUAcKmA,uA(c~!8|+|*0 @KD0zLKO,AaKA 8`H~!;|"+c3 @|T>0|0|@ub8KAO,@hK,AaKAz ,,LBA 0zp,o@0H 0KO8`H@ 8,;@D33~,AKA |3@~,K2sK0z(8K؉O8 K$0zKqO,AaKA 8`H@0zXKEO0zK9O0zK-O,AaKUA8`xt0!p|} N a<LH0!pN aaO,nA@!<'KiO,n@0!|} N ,@2,H2,@0Ȁ0ЀbKeO,a0~8,@4?0({@$}?8( }@}920`! LAc3?,@@|3H8,ADKA@,A KuA@|3@,K,@8,H ,@L,@<@0nKOH 0n@ 0H0KѵO8`H $0nK%O0 8`K;]OЈgHA,A: ,@DnbdK6O&@40n(@ 0HH0LKOH, O&! 0db8`LMRBK:OA(,; @0nlKO8`H 8! L@`:HXЉ'(=@H1gnЈ:( @0ag1knЍ'( @1knЍ'( K@,,@tAn4HnK4@0.A(0nKO8`H p0nKO8`H P,(@,@@@0-@cH-cK~OH-@ăЀ,@`Ā,@PЃccKO,@c0nK5OHc0ncKOA0-@d,@XĀ,@H0nH -0n@0(00H0,00bKιOK `w?<3cc&cEbdbCKi,2R@@|bCbdcEc&@K̀,LKBA5P2ހ;@@0c; 3Z`b||P02@P}} `@0g@@@` k@0B1k339AA$@P,@DĀ,@4bA, @; ,;@l3]?338bcc,}3@0\K!Occb@},KA|A0np|KOH8 8`H@@x-AcH cK{%ObA HK{ O bdcEc&8`KQ,:8 @8`H@xn,A\4.@HOa.A,@:@0nKO:HL,0n0@0ԀH 0؀@1܀H 1K˩O:@"3G3"T:03n3)8:23c}cc.bK=O@0n,A(K%O@@3,.0nK0nKO3@23KbHP"pg<), ;!,:A@<8`KvOt,@<,@pKO7A`@(`! 0nL@ 0H0K=OW@0`! 0nL@ 0H04KO<`! L@,0nD8888H[IOtHt"8|HА:BĂb332-0@`0nHKyO,!t'8`: @A3g?H@;:.|80ndA KOt,21H,@ ;A;,@ `.c#K,An@|0n,Ah;KȥO0n8H(O,a0|HbCA K%Ot,21H,ccKuOnKObCK%O"ci}1, b%b,At0n@ KOc$0n,A KO8, H$`0n0KO8, 8`Hhn3, a)@3n8@8HWO,Tt@$/, /L3OFLsA21A@ H, @,/ ,A,A/A, A,LZL3LFsA؂|8@ȀĀ,@PЀ,@@,@$,0n@@ 0H0KŝO0nKőO,0<@8KO,nA|8`KA<,01}@5@9!@::`@a@KaO,@X̀@08`8K-%OK O,@.@@0K!O: H: H쀁@8`KO,@X̀@08`8K,OKO,@.@@0KµO: H: HA@p,H x@L@b,~В!@V:@0KŀA,`w@!_1J1}IBK<O,@d,@TH, @D́`\^8`00 K+O0$048`K+OlBp0`b 8`8@KO,Ap@=@-@3.@P-; ;`l,1HlHA$a0b%b&KtO,A؁p,1HpLq‘HA |A@8`|+`h0c @}A,UJ>1PA@b,A`9?l1@p0p0lbHObKAO,@9@|h1Hl1@!?|h1,@@@0a8|+|*0 @̀a08`KYA,@,L BA1;1. p}J,( UJ8A}J!j|A@}3H`, |}_H8`@ ,9`@<}=1@,} H@0c|X3B@@ p}J,K\0a8|r+|*0 @@bA(}~@V:|wB0KmyOH@A4\H`,}R,1 }@LA)Aa00h@KO@D`H, @4\1J|P,L AK5O,A@; 08`8@KO,2RAl,KЁ@.8`K=OAtl̀0D,@0T@H 0X@KO,Atp0\,@0laH 0paKOH@@,,~LB3A(@;@;` H 3|bA;@;` -"̃B`\}W:@.0yt,cA;APa,|+c3 @,}AUJ>1}P}1}@L)AaKOA<,1|@@(,L)AKmO,:A$c~KŀA3A }K0bKAAAA@ x|HtBpb# t9@0!AH} N Cdotype|!;x|,,;A\3;@@|e.3,AKAx||03@|e.3,K`KAxX|}0!PN A freedirlist|!dc0DK9O8,,/@<@0hcH@0PcH 0`cKO;H0pcKO;,A(A0xcH 0cKO;,A(A0cH 0cK}O3,A(A0cH 0cKMO3bc,A(A0cH 0cKO3bc,A(A0cH 0cKO3bc,A(A0cH 0cKO30,A(A0cH 0cKO34,A(A0cH 0$cKQO3$0},@$`}00cK)O(,Hl@`,3,,/@0<H0@0HcH @0TcH cKO(,A(A0`cH 0lcKO3 ,AL@0xcKmO7H4T<|0KmAcK=O3,@0cK!O0cKOX0!P}N Ad showdiropts|}&!p;b̂233Bcccccccc ccccЀc&b0sKPYO,;s,A0KmOT`>+:(=A@;.AKiOT`9A@KUOT`9@0(T:A|8.||N :K\:KT:KL:KD:@K<:@K4: K,: K$8Ā8`A(0s00KO O,sA$`n9K9K9K9K;K;K:K:K;K;K;K0s):b(=A@8.AKEOTf9A@K1OTf9@ 0("A"T:|0h|0|N KD8 K8:@K0bK(bK ;K;`KbKbA (=@(0p0`0lKHO,A8a 90aKbK K8 K 9 &K K09 &K|0Kp]8!<0(:0<0@0a899 K|MOK8]8!<0D:0X0\0abb8K|OK]8!<0 :0 0$0ab89K{OKȀ0p.KOt&H9KbK82s K 2sKxA (=@$0pt00KЉ&, * [AH@(]@0aK4P<3ƀcKyOKxO,A\,A,:0pK%Ot.&lH 0c8`KO,@pKO,Al8 |;|+c3 @}!U)>0|01c0bKeOЈ0 bKMOKUO.`fa -0 8`K!OA@bcCcH cCcKO,Ti>@,0p 0KO:t.&l,H,XTf|0.. At.&HXA@4pKO,A 0p LKOt:HH0p h@0 ,H 0 ,@0 H 0 KEOt:&.H,ALT0p<; KYO;|+c3 @}!U)>0|H@ ,- 0AdT:A\KwA,px@0Ѐ,@0p KO0p KOb0 0!a8`KEOAb-A0TpЀc:KO0p!K-O@tpa ԒFb0!(0!,bKOt`v.&p&ALJBA 0p!0KOt&8.:HXa,A08H}O9 &0aKO,AH ȁ! |4T~ ЀH! 0;@ ȃ"̃b,A\880< ́! ЀԀ؀܁A 0aKjO,A0aK)O-H0aKyO`~0!<0c8`KO0!L0-8`K}OA ,A,LN1A0aKO-H< 0 0 A 0 H 2| AD0!\0b8`KOa 0KVO0aK1O-H0aK5O`0!lcb8`KO,@3!|?,@3!3A;H,AL0T8|3||5, T:LE BA |0.H0!3W8|880843W8}=H|H?1)|HT8}'H}'H3W8}=H|H? 343W8}=HH ? 343W8}=HH? 1)}0|H 0aKyO`m0!ab8`KaOA\,@T, 34A(c0!0!ca1KAHpc0!0!c0KeAHP, 34A(c0!cac1K5AH c0" cc0KAԀ,AA;|+c3 @}!U)>0|fHA;|+c3 @}!U)>0|H|,9@ 3"A;|+|*3 @0,c3@@A;|+|*3 @H$,A ,3"$|f.b,AL`08KWeO,3,@@ 0,8A K̀ (b|f.,AL`08KW O,3,@@ 0,8A K̈,ATA;|+c3 @}!U)>0|H1&, 0@A;|+|*3 @,A`<,ATA;|+c3 @}!@U)>0|H}&1), ||0@c0"8KՀA,A|A;|+c3 @| }!|U)>|fH@LKnA,|0xW:|i1.A,34A;|+|*3 @0|0aKEO,@0p"d04KO,A-@A\0,@XA;|+c3 @}!U)>0|H}&|A8|0~0Hb|0~0H``0|0@,K!O,A,b-H -@A8a :KMO`d8a .KOOt&H, ,.AAH,,A,A@@8 " H48 H 0 H,AdAT" px| bK^O|b,.@,3P"hb`b\; xcC|.K5OA܂p|0|0AÂ[,00;@|x; ~.|+c3 @}!U)>0|H|ƒ|bA;|+c&39 @}!U)>0|H|ƒ|~0H`|@,K=O,bAp|3|Hp|3|3@xcC|.KAĀ 0p"l.@0",H 0",@0" ,H0" ,@10" mH10" m bˁ ˿KO(2;0:@0p"<&! K]O0p"HЀt.&H8 K 0 Kt.&H0p"(:(=A@;.AKaOT`9A@KMOT`9@(T:|yA,||N :K\:KT;KL0v$dKOtx0!p|8`} N ;K;K:K:K:K:KK]O,v,@|xH0v$@KOtx0!p|8`} N 0v$KOtx0!p|8`} N -.A|xtH88`,dA#A#A#A#xt0!p|} N C 4 setdelopts|}&!: :0̒!h!l!p!t!xb3b5b7b;~:99:@'B0̀l 6#p, tAa/#,A#,A`#,A p#,A`䃂1!!<"\!80$0$0$0a89 LK\Oā\08,@KOTg>(:(=A@;.AKOTg9A@KOTg9@ă (W:|8Ap|8|N b/K`9KX:@KPb&0v%L0%X0A<2sKRO,.,Ap.,/AL0atA40ahA0ap@K=-OK䀖K=OKԀK= OKĀ0alKKO,b=b?b:@(,0v&(A 0&0|(;}(;;a88KO0'~A88`|+|*3 @8~3Y'|+c3 @|T>0|08~|+c3 @|T>00~|+3Z |*3 @8088KiOc;0y'0'8KQO,yȃA\~8`|+c3 @|T>0|0<0ŀ8@$c|(08|0KEO,0(l @0y(KO8`H8`8KO0($K%UO,y0y(,@LK)yO0(4K%%O,y0y(<@KqO8`xH`tx0(\8`8KOЁ|(|0T:|(ycd`KO}x0!p}N x0!p}!N A tdoswitch|Ԑ!B820z(l0(|bKO,; z,@4@0z(KmOT}0!8`A!N z00KO,zATP:  0z(~;|+|%*3 @~8`|+`i0c @}AUJ>1)}JHP:Гi( \@1izЉi}dQZЉ$0,1*:A0)$ZЉ$0, 1*:@000z(0(0<8 KO,z,@ @L0!}8`N <0(0(8`KO~~8z|+`0 @|T>1)| @T<|0(KdA8ЈZЉ$0,1*:A0)$ZЉ$0, 1*:@000z(0(0@8 KO,z,@ @40!}8`N @0(0(8`;`KO~|"+ci3{ @|T>1)| @||@0(KcA8ЈZЉ$0,1*:A0)$ZЉ$0, 1*:@000z(0(0D8 KuO,z,@@8`0!}HĀD0)0) 8`;KeO~|"+c3 @|T>1)| @\|D0)Kb}A8ЈZЉ$0,1*:A0)$ZЉ$0, 1*:@0!D,0@9 <$0H9 >$00z)00)(b8KIO,zAp~8`|"+`i0c @|T>1)| 8`@<8=@|H1*|HbcK9O,@$0z),K{O8`0!}Hl 0)DKUO,z@X0z)LK"yO0)TK%O,z@(0z)\K{uO8`$0!Hxtx0)|8`8KOЁ^}$ |HT:| $zca%KO|H0z)KzO8`0!}N T}0!A!N 0!|N 0!}N A (dofor|!b̀`,0|)3); A`KzAO0|)Kz5Occ0|*0Kz!Occ0|*`Kz O0|*KzO0|*KyO0|+ KyO}0c, @KO,8``A0|+\KyO0|+KyO}30c|@KUO,8``A0|+KyqO}30c|@KO,8``Al0|+Ky9O0|+Ky-O}30c|@KO,8``A(0|,HKxO}30c|@KO,8``A0|,lKxO}30c|@KiO,8``A0|,KxO}30c|@K1O,8``A0|,KxMO}30c|@KO,8``AH0|- KxO}00c|@KO,8`A0|-XKwO8`X0!P}N Adobug|A!7;cc8`@ c3-c,0-A8`K9O|3|KE A,8`A|\KDA,3ZWF8|0A|0|83|3FЈ8`(:,@\{3KDA,8`A0{KDA,3W8|0A4|0|833HAh0!`}AN ,<8`AЈ(:,@\|3|KDA,8`A|KCA,3W8|0A4|0|83|3HA0h0!`}AN ,<8`AD( A8W 6|0T:|000-0-c8`KߍOch0!`}AN P0!`N h0!`}aN A8tod2sec|}&ܑ!P`".>H;@,0ăb^;@$0y-0-8 KߥOyH@0y-0.@8 K߁OyH0y. 0.P8 KeOy,:,@T@<0<@e0<0@HO~3TK70aD?@00y.TKtEO0!|8`} N DKWOD3Q0` KxAD0`KxADT` 6|0eT:KxŀA|||@c-,-]@A3.A08`@K>QO,y@t0!H3.cccK O,y,AAp|x̀KK=O,yAH,A@$yAcKSO_8`HȀ@0,@(yK^݀A_8`0!H,AK_O,y@,@(A$KdO,Ah|e8|AH8`K^iA0,@,Kc@DbHL8`EH8cbH(bK_OK|4T~b0!|} N 0!|} N C dopaus|}&ؑ!0́0p<;;:WL0.0.0.80aL89 K=OW80.0.0/0ap8<899 K=O0aLK=O,AĀ/,AX@4 ,/,/AL3A,@8;,H00!}8`N ;H ;,Ax 0x/D,0/hP;` @(0x/KpO0!}8`N aX;; |+|*3 @a|+c 39 @|T>0||00K O,,ԃ@,@0x/lKouO0!}8`N a;`|+|*3{ @K: O,x0/8AH8`KO0/8`8KO}KyO,xA(0x/KnO0!}8`N K_O,At,Ad, xAT,@@TAx,A(0x/KnUO0!}8`N .䃂cA0x/KnO}KqO,0(@T:|A8||N 0x0KmOHp0x0KmOH`0x0\KmOHP0x0HKmOH@0x0 Km}OH,0x0KmiOH0x0KmQOT>KSAO8`H(T>KS-OA0x0KmO8`؁0!|} N 0!}N 0!|N C docopy|}&ؑ!0́0p<;;:WL00000080aL89 K9OW80101010ap8<899 K8O0aLK9%O,AH/,AX@4 ,/,/AL3A,@8;,H00!}8`N ;H ;,Ax 0x1L,01XP;` @(0x1 KkeO0!}8`N aX;; |+|*3 @a|+c 39 @|T>0||00KUO,,ԃ@,@$0x1\KjO0!}8`N a;`|+|*3{ @K5YO,x.01|A8`8K=O018`8K%OA0x1Kj1O}ԃKO,0x1@KjO8`H 0x1A KiO8`؁0!|} N 0!}N 0!|N C  dorenam|}&Aȑ!" H`v08, HP̃@,0f1Ki1O8`}~0!N <0ƀ,8 @b21HbbH~O,b |: ;A 01b8`8K҅O x,0T:|8@DT8|t0.Bx,BtA$}&0|HT:|0.31/c8@KmA,028A0T:|8T8|t0.KmA,020AXT:|8T8|t0.8KmA,020A(T:|8T8|t0.8KmUA,@`3232(3282؀cT:|8T8|0.8`8KMO8`UH#5K OKOcc8`KO,T:|8T8@|t0.,AԀc|0|8T:|0.8/@KlA,02T:AD|8T8|t0.8KleA,02T:A|8T8|t0.8Kl9A,02T:A|8T8|t0.8Kl A,@cT:|8KȀ x,;AT9,U':b|8AT8|8.0s20|080f@K1A`}0T:|{0..,;AK1A0T:1.02p8`A@~|+|*3 @980T:9.U':|8.KOH41.8H(0T:|0.|{2,8A K]O8`0!|A} N Cdoreturn|!́"b02|02KO7/,@,@H0~2KdAOh0!`}8`N ,A0A/LӂAL0~4H/AA0~4H8` KPO,@(0~2KcOh0!`}8`N 0~2020@0DK5O,,@,@0~2KcOh0!`}8`N !D, A(0~2KcUOh0!`}8`N P8 a@|8|+|*0 @|}8|+`0 @}AUJ>1)}*H8`@Ȁ0~3030D8 KmO,A!D, A$0~3KbO8`h0!`}HK-YO,Ahԁ!D,<AK.A<0iK.A,@ 0~34Kb5O8`h0!`H8` K5OH"܁), A00~3TKaOh"}0!`8`iN 8` KNO,@(0~3pKaOh0!`}8`N 0~3030@K]O,aD,@,@d0~3Ka]Oh0!`}8`N P8 @|;|"+|*3 @|8|+`0 @}AUJ>1)})P8`@K+O,aDAЃԁ=, @H"؁)0iK-A,}@(0~3K`Oh0!`}8`N 8` KcOЁh}0!`N "܁), A00~3K`9Oh"}0!`8`iN 8` KM O,@(0~4K_Oh0!`}8`N 0~40480@KO,aD,@,@0~41)})P8`@0K)O,aDA8` KbiO,А}@"؁),A쀟0~4TK^Oh}}0!`N 0~4x040@K!O,,/@,@0~4K^Oh0!`}8`N @,@0~4K^eOh0!`}8`N 8` KKAO,@(0~4K^-Oh0!`}8`N "P?8 9@1?IIIIIIII@~|;|"+|*3 @|~8|+`0 @}AUJ>1)})P8`@K(MO,aDAl08` 8K3Oh}0!`N K]5Oh0!`}8`N h0!`}N h0!`}N Adoopen|}&! :@b`qb&05A05 A8`bPKqOB 99@Ab^bO351a}IKB,,A@AH, ,.nA,A@P:350H<35$;H035,:H$,.AA@:35Xb.05`cc8`KťO05l05xb8`KōO@DBJ, A40s5|cK[O0!|8`} N A050606H050606A HNA 04H0Ԑ80<0a89 K'O@ ,AA06 BH 06(B068J06<, ,A@N00| ,|jXA1J}J 9@A@4AAH0j=@09@AK"uOH 9@A09bF8`KO09098`KO~HyA~, @A ,@p0909bF8`KUO0s90:0bFKAO,s,@@A=@}09@AK!OH@0s:0:,0bFKyOАs`f0:08`KOS, ,@@0A8=@}0K!AOKO,9@sđAA0:<8`KeOA, @4 ,A =@}0K OH]JH0:HbF8`KO0:TbF8`KO^J, @D, A,n,-LB3A@$0s:`KSO9@S3H A 8, @_ĉJ,@$0s:KSO32R,HB܁J, A$0s:KSaO32R,HB؁J, A$0s:KS1O32R,H 8H ܀0;0;8`KO,@,A,@ 9@AA, @ 9@AA,@a8H&O@D8`8KO,@,0s; KRuO9@S32R,H a,@BJ,-LsAAP-,A@@A<_J-@,0s;\KRO9@S32R,H LA,@8B T"B" 0B 4B ,B 8쐪B <,B @B HbB Lb PB T DB X B d \ h ` lA`fT 6| T:|@i,AD ,A YcED,A,XA ]\,Ad, A{d,Ald, Atd ,AjD$, AW0;0;8`K OB 0; bF8`b xKO,Z\B 8@0B 0;0;8`KOHpA, @0B [J0;0;8`KiOH8A,, @,B J0<0<8`K1O`0<0<(8`KOB 0<,0<88`LKO,@|aH,B@ ]HX; 8|+`0 @|T>|j KA,}A8|+|*0 @Ad, @4Bx!`J,A,0s<c#KO,1[J0z@KeA7A8|+|*0 @1Z}]P8/( /9@XA|Ѯ\~]Ѯ}]Ѯ1Z~]QKYOscKـAS, @(c$0s0|Pc0=(8`KaOS, @ 1J}EP* /A(`H `KEO,AP0=1J}J SW8@|v.,AKAS0jK1A,|v.A~;|"+|*3 @X.K0s8KHO9@SHc08`08t8`KMOA0s8x080bFK֩O,s,@@0s8sHsHs~8|+`0 @|T>1J ȒSbD|1C@@}c 1( \@| )vA$a|1@}c ( \KAW8}V.X., AaCKŀA~V.s~8|+`0 @|T>0|X|jX@tKA,|v.A`~8|+|*0 @K@0s8KG O9@SHX@W8XQ.0aKB܀b0808K}O,sW8A|xQ.0aKAԀb (0808KAO,sW8A|xQ.0aKA-@0s7070H0s7070@ HbFKԉO,s,W8A|v.,AKIA~V.s;Hɐs~|+c3 @|T>0|X|jX@K!A,|v.A~8|+|*0 @X.K@0s7@ 07H08KEqO9@SH0s6KEYO9@SH0s6tKEAO9@SH:35P KD:35D bK0:358K 1S=_ cKaO0=c8`KO0=bF8`KO32R,.2RA KŀA@.,KsĀ聁0!|} N Cdoxget|}&!``KO,.T,Ue@0|} 0!N 8`H0= H8`@0=8`KOH 0=Ā@|0=8`KiOu:,bЂ"48%A,!d|0!8`} N -U8:1::@0b x؃B $܃t `hb"0090a8@dT,T:|(T8@ | .H|(|K}Ou,Td:|q"@0| .KO,$H @p,A K O0a80T:| T8| | PK Op,0ccCA KOTe:0c|(.Tc:|.Te:0c|(.Tc:|.Te:0c|(.Tc:|.Te:0c|(.Tc:|.Te:0c|(.Tc:|.Te:0c|(.Tc:|.,$22R@009KhbX0@0/T:\(B,"\ |@LXb03k T:1}f!.| !.| !.cW:|eKiOH`.|`.T:Y.`.10T:U:|.|Y.Y.|eRK!OHX,T:b,(A8`H8T:}c0.}E0.X}cA.D"\|c0.\}EA.i|dA.8`0!|} N |t0!} N C4dogta|}&!0`1}4,`sU~:@: Ac8`0=0=KeOt0=0=8`KIO H0=0>8`K-O 0> 0>8`KO0>be8`8KO8 |;|+c3 @}!(:U)>0~ 8A4,|@|8@~ GGB8:~ @~Sbeb0>48`KuO(.* ,LƓA@<0o>LbdK>mOԀ؀|G0!й8`} N t,@80o>hK>)OԀ؀|G0!й8`} N @|" x=1)-/ H .!`3Hb4h"P؁"x}8}@)U:} @.-/@@8T:8.H|@}8}h0>3ca8`K O, 8;@L>1({+ }1Q@ 6(H@aQ,AA+ ,,( +:@ 8HL3Abbe0>8`8@^1!, cAa(;AL,23+!+ ,1iOӂA0A,Gai, H+!+ ,A,23K̚IKOc0>08`KOA81l0Ȑp0p0l0aHR!O0a081KmOAbdA<T:|8.0a8K9O,8`@,8`,H$|bc|808KaO,A0,8Ax0o>@\;cHT0o?bdK;MO8`H8`H0?4c8`81({K@0>0>8`KO@x,T:|@@T8|h8.,Ax4|H|8T:|8.-@0>8K>A,A0?T:|@T8|h8.8K=рA,Ad0? T:|@T8|h8.8K=A,A40?T:|@T8|h8.8K=qA,@8`UKKaOKYO,AL,@"x}8}@)K0o?bdK7uO8`؁0!|} N Cdogoto,({@ 0e?N 8 88L ||+`0 @|T>0|(0|((}L |)0cN @lbrstrip|!7;c@3?,(\AT@8c,(\8`A ADcKA,cA KATh>(%+&($8`A(V+M@P}([cc0h?88@KO`~,8`AcX0!PH+FA A@,1}4UAlcX0!P}Hdcc80~?@<8KO4cc0~?8AKO,A;cX0!P}N DL0!PN @0!PN Achkvar|}&!@<2F<0ŀ0D: '0999AP2;̐X8BbP"TTbt.I: ؁HLV80萡<0a0?0?0@89 KOV0 0|(TT|0A~;|+|*3 @0tA0A0dKO,a,A(ad;K=ad~|+c3 @|TT>0|0|0X0|8AĀ~|(3;|+|*3 @`T:w|(.8K޵OaT,/ , |e4APAD@,;A;0A0Ac8`KmO-0H T~KT~K0tAK-aO8`H@0tAK-IO8`($0! H0tAK-)O8`H@0tApK-O8`($0! H0tA0B0dK9O4,aTAAl0B00B@8`KO~d;|+|*3 @0BD8`8K]Ow0BP88KAO,@܀T:(.H؀w0BX88K O,@ 0tBhHw0B`88KO,@ H\T:(.HlwKO,A$wK1A`0tBh0BHDwK6O`KO,8`A cK1AA`0tBh0B0dKO,a,AhA~d;|+c3 @|T>0|08`@~;|"+c3 @|T>0|0T|03~8|+|*0 @0B8`8KO|0B88KeO,@܀T:|(.H؀|0B88K-O,@ }8H|0B88KO,@ H\T:|(.Hl|K O,A$|K/A`g}80BHD|K4O`~KO,8`A DcK/eA`g}80B0B;8`KUO@, ATA,*ADA,A4@,A$A,A@, @;0B0Bc8`KO-0H x0tBK(O8`H p0tBK(O8`H \KO ,,@;@ ;-H;@;-0H 0tB0C0d8KO,aT,@,ATadT0TbH>5O0C8`8KOwKO`~-0C(0C8c8`KO0H H0tCK'O8`H @@p($0! |H 80tC<0CH0d0KO,A ad30KPOc~;|+|*3 @0tCL0CX0d0KO,A ad;KPYO`~|+c3 @|T>0|0,@~;|+c3 @|T>0|0,@0Cx008`8;KiO0Cc8`8KQOc0a0K;O,A;0C0Cc8`KO-0H0tC\K&!O8`H H0-HЀ00C0C8`KO0C8`8KO0C8`8KOЀ,@$Ԉ(0A؈(0@-;H0tC8KO~;|+|*3 @Ԑd%y8K*A`0C0Cc8`KO,@L0e KA`bK)̀A|;@;0D0Dc8`KO,;%@;0D0D(c8`-K]OH 0@00@88`8;K=O80-H0@<0@D8`8;K O-0H-;HPbT0D,0D8KO,aT/',At,"A /a@4KO ;,@;-0H@@,A(K O,;A`;-HX;HH@,;,@0;-0H(K%O,;A;-0H-;H0tD<0DP0dK1O,aT,@(,AX{dK1O{Kqad0Dh8`8KeO0tDx0D0KO,aT,@,ApXyKOyKa0D8`8KO`T:ad|(.8KqO`~-Hx0tDK!O8`Hp@($0! |Hh0tDTK!O8`HD@($0! |H< -HXb\0D0DKO,0aT(AT:|(A\|(|N -;H-;H-;H-;H-;H-;Ht-;Hh-HX0tD0D0dKO,aT,@@8,AadKUad,$!,%@4`8KQO,;A;`%H4@0d8KeO,;A;d%-0H0tDKO8`H,08`Al8&2RKh,08`AD8|2RK@, @(8`,A08(H08(192RK,18`A, À08)2R2AtK관;,@;0D0Dc8`KO-0HX8-;HH-;H<-;H00tE0E0dKO,aTAadKrO`~-H;,@;-HԀ0tE0E 0dKO,aTA db 0KO,,AA;-Hx;-Hl0tE$0E,0dKO,aT,@@Lad8KO`~-H$@LL; ,A;-Ad812RPH`0tE0KQO8`H8`H8`H8'8'K@T8`($H802RP20|(@1A0EP0E`a8`-KO0Ed0Eta8`KO,A@HLKPaP2K'=OK"QAP`0Exc8`KIOc($0! |} N Cboolexp|}&!p`~c8`0E.-0EKOcK`-0E0Ec8`KO@(p|c0!} N @\K O,@0xE,A(+ ( A@,+ ( @({8J@ .-;J,I,J/AAAD@ $KO,A TЁp|c0!} N 0xE0F 0H8KO,;`A $BPH L0Fc8`KyO?0aLc0K0|0|0`({,LA``1&0!`+{,A4A0`1&0!`+{,K0Fؐ`Fؘ!`0,0`A0!`0,0`@0Fc%8`8KeO0xF0G0H8KQO,A(H<P` 0a`0K7uO,8`A0G 8`8K~O,Abl {0GKO7C@Xt0xG KO{0G(KYO,@,0xG0KO8`0!H;|+c3 @|T>~;|+c3 @|T>|8|0|d0KA7A|+|*3 @c|+c3 @|T>08|+3 |*3 @0GPc8`8K}Otx}'8|HT:|8cCc`K1OcK߹A8`H0xG\KiO8`Hx @t&T:c;9.0E0E8`K|OAĀ> HT:1.8`,A KsOp0!HĀ ,A,0E0E8`8K|O8`KsmOH|ԃ fKt9O0xEKO,APfKqOH<=8U):|I.0xE0E0HKO,Ap0!|8`} N p0!|8`} N 0!|} N p|0!} N p0!|} aN p0!|A} N p0!|A} N 0!|} N p0!|} N C $doif|!p`rbt̀bE0G8`KzObC" 0G4HA,:0T:|A.bC@PKO0GbE8`8Kz5O0}0!8`N h0~ A. @0G0G8`KyO0G0G8`KyO,@p0G0G8`8KyO1T:|@.0H-A0tGKO}0!8`N T:|x0.B ,`hx" L;` ;;AKaAT:~1.a|+c3 @}U>|h0KQA,T:|x1.Aa|+|*3 @T:~1.T:~1.1 U:}@.U:}a.1U:}`.T:}1.1U:}`.T:}1. 1U:}`.T:}1.1U:}`.T:}1.ЁT:} 1.} `}`U:9}A.1}@}`U:|@&1(|H|HT:|`}(@}HU:} @bE,0tHA K uO8`0!}N AdotakeV|VVVVVVVVWW WWW$W,W4WA.@@?PbM?zG{u,v vTv`vlvxxxvvvvvvHuvvvvww wTwwwwzzzzzzzzzzzzzzzzzzzzz~~ ~(~0~0~0~0~tttt$p,HDDDDDDD,`,,DDĸ@Ɛ ڄ4xDDDڄ(D(4DD@LڄhxxXD4xd ,8DP|a!1D`|<980} 0801@|+3{ |*3 @?0@0<1D8K{yO,8`AKiOa<x0!p}aN A findinpathb8 N @trtrap|}&!p: ,@b, 8`@(KAA7s@0u K,O: 3 8~;|+|*3 @,,@,H @,@(-A0 @cKO,A|0 DcKO,AdcKO,@pK}7H ,@8`KmOc8KbO326?@BbB 1 lbb(=23%Ah0 H8`8KpUO0 XcKO,@H2,A$~K,@8`KlO0 \cKO,A܈(-@,A3 `-Scac-A8`.xKoOA,/+,M,YADA(.-,7/RATbbLړ8A@HHCeO,2210u p@ K)O>Hbbb;;A@HH21,20u A K)IO,@|(-@0u K)%O|~|+c3 @}U>0|8,@0u @ K(O~|+|u*3 @H9H-yA,d/h/zALA A@ܒ,HԀ0u ,8@H'o,39Hb;AA,H6120u A K(!O~0 |+|*3 @8`8Km}OH0H(H 8K_UOHT8,39,AA-ScacKt61@bbK0!|} N hd0!N P0!}aN 0!|N Clprescan||(,,A,A(K1O,8`@ Ke1O,A(KO,8`@ KeOT>KEOKg1O0 0 8`KhO0 0 8`KgO,,@/A@,A3o 23O3-ȃX ce0 8`KgOlbg K%O,0 8`8@KgIOtGx}*P}*HU):0|H.0o@`KqyO0oPK%OHP008`KfO8H008`KfOH0`0|8`KfOccD8`KfO0,08`AKfyO0|4|4|H8T0 0 8`@PKfAO8,LBAAD N2 T,,A0@,,A8`,@ K|OHO`y0$088`KeO,A@KYO,@0,@,A8`KbAOKO,@0T>KuO8`,A`KbO,@L/,@ce0 K@(,Ace0 8`K\T>KOKcO9 'c#0!|} N CdoconectbP,4b8@ ,0c,8:`9: :9Af ܀,A\8`,@ c8`KO,Atc0`LKIOx0!p}8`N c8`K̥O,@0c0`hKOx0!p}8`N 080``cKyO,@0c0`KOx0!p}8`N `,A0f xAA`KOKơO,,APLJ3BA8`KƁOm,A K-O,A,A,8T>K߹O,@:`,HKQO7A;@zKUO,a`,/AD,T`~A ``|`08T>KAO,@T:`,Hh0w@$KAObcKO3|H(0w@ KObcKO3|AT,H:`HK5OH0wKO:`H@,;@,,T>AKO|f6A$008` KO|@A8` KO|f2 ,A; ,W>H0A$$,,A; A;,W>AHKyO|f2/,, H0A lfH O,@ ,@ ,AW>aK̀A`~, ,LAW>b+K٩A`~,AxW0,Ah,A`8`KOb3|fW>KߩO2|f8`KߑO2|f/,, HHW>KiO,b|f2LJ3BA8|橮2/,, LBA(@/,LA ,A800b|c8`K\IObcK}O,A:,At,Ah,@,@<,A0cT~,AT~,KcKEO,Am,A KO,A<, @48`zKMO,a`,A,ATf~,@y,A`HO,a`,@@b ATc>KMAa`, aLATc>K-Aa`Tc>KO,a`A|@@D,H:`H,A4@(0wTKObcKMO:`,H:`H0whKObcK!O:`H,Al,@`KO,@zKO,a`/,@ AAT`~Ay,A`HEO,a`,@@b ATc>KAa`, aLATc>KAa`Tc>KّO,A$K5O,AH@:`,H:`H0wKyObcKO:`Hx0wKYObcKO:`HX:`HP0w@K1O:`H<:`H40wKO:`H KQO,A ,K,,@8,A(,A K=OK%O,@老8`K݀A8`KɹO(KObcxt0!p|} N (0!pN C transmit|}&ԑ!`{```cd8`KO,:cD:@,0wcdKOx0!p}8`N 8`88KOcD,}<8`@00wKOtx0!p|8`} N lKA}.-}_-.U 8UH8|H.|@.cF`zcd 0wKOA,-,.AON3A@c8` @H 5OHP8` @H !OccH,AD8`@TKaO,ccA(KO, Td>,A8`K0w4K%O:H0w,KO:H؁ |ccKM"`|p}<}, @,AKA`h}U>, AKA`hU>8`KԩO,A(5A@1(h>H40wlKuO:H<0wdKaO:H(KͭO`h,A7 U>, KDcD8`K]A 8`K5O8`K)Obxt0!p|} N C Pxlate|!K9O䃢`e0; c;KɀAc8/|+c3 @}U >1}+@,1 9@A]H$@ }@|((/9A |I})X0!P}N Ahomepath|}&a쑁!x`{h;,8-A8bal0cKO|0!8`} N .-AA ,A4ATbcd0cH,AAbcd0cH䃢080|0KVOH䃢080|0KVqOH|䃢080|0KVMOHX䃢080| 0@KV)OH4K3T`dc; 8KOS8`|+`h0c @|aTc>1@8`0P|"+`h0c @|aTc>1|h|~,@L0Xc|+`h0c @|aTc>1|h|"+0 |*0c @H0`c8KUO0|h080TKU%OH0KOal|0!8`} N ,,A@$80|KeO8`H؀a8(|AxT= 0KBO,cAP,AH9 }8|+`0 @}!U)>1}H@a8P9 }Ha8P9 }8|+|*0 @0Đa8@bc,A ,@0Ȁb08K~O,A`K%O,AAxA$,ABA|8`KMO8`K Oc%0(|,8`8@KMOc%,0D8`8;A(( 1@a,1( @c%KMIOc$8`KO}008`KMO},Hlc;AD8  $08KO}H8KO},8 ;@||+|*3 @H }h0!`}!N !D0!`N Apktopn|!t,ahlp`x|!A@b0cah`ec,08`A8`KKO0 008`KKO8`KO|h,al|@\,ah;@ KҍO,ahA KmObh8KOh8`H$}3(|c048`8@KKO]c, 0@ 08`8A(( 1~@Ia~, 1~( @cKJOc8`K-O}`f0L0\8`KJO|,h8`Ald!l(|, 0Ahb8AD9 (,04<@HL0(#D8`KyO~H `8`KaO~H~,@Ԁb,h8@KO~,A`b ,0`8`A8KO~,A,b ,0t8`A8K]O8ahKQO~,AD<h,0x8A,8`K!O~XHb8~X0!P}N @L0!PN ALtraopn|A!7`cc8`@3|c,03_b\A|8`KHO8`KOcE0(|,8`8@KHMOcC,0D;A(( 0@`,0( @cE8`8KGOcD8`KeO}`f008`KGO}HpcDb;AH8PTX\dhpt0Pl8`8KO}H8`8KO},8 8@||+|*0 @H }h0!`}AN AH0!`N Asesopn|ؐ!7C`8`@3G3,A|8`KO"c(| ԃ c7@08`8KFqOc,0ă;A(( 1<@a<,1<( @c8`8KFOc8`K߉O`f008`KEOH,cD;AL9 x|0x'8`8KO`fH 8`88KO`f,08`;`@8 |;|+|*3 @8KE-O08`8KEO08`,8AxKDO08`,8A KDO08`8KDO0$8`8KDO048`8KDO0a,AKO4@0}KO?, H`"0),"/ @0}KљO?, H4@0}K}O?, H0}KeO?, A0}KMO:, H0}K5O:, A0}KO?, H0}KO?, @(KU1=`da#KO0}b@H`<,@0}KйO<,@0}KСO<,@`8>/ ,@0}KuO<, H<@0}$KYO<, H 0}4KAO<H8, @0}@K!O<, @0}dK O<,@0}tKO>,@0}KO0}b@KO[, A<:,A0?UC>, @ KMO`~;0}, H("p)U#>K%O`~;0}, A0cH 0cKAO:, A?,@苞cKA,AcKрAT|>"D,A,"0;),n@;0}KOH0}cKιO;, A c0}cKΙO0}HD"p), A c0}cKmO0}Hc0}KUO0}KIOH0}K9O"0}), A0$BU):|H.0}HKO0}TKO>, A "0}dKͥOH0}hK͑O>, ,/ @0p0}H,@0t0}H@0x0}H 00}K=O>,@<",A 0}KO"T3iH0}KO"T3iK]O`dcKO:, A?,@8")/ A($,A0}K̑O:, AKOh0!`}AN Ashoparc|}&ȃ!b`ub`0{D0`;0p0|01K]O20@K O,8`A:-;@233=23@0+/'0@PA,0++OYA8,//#OBӂH+@,//#OBӂA@.0{/0/,A@A@@PA/0Ac@T:| .H8//0OX@@ 0lH85T:| .H0K%O0{A /0Ac@T8| T8H4//0OX@@ 0lH85T8| T8| +AdA /0Ac@T8| T8H4//0OX@@ 0lH85T8| T8| T:| .H0A /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@+AdA /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@T:|@.H0KșO0{A /0Ac@T8| T8H4//0OX@@ 0lH85T8| T8| +AdA /0Ac@T8| T8H4//0OX@@ 0lH85T8| T8| T:| .H0A /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@+AdA /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@T:|@.H0K O20@KO,8`A@:/A0{000 A /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@,A 0H0A /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@,A 1 H1(KOH0{00LA /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@,A 0PH0XA /0Ac@T8|@T8H4//0OX@@ 0lH85T8|@T8|@,A0`0p1tH0h0p1tKO20@KO,8`A,:3Z-A0+/'0Kb0!|a} N aL}0!ԃaN C 8shotopt|a!4`},0xA0$H 0$KO,/,/ALA A0AT`30H`00KýOH<00KéOH(00KÕOH00KÁO`30|8@K)O,;8`A`0KAO M,/,/A4A AC 1>| BAa>|X|0)| @ 0)H"@T:| .`KYO~; 0c, @KO,A(;0)Ѐ/,,@ 0*H @ 0*H@ 0)H0)KO~30c|@KΕO,A;bc,,Tc:L A|.0*H 0*0*KO~30c|@K1O,AT;D0*8,A;cK9O~1=0c| @KO,A9 ԁb<0*X}D |PT8| 3KO~0c|@K͑O,A;0*xLKO,, / AKWO`dcK O,A0z8pKO3"쀉0z8KO0z8ȃKO,A 0z8䀈KOTH0z8KOT0z8,A 09H09KiO3b`3{0c|@,K O,@8`0!H;bc,@ 0z9K O{30cH,"H0z9DKO{30c|@,KO,@8`0!H;@X"0z9hKO{30c|@,K-O,@8`0!H4;0z9K5O,A(ā"0z9U>K OH0z9KO{30c|@,KO,@8`0!H;b 考,@ 0z9KO{30cH0z9KO{30c|@,K1O,@8`0!H8; b# *HHOKUqO?!P3:`dc3PTKO{0c|@,KO,@8`0!H;|,ADt~,OFA0,AK@O4}@x,"@ 0z:@KiO{10cH0z:hKMO{10c|@4KO,@8`0!H|,H |,A~,@bc,@pb0,c/"L+BAX <`Q쀟0c$d|c@|c.pTh|c@|i1<`ff0cfg|c@|cpTh|@0z:KyOH 0z:KaOb,@|@0z:K9OA0z;K)O8`0!|A} N "Cdostat|!䀂};00,;;@KrO;0;40,@KO;4X0!P}N Apmyflsh|}&!a4b4`b8c:@,8` : :a(A$btc.Ab8c,A@bc.A 8`a(b8AKQEO6#@pt0};<.A 0;\0;Hc|θH 0;`0;KeOb|0!8`} N 0<0;d0;tb&8`KOK2O,@<0};xKOb8|0!8`} N o8,A<8 |;|+c3 @|aTc>0|c8$c|cTfa4.,,LRL3BA$0!|8`} N bc,A8`0;0;;`KO;@40;0;8`KOb0;0;8`KO0;0;8`8KOo,A3;; cec0aKi݀A3{.;0Wz:8`|+c3 @}aUk>0c|XK9O|o.,Acec0aKa(,AXȈ O,A  W,A8`8KObc,A T,@8`KiO9`g8`|80a$CBbt`cTc:|g.;,@d,AXa,A0KOeA,AKOuA,@؇,A,KKdOKemOa4-b Gb$C@8`a0H 8`a0b200cȐ,a8Ȃb؃35=1=bc,,A@bc,Abl c0;K%O,@tbX0< 8`8K1Ot0u<,x}l`}k`XUk:0|X.`K]O0u<,A8bc,A(cKOMOb2c,HW>b2c,AcKO0=h0=xb8`KuOb Lc|{8b(cK`EO,a @ Ab$88`a$H8xcb$Xcb1kb0j|`|8@$xgACbcxbc,A;0a,1gc9u;0bDc,A0bH+ c,@A;4a81gc9u;4@bt`cTc:|g.,@(ccKIeA,AccKIuAT{>0=|0=cf8`KO}ϐ.;@,;A~.a|θc$8`KO|θθ|0@,0w@`w|θHta3bac@\2b|8@-@KYA,A,3bac@2b|8@-K|θ,AL~.3ZW\:}.,A~.a|θc$K0a$,@b0H8`a$K8`a$Hv,@$u;8,AU;8bc,Kc8`K-O,3A(8`KiMO,3@H b0u=K{O8`K OHKh-O`p-0> 0>b8`KO@:K\O`0> 0>0c8`KO40>8}00>H8`KqOAApba ,|c|8AbcKADbc,,Kb8H 0>L0>`b8`KOKhK5a$,@ bCbK\O!H8O ga$|0!} N "C doinput|}&!p`8 :|b8|+`0 @|T>0 0>hbec8`BK O| @0P}b0!AN cs|ӠHt"`T:| .b,0~@KE)A7@(0>tKxOb}0!N sc,3A@}KDqA,3}AKD}A}s,A }K̚b2>1>3?>3_>sbmX2| | @T:|(.c3/AaU@$KC̀A,cAKC݀AT|>cabbKO|ӠcEc$bKmO|Ӡ,|0@@ cs|Ӡ,H:H3bbcc@`2[b|P@.@K|ՀA,A$3bbcc@2[b|P@.Ks|Ӡ,A @AXKT:| .,,LBAbKB݀Ab0!|} N C doreinp8 ;,>,A 8@8`N ||+`0 @|T>1|@10>@8`~H }#@>=>1)=>AKN @yystring|}&ؑ!#`|,;;;;`;@AȂ2>,c#,Ac#*.3@KBA,,0A,c,@;@<,HX73HDOR!,A(`;`@;@<H$73H@AX>;@<,A,c#,KT/,|>L A`0`>xt0!pH\|>0`>H<;KBA,;;`A7;`;;@Kp0`>Āxt0!p|} N C getip|}&A葁!p7C;;8` @ 3D?4|a8`|+`d0c @|aTc>0|c ,bAAx0c?80!N ;0c?T:@P|pT;@|H|A;|,|c0?DA4KW5AcH4bAx0!}0c?@N 0?PKWAc0!|A} N Ax0!N C\zjdate|}&Б!`78`::@3?\H: 0?`~;|+c3 @}U>08ccKO,,/0u?l@00u?p;A3~3@`K>}A,,A3@ ~K0?x@0@A8`BDC8KEO0?H8`I0HKJ8KO0aHKuA`y,n@0u?}0!N 0a@KuA;`}p|T:|0?0?.bW:8`;@HpT;@|@|A;cKMO,0?0?8`A 3>H3>}.03\3 |@@}.@@$c\, W:3\@}.|@KcFKO|.0?c0?8`KؽObccFccA,0?KSAH(0u?t}0!N 0?KS̀Ac0?8`8cKUO;c8K1O~|+|*3 @c@ Ѐ0!|} N 0!}N C hjzdate|A!7c8 ;;@ 3f?||+c3 @|T>0|(,8`@038`;A0}3K;9A,8`A$,3@ }K܈@?KrA`|30aHHJIKrŀA`zP3zRQ0aPKrA,00 A3H `|p|0|0|pT0:|8|0|e0!}AN xal0!N tal0!N al}0!N Amjd|!<%0|,-,AA@@0 ,'@ 0@LcbKNaA;H?0@lcKNIAH?0,'@ 0@cbKN%A;H?0AcKN AH?h0,'@ 0@cbKMA;H?D0@cKMрAH?,0@cKMAH?,AL,b@@3A3c3~pc8`KO@c3~pK0.T:A@|}00,`.@ `H @ aB.0A(0A4a-8`KљO@4b0A8ce8`K}O,@3yA@al-H> @|r,al.A@8ēl:`,A=0ADcKLyA-;H=K/Oal*\@`f0cal(%*&@D0l0Ah,l(0*9@8ēl:`,A=X0AlcKKA-;H=D(*NDAX HW:,T:|0@0|8.l.H0T:T8 x|8|8.l.Ht@< H,T:A(4|0.,l@<0Al.H8cK1A,0T>A`0W:|8.l.@0|80@$|8(}@U9l2lH,|Ǩ@X}8* ( A@DF4l|Ǩ@|84* ( NR3@Fl|ǨK؈* ( A@8b2l( ( NF@2l( KPbK}Oal0p0PHy`c0BH0BX8`KQOP0B\0Bl8`K9O,cb0B8`AS2~pKO@P8` KH;`,Ad@`3B3B33Rccf8`KOcfc8`3{~pK̡O@ccfK.AX0(,P00@ Ad(,700@A(0((LA)A,0, /2Hx0((LA)A,0, /2HT( ,l00@A(0((LA)A|,0, /2H(@d,0, /2ATA4,/-LFLӂLFsA40;(lHd-C,R,MsL3A@8ēl:`,A80CcbKFA;H70;(lc,@N,-AQA, A@8 pc|;|+c3 @|T>0|00CLlA7l( @8`f0cap0) @0cap0K,al`d@8| 0HA0p`0( BAp`( @Tp0p( @D`0p( @0p( K쀁lH0CPpHl,,;LB3A l gKQO`~,@8ēl:`.A6,0CTcbKDA;H6@`3Ct3a;3~pc8KFOcc8KFmO@3~pK̓pHpt1Cxx||8T:l|ccK|O,@5hKO,Ad88`KO`}KO,@5, H |0T:|0..l@50C|l;H40C0C8`8K%O0yCK^=OKaO,AKQO,@0Cl;H4a,AKhOal,H0yC(al,@4hĀ.A4Xl0C,cb:`KB݀AH48,AMAJp(0(ALW:|0|0|N @H8 0Dl|8`|+``0c @|T>0|0cKB]AH30DplH3,@0Dtpf,AdK(A,pl`AgK(AlfH lp30lpf,@l;H3 ,AcKgO`}cH0yDx`}cK(A@; 8`|+``0c @|T>|`0K(qAa;|+|*3 @`~a,AKfO`}cH0yD|`}cK$O,AcK$O,AcKaYA`~c.KaEA,`e-|AAh@L,@<:`.A 0DcbK@iA;H1ěH1|*|l0DcK@=AH1|@cl0DcK@cl0DcKĀ:`,A1P0DcbK?݀A;H18lH1,a,AKe)O`~H 0yD `~K#}O,AlcK`A,.L@BA lxl0lH0:`,A00D$cbK?5A;H0:`,A0x0DDcbK?A;H0`8 |8`|+``0c @|T>0|0@ c0DdK>A;H00DhlH0@/,@$8 |8`|"+|*0c @H8 |8`|"+`f0c @|T>0|f8|a;|+c3 @|,T>0F8@ ;H0|!;|+c3 @|T>084.,LR BA@ |8`|"+|*0c @H,,pA.t`cT:3|0.cEccK O,pl@8cb$`AK$Ol|lp|pH$lp00lp,AcT:Kllpllp0.0lpA0lp0,0lp@ؓlH-A,,[A@;,Z;A@;0Cl@-8` |a:;|+c3 @|A|aT>0|8`Ap|+`f0c @|-T>08,0Al@:,0`H|0**A:,0`A8K"A7A$b0CcK;uAc|H :|,,.@,;@,@;,@a,AK`O`~cH0yC`~cKO,AcK[}A@$7@;@,@;H,@8`AP|@c|7,/@ LFӂA+bK!A;H+p8|9H<7@;|,/A LBӂA+bK!AA;H+AA,0@`.At`pT:|8.|b8K)O,@\3pb.8|A@T:|8.KO,bp8@3.|K@;,.LBH3H~@t`pT:|8.|b8KqO,@\3pb~8|@@T:|8.K5O,bp8@3~|K@;,.LBHL3H8t`T:|8.cDbccKO`,.LBAbKaAc0DcK8IAlH):`.,-A0CcbK8AlLRsA)dbKA;H)T0(,A0T:|||N ,@0Dplfc,AdK9A,pl`AgK9 AlfH lp00lpg,@8l;H(@(a0lKۅ;H(t@(l3D@ a,AK\aO`cKO,AcKWYAaP`fc0D8`KQOP,@l88 |8`|+0c @|0T>;0E0Ec8`KO0E 0E88`8'KOP,|.'AD:`8,A 0E0~|,'Ac8'K}OH.8 AA T?.|@; @TccK9OPl|0l@tP3~0l3lA8HP,P8@$P0~8l3lAccKOl8H,:`,A0EcbK31AlH$alKw1O4ap@ 0Ep.@4:`,A$D0EcbK2рA;H$,0EcK2AH$@$@$ 3D@,,A cKWO`},H ,AcKiA8 |8`|+0c @|T>0|; 0`;KQAa|+|*3 @-`~3D@ a,AKW]O`}@D8 |8`|+0c @|T>0|AcKO,AP,LFiAt8 |8`|+0c @|T>0|AHcKUO,@4:`.A"0DcbK1-A;H"8 lca|8`|+0c @|,T>0@D@cKQiAH8``}@cKQMAAlH8`AlHx,@4@ cKQ!AAl`}8`HPc`}8`H@@$cKPAAl`}|4`Hc`}|4`A8`,~|@0Ap9@tlp3F,0AlpAH1~@<1lp3F,0AlpA ~K8lH 0(0( AT:|||N alK; O4@:`,,.A ,@0EcbK/AH l@ 0EcbK.A;H P@ 0F cbK.ՀA;H 00F0cbK.AH 0FLcK.AH 0( AT:|8|8|N @8 |8`|"+0c @|T>0|,'@@8'0yGap@ aap8 |;|+3 @|T>0|0,-A 0Gp@4|3~@c8'KOlABt`:T:|0.p,cc@$K.A,cAK/ AT|>.AT:|0.c,3@$K.A,cAK.AT>|@ATc,AT:|0.Kl3AD~@lAT:K(H$l,KĐl.AbtB`T:|0.b,@$K-A,bAK-ATw>pc,ApT:|0.c,3@$K-A,cAK-AT}>|@Ahc,AT:|0.KlA$.AT:|0.K0c8'KOlHl0l,K0GlH@܀8lpX0,cp;AcHA,X.Adc@8XK,A,cADK,AT>llH4cKA,cAKAT>llp0l0,p@\8lH0(AT:|8D|8|N ;.,pA@.A`c8'K}O8 |8`|+0c @|T>0|4|0P0A@0| ,HA4Pa1~@8@APalH|1K;.,pA@.A`9 !X0,p0A@~@8`,AP0p8`A~@,K, @ p`c8'KMOlHXaX9 K@H3GT@ a,AKN=O`cK O,@4:`.A0GXcbK(A;HcKIA,aP8@ P8`8 p|;|+3 @|T>0||@8,lc0@0,0lp03lpA8lH0,K;A0|4,ccccc2YG2GT~@2G0Gba8`KO@,@@8 3G|8`|+|*0c @0G0G8`8KOH,@3G-0Hc8`8KO@3H@ ,AcKLIO`~cK O,@H:`.A0HcbK&A0H40H<8`8K!OHcKFAaPH@|,Apc0a 8K O0H@0 8`8KO:`,lA0HPcbK%A (&A 0Hp0Hx8`8K}OH4,*[A0@(]A 0H|0H8`8KAOH0H0 8`8K%O (@*[0 @T>@  `(a*zA@ 0H0H8`8KOH0H0 8`8KOa 8KWO6#:Ab:` xaP.0H0Ha8`KiO0Hc8`8KQO0H8`c8K9O@c,,@c.@2YH@2H@P,A.@,: A0H0 8`8KO8`f`K IA7c@H:`.A0IcbK#A0I 0I(8`8K}OH40I,0 8`8KaO0I@lp8c~.;;@( 8ApbC,+0(9+A8A(K]O,p8@88,H0(ZA@(a+zA@ LA8,@@,A4b/A$KO,p8@8,A@3l3.HAP|A|,.Ap2p,A.Ah,ccc0IlA00a K"YAl0a KOp,HlKuOp,HĀ,A0IDcbK!Al0I`0Ih8`:`8KyOH00I.Al0,A p`,H ,L‘@( 8K0I0I8`8K OA`0IccK!QA,.LBBA<0I0 8`8KOa cKIO7@$0I0I8`8:`KOHP0I0 8`8K}O0IW:0 c8`KaO,\.@,cgX9|.|A.1BHX0I0 8`8K O|.8|.cKO0J0 8`8KO,AccK%A0J0 8`8KO0J(c8`8KOlHH;lc8'KO'0Ix0I8`8KUOH ,LAA0*,;A ԀT:|8x|8|N AH,al8Haal8KOal,U(<.V@4:`,A0JcbK AlH`0 8@l;HL@D ll0` K>Al0` K>mAlT` 6|T:0fK>MA|0JcKAlHAH+!al8Haal8KOalK!8 |;|+|*3 @l:`*-@x:`,Ad0JtcbKA;HLa:`Ka O,al@ 0yKal.@:`,A0KcbKA;Ha; K;|+|*3 @l:`*-@:`,A0JcbK)A;HAH+al8Haal8KQOal*-@4:`,A40JcbKA;HKɉ`e0JcKAlH a;KAOal0(-@l`;KYO,:`@0Ā.A0JcbK1AlH alK;ՀA,|A`Kʹ8 |;|+|*3 @l:`H @AH*Mal8Haal8KOal:`*-@0Ā,A 0K8cbKA;H KI,T<I0$|||pT|0T8|0|0||0|pT|8T8|8:`|l@0KTcK AH dT:|,0KXcKAH Da;A0yK\K@AOal0(-@l`;KO,:`@0Ā.A0K`cbKuAlH ̀alK:A,|A`,8:`@0Ā.A0KcbKAlH t||8<|2:`|0KcKAlH DlcK%O,@:`,,.A ,@0KcbKAH @ 0KcbKuA;H @ 0KcbKUA;H 0LcbK9AH cKSO3L4`eccKAH l8 3L8|: ::`8`|+|*0c @,@2L<8 |8`|+0c @|.T>0~AA0Ā.A 0L@cbK}A;H ؀0at8KO@ &000atKCO,@0Ā.A 0L\cbKA;H p\Tr:,l8|Ɛ.@ :~0@ `,@ `~0:`@ `,8@ ~AV:3A-^X`t;`|ݐ.|.,A8,]b8@ЀT:|8.KO,@2~2A|ݐ.|.,K-^@l8 3L|8`|+|*0c @XT:|Ɛ.b|f8.b8KiO,@ 0LcKA;Hb0L|cKAH8@T,Ap0a8@0L0.|@A(A$0.@,|@@|z)b@KO,A|bb0a8KO|`4T~.bb8A|.|gKmO,@,A8 3L|8`|+|*0c @Hb0LcKAHl8@,_@$cc88'K5OaXH8 |8`|+0c @|T>0||p|T:|0X@ 0LcbKA:`HL8`888KOcc88'KOaX8`888KOaX,@:`.A,0L.A@0L0LcbH0L0LcbKAAH0(-*+A@`cK O,@0Ā.AX0LcbKA;H@8 |8`|+|*0c @HA.t,u-vA`,xAX,yAP-zAH,{A@,|A8-}A0,~A(,A -wAA@l:`H,l:`@A܂&HXcKO,AcK3A`qb#H,Ā,A0N4cbKـAb#H5 O3NT`e:`ccKAH A0Ā,A0NXcbKA;HcKeO,ALcK2A7A|@0Ā,A0NcbKA;HxcHJAO,:`@0ATe>0NcH80NcKՀAH0A4:`,A0NcbKA;H0( AT:|||N cHJO`e0NcKUAHT`s8A80NcK1AHcHL5O`e0NcK AHh.@0Ā,AP0NcbK݀A;H8cKO,AcK1AA`q0(8AT:|||N 8cc`8'H=O`qHcc8'8'8H0|0AP|0(>ADb0OtcK AlcH$b0OcK Alc,A 8cH c0O8`KO,A l0yOK'OalH0yOHĀ,Al0NtcbK A;KT.l:@@0Ā,A00McbK A;K0M80MHa8`K=O8 |8`|z+0c @|0T>a: ~0ML0a K UAb;,@ll;0a|.8-8KaO,03 A`@cr3{|0@0a|.8K30MT0Mhb&38`KaO0Ml0M|bF8`KIO8c8KO(\@cbēl,A0McbK QA(&@,([A@(]@~(@([0 AT>@ `b$K3uO,aXTf:ADX0M0.0;c8`KeO@0a8KO0Ԉ0(\@ `*&@,*[A@̈(]@f*@([0 AT>@ `b$K2O,aXTf:A0.-0M0c8`KOb#KIO`dcK1OA b#K)O`dcKO:,A0McbK A,~@t||3^2blT:T;; 0a|.8~8KוO,|bFT:@(0M|.8`2RKO3 H|f.89|+|}*0 @}|z+1 @(<|T>0|0@|8b1*>0Na28`@9K-OacCKObA|KѩObCKMO,23Z~AA0a|.8Kb%0NcKA:`l0N cbf8`KOKL0N|.bF8`KuOK,3,8c8KO,0*\:`@`ēl,A0JPcbKmA*&@,*[A@(]@*@([0 AT>@ `*_(zNP Al8K9O4:`Abe0JpcKAK<cKO,APcK'EAXKcK-O,@4:`,Ax0GxcbKA;K`@3GcH 3GcK%A`eccKɀA@X8 |8`|+0c @|T>0|TA(cK%AA3G`eccKqAlKȀac8'K{OalKv O,@Xal0KOaЈ,A88l``K}O,aX@l08|9l.@@0Gl;K4H]A`~8`aX@\cKO,@4:`.A0GcbKyA;KcK$AaX,0G@||H$@8cH||||cKAlKtac8'KzOl,@T0G l;KH8@lH0G$l.A8`0|l,A0|l,K0G(cKuAlK@T8 3G,a|;|+3 @|T>0|K4%O`eccKAKx0G0lKla0lKOKX;,@8`K O,;`'@|B c~43{A0fH KO,lAȘfl,0lAc~K8`K9O,l@:`.A0G4cbKA;Kx`0l( ( NB3@0l( K0lHl8Kl0FPl@.8`@a,AK' O`cH0yFT`cKUO,AcK!A,@8`8 |;|+3 @|T>0||A0Fx|lpH0Fx|lp~`{.AHBt`T:|0.b,b;@$K!A,bAK1ATv>.AhT:|0.c,@$KـA,cAKAT>|@A|.AT:|0.K,p0A0p3{.AT:|0.K(KL0F|0cKـAlK0;K:`,A0FXcbKA;K@8@4cK]O,A0cKA4@8|`0KualK:`,A0FcbK!A;K|0FlKl@h8 a|;|+3 @|T>0|,@4aplc.ApT>|0Xlp0l1T>|0Xplp0l,AT>|0XK8lK@8 a|;|+3 @|T>0|,O@haplc.A3`>p0,pcAK5A,cAKEA`}.0,9-A0,FLP Ap~3H0LL+Ap~3@p0,K|ptT&6lT>|xlp0l,A`>p0,K,8lKP:`,A<0FcbKɀA;K$0FlK8`@ .@a,@0yFȐapKiO,AapKA,@8`8 |;|+3 @|T>0||A|p~8,H|p~8,A.Bt-b`;HAT:|0.c,b@$K)A,bAK9ATw>@3F,AhT:|0.c,@$KـA,cAKAT>|@Ax/AT:|0.Kpl@8lp00lp,AA Hl8lK4.K:`,A0FcbKA;K8`@,@@a,@0yFapKQO,A܀apKA,@8`p@8 |;|+3 @|T>0|@p8 |;|+3 @|T>0||A@.A(btB`;:T:|0.b,03;@$KA,bAKATw>X.AlT:|0.c,@$KA,cAKɀAT>|@A.AT:|0.KX,plAHlp00lp.AT:|0.KHl8lKX;K:`,A0FcbKiA;KĀ0;c,-B,@A8A@`:`A0ClK|,AA@`a,H`a,A4K"EO5@90CcaKAlH 0CȐl@38c8KO0*\:`@`ēl,A0CcbKMA*&@蠈,*[A@茈(]@耈*@([0 AT>@ `aKqO,AHTf:X0C0.:`caKŀA@;,AHfc.;A(KݝA@3.W:|f.,@`KuA0ac83KݥOW:KuA,y@A.;AlU:3@;|c}K" Oc,@||3A(K5OcA@}|K,8ApaKO`dcKO@LU:3;;3~@c|.3KO@3~K8 3|8`|+|*0c @ 8@K怀@l,8Ah@T:|8..AT0l@;KDl K%O,A ||T:|0H0C$lKb0Bp0B8`KyO:`,AȀP.@ 0BcbKIA;K0BcbK-AK刀:`,At0B cbKA;K\ēl:`,A<0AcKрA-;K(ēl:`,A0AcKA-;Kal0!|} N C\fneval|a!p0a8KO䀁80aD8KmO0aDa8`e0O8`83O;`KwO80Ohc}OЈ8`OщH8]O҉}OԙOKw]O8bDe88 08KiO40}O0P @<80P8`8KwOa|}0!0}PN KEA8cD9` ( 8`890;AaHO։ }OؙO3O؛}O0P(KvOa8c0P80c B}O8`8KveOc0!}aN Ackdate|}&!0a8KOa8,,AH``@ h}P0`PH0!`N 8|0O080B;( 3. ;A`Oʈc |O0`8K9A,0A$`. 880`@ KЛO0|O0@8?OɘOHH, <ff80A810fg| |pT|(T8||| 00OȘOɀhd0!`|} N Cpzzndate|!KyA`e3PL0PlcKрAXc}L0!PN ALckgetpid|}&ܑ!@7@3Pp;@ AH;@ A8`|+`e0c @|T>0|(8,0 8A8,0 @0PtcKALH0PKAH Lc;8<0<08H,;A$PbTc08KmO`|; ,T:@  &(.*0P0Pc3|8`KrO(AW:|0 |0|N H0P,T:@XcH\|(.cKAcHt܀T:|(.0PcKŀAcHl0a0|0,80@(|((/A8/|1880|)cHP,XAWe:|0X|0|N 0a,@(KOA;|+|*3 @HpT>KO,@cȁ0!H cKݙA,AcKݩAT}>D,A08,n@8,A 0SccKɀAcH pp,A 0SccK۝AcH D0S`cKہAcH (c8;K©OcA8`|+`e0c @|T>0|P80@ |89`/(/A}x1|()cH 0~S|H 0~SpH 0SlcKՀAcH |bH t0~RH l,@(0~SK5A4Ac8KOcH 0b,@ 0~Sȁ0!H b ,@ 0~Sȁ0!H ,@<0~SKA4A c8KQO,H ,@3S cH b,@ 0~S$ȁ0!H x ԀeH ` ,@ 3S,|,@ 0~S0|,AA;|+|*3 @,A3S4cA|+`e0c @|T>0|e0A|+3 |*0c @cA|+`e0c @|T>0|e0A|+3 |*0c @H 0~S8A;|+|*3 @cH P ,8A8A880S30T\c8`KRQO,@Hc0Tl8`KR1OH|T0!8`} N @ T0T0T8`KQOH|T0!8`} N T0T0T8`KQOT8`H .M-%,VAtA,,&AhAh-$AAT8aHH@H7a30cHa@@ 80T0T8`8KQO8`H h,FAA8aH@0`0dK]O`}0Tc8`KPO,A8.AXc([0g*]1@`g0g@ 4A0a,A([0g*]1K*]@ 3a`dKqO`}0U0U,c8`KP!O,@ `d0}T|:.a`~ A |.0U08`8KOO`0UDW:d.W:|.8`8KOO`W:.,AhdT:|..A 0U\8`KO}Od0HW:|}.0@K,@ dT0Ul0U|8`KOEO8`H @aH AcW:|.\.@ 0TȐ\0T8`8KNOa\0H0@KM,@ T0T0T8`KMO8`H <,f/m-vLB1LӂALFsA8aK!O,ax@TH@H7a30cHa@@T0Vd0Vx8`KMaO8`HH}@H73H@@|cKAA7AD\}8`|+|*0c @;x0\0xcKcKՀA-$0V<08`-m8KKUO@ 0aK5Aa\,HlA@Px0KO,axA$W:3|}.a\H\8`H0aK֝a\,AHHa\3.3H\APa@4ca@A\Ha\3.3H\Aa@4ca@K3@H3@aH@T0VL0V`8`KJO8`HpaK0cAxa0c33((,Ah|xaA4.0c0ax3@0c((,Kx.Ad|,((NB3A0|c(|"+0 |*0c @c#|+`e0c @|aTc>0|e|"+0 |*0c @0Tc%8`8K9OH~,A,A0hc#|+`e0c @|aTc>0|e|"+0 |*0c @c#|+`e0c @|aTc>0|e|"+0 |*0c @B`b;8c#8KP1O,@Lbc, @ 0{lKU0!}N 0{K0!}N btH=Ob bЀb0!}8`N ,@~+-Ap0K O,@0!}8`N b0,A00008`8K7O4@83Ăzc08`K7Oz0ԃc(=*-AKQO,Ac08`@K7YOcH`~c008`K75Oz08`K7O,@X8`, 8AK3O|4H88`H`0 0a`K)Az0`cK|4@zc0Kbc,ATB0@0L8`K6qO0P0`8`K6YO0d0t8`K6=Obc,A~,@p,@,/xLӂA\0x08`8K5O~, @0{K-0!HH0{KeH0,@d,cAw,AP008`8K5mO, @0{K0!H0{KHv,v/s,A`,r/vNFOZA`AP0(088`8K4O, @0{,A KYO0008`K#O,A0|8~|+3 |%*0 @~|+c3 @}U>0@~|"+0 |*3 @`0a(8b8K~O(1(,(:AXA4a1,(:A0|@~|+3 |%*0 @0(~|"+`0 @}U>0|@3,~|+3 |%*0 @89HP30(~|"+`0 @}U>0|@~|+3 |%*0 @8,@Ѐ,@Ā,@,0n0@0cH 0cKO;,@\3333ccKO| @3K,@8,@T:3;`;b,~3(;@H~|.|"+|*3 @c,+:LӂA(,(:AA,(:K@0,3N,c3,A|~|"+`0 @}U>0|@~|+3Z |%*0 @~|+c3 @}U>0|@~|+3 |%*0 @|.0PK5O,P0n|@A |@4T:|8.|АH|.KO3{3A3(~8|+|*0 @9KɑOb8K.O,A4tHeO9KMO H, @0nK؅0!H0n4KؽHc0l0a,KMA, @0a,K=0!H0a,KuH, @0nK 0!H0nKAH, @0nxKՀ0!Hl0nK HT 9 dH,@h0,1@(-@ Ȁ, @0n"pKM0!H 0n"KׅH ̀, @0n"8K0!H 0n"TKQH (O,@$@ Ȓ@8xH 0, @0nKֵ0!H L0nKH 4H  @GH xGH ؀ |G H ĀH ,@0,1@g(-AKŀA8||pT|g@K] O,A(KaO0g0,00H <, @0nKձ0!H H0nKH 0, @0nK}0!H 0nKյH , @0nPKI0!H 0nlKՁH Ȁ,H H ,@0,1@g(-AKeA, aP@8|8A(,^g g@ 9^H , @0n Kԁ0!H 0n KԹH , @0n KM0!H 0n KԅH ̀, @0n xK0!H 0n KQH ,@$0008`FKYOqH 4, @0nKӹ0!H P0nKH 8Kـ ,@ , A 8`8KO,@0,1@0(-A $08`KOH t, @0nK0!H 0nK1H x, @0nKŀ0!H \0nKH D xH ,@8vH, @0nKe0!H0n$KҝH,@0,1@(-APbT0PKO,A,d|8A;H=OH(, @0n PKѭ0!HD0n dKH,, @0n (Ky0!H0n 0|0+`@8| H @1|8|(+ aB@@/@,+^(+AX,L+B@Lc0 xAKO8`x0!pHKbMO,A8`x0!pH@,c@pK}A,cAK}A`~(>+`0 LA(KaO,k@T>A8`HxKO8`Hd0 KO8`HP,0 OFBA$KO8`x0!p}aN KaaO,@A 8`x0!p}aN APsetcc|}&!đ!<;:0 X3+:c (=A@9 , AT8,A /,/A A/AL@A<0t 0 08 K]O,tA3 0aKDcK8A80 0 b8K-!O,tAh`z0aK;@K,A@:`0aK8`H4A0t 0ccK"iO,tA 3`K\Ot`dc8K`aOAc, At3`HAhccc1a|03{A((:0AI`, 0(:@tKO0a|KO.t4,0a|8OB3A K_O0a|K]]O,0a|A$KA_~, AHAK0t0|KO8`H3K`:K|,A(@: ,H@0tKO8`HP<0K_O,A$0t0}0,03(A|0y(~|@3\@AX|yc}K[A,A@c3{|@39A,}K[A,Ac3{|@39K,|@8`ALAH(~0(.@0<|00@ 8`KuOcKUAh0!`}!N XP0!`N P!D0!`N !D0!`N Abkupnum|!<d0cKOc,;TA0;@0 KOc,0A`0(@04KO0,0@0H|A `KqAcKOc,0A`0P@0XK]Oc,0A`0`@0lK1O c,0A`0x@0KO,c0@ KOc0KOX0!P}N A| showpurgopts|}&!đ!`:B*:(=A@b_-AKEOTd9A@K1OTd9@Ѓ h(W:| À\| |N AbN(=A@00v008 KO,aA<., NP @0v 8 K=O8 l,H a H bWHhbPH`cPHXbWA A HHA H@cWH890v KOHb[Hc[H0v`0t08 KAO,1A8 . , A@̀ ,.H Ha H<cF0v80D0KIO,,1. Ap,,-AL0aA40aA0a@LK3qOH<K3aOH,K3QOH0aK3=OH@(0vHKO8 l,Ha Hp0vx00KO,.1A0aK2OH@(0vK9O8 l,Ha H0DH`0DHTA ,HL0vKO8 H0vKO8 H@7.Hb^@,.Ah@PA0KhAH(8 |3Ā;|+|%*3 @@(KN!O,@a l,H,x ,.,,A(0vK O8 l,H@ p@8 0v,A0aH 0,aKO:`bDK=O,`y~p,A.@pW$:3 c^-."|`-T, cJ!  1atA8|l.8aO,c_@LW$:0U:-- (  .0; $`20aKQO`{,cJ!  1ta@, a $|XA@bO, Ap9`a8<0aKAO,AP0v0@xKO2s0| @\KEO,cSA\ (3| HD,00a@K6A,cJ,0@,}H Aa*1*@BAa*,@(bF00a@K/O,Ax||p00@! 1(H.8`c&KO|@4U:W:d0|h.3K,|LA!A\cC2A|d.Ku=O,0v@cAD0|.A0@0K~OH0vAD|.K~OLNSA,2s0| @KO,cSA|3@0|h.K0HDLNS0v`A4K}O2s0| @KEO,cSA\,c0@}DB,0a0@,KIO1H! (3| 3Al,A0l9t ., ,,Apt9@ a HA0 0v,A0bH 0 bK|O,.Ap@dcRbCDHd|PV:UD:}*@})1!}H((B1~!.K$8 Ka KbZcRbCD 聁 0! |} N C dopurge|}&a쑁!<$;0}000LK5O70P0TA0}L8KO7.AKFO,A $@<,cbPЃ(A8`eH,KO" 8`ehd0!`|a} N h0!`}N hd0!`|} N C(doxdis|}&ԑ!p.<Ahb,0u0`0xKO,u,@`@ 0u|Kz!O0!|8`} ؂N (0uh00KO,uA (A DbhTe:|X|(|N b (0T0lKAO,uA HKDMO,u A 4AX3x eK%O`e0|c8`SKO~|0!Tc>} N |ebUg 6}k8Uk:}k b ȑ0!8`e} ؂N A 0uHb 4A؀0H 000K)O,uA 0KC5O,uA u xb ĐekAPK$O1u`e0ad8`SKO|0!Tc>} N 0!|8`e} ؂N 0cK,uA  D, 8`9`AeH e0!|Ԑe} N K|0!} ؂N b 00 KO,uA KAO,u A Ā e , ,/.@4T:L˂A(b 8|k(.,, L@+A ؐeH ؀eHO0!|4b8`ek} ؂N 8`K"O3`d0 c8 KO,uA K@O,uA ATu 3K"O`e0c8`SKO~|0!Tc>} N  |b8Б0!8`e} N } N ,9`@ 0e,@09Ё0!|8`e} ؂N 0u00 8 KO,uA ,,LB3A40uKsO0!|8`} ؂N K>O,uA ,,@D9`eH@D9`e0!|8`e} ؂N b008K O,uAK> O,uAAp,0 ,@0,00H @0$008`SH0(008`SKO|0!Tc>} N |0!b8`k} ؂N 0u40`0LKYO5c,LFB@ . L0d8`;8KO@00utKr-O0!|8`} N T=`aL0KO,cAP,AH8 |8|+`0 @}aUk>0|(@aL`eBP0HaL`eBP08`; 8;KMOaL!|+|%*3 @LK<O,A<!8`|"+`|0c @ |}T>,0eA K=5A,|~A0K=AA,}A!|"+|*3 @0!|к8`e} N 00bHЀ04K %O,uA,K;1O,u A|bLЙ0!8`e} ؂N H'eO|0!} ؂N <0u 00KO,u,/AA@h0u00 8 KIO,uAX ,A40uKo}O0!|8`} ؂N K:!O,uAu( 0(}k4@(A0|4T~P bTHXUk~e\,A K;!Au K;9A,@,0uKnO8`8K]OHu Te0!|к8`e} N 3 3(33XBP;`; ; |cccKO,u3A`39.8`|"+|*0c @zK6Ou`dcKaO@|cKu,@K8Ou,;AW%:3aX3;;" (B ,~,3|uA4,|y@KO{3H`KO{3K9iA3A~,KW:,@ (8|eZKuOuH ,8|eZKYOuHtb |KU,uA|0!|8`e} ؂N 0u,KlO0!|8`} ؂N 0!|} N |0!} ؂N 0!|} N 0!|} N C setfil|!<0~HKkO0~KkOX8`}0!PN AL settrmtyp|!<`0~00KO,~(4AAhTc:|c c|d|hN 0~008 KՉO,~A~,,LA,0~KjO8`dX0!P}HK5aO,~Ad~,,@b L8H @b L8bp88`dHKmHdbh0 0@KO,~,A@} N ,#@9#@@  8`#@$KO q|@ALKO,@<؁,A,0qK_Oq=HHq=,^BU( 6} @U:}Ph9@^A`j HHKe,qA q , @00qdK_%O0!|!8`} N ,#@>9#@, @@  8`#@쀟}KOq|@ALKmO,@<؁,A,0qK^}O>, HqH>, ,A@P ,,LB3A<0qK^5O0qK^)O0!|!8`} N q,Bh`l 0jU* 6}IPUK:9@H} @H  ,,L3BAKeO,@1 ,^@H,@8؁,A( , ȁ,LD A0qK]IO0,A(KUOq0!Hq0!|!Đh} N H90q(0H08 ;KiOq`e0q 8~K,qA|q @(hH8"ȁ@(H (0!|!Đh} N 0q0 K,qAt1 @ę(H ș(0!|!Đh} N 0q H0 p08 KOq`e0q 8:K9,qA |Q "́0!!8`Ih} N 0q008 KiO,qA K%}O,qA 1. , ?,_/ @A LEAD@Й(H  (0!|к!8`h} N 0qKZ1O0!|!8`} N 3@8`KO3`dcc8 KąOq`e0q 8^K,qA ATq 3K1O`e0c8`SKEO~|0!!Tc>} N 1 ԑ(H;c0q;0<@8 KO,q@ K#Oq,A ,@00qKXO0!|!8`} N 0q008KYO,q A A0q00<8 K%O,qA T<,A40q KXUO0!|!8`} N 0q 0 00@8 KO,qA K"O,qA ܁Q , H 9`h1 B|1 (*Aa<A@"hI0!|к!8`h} N ,5,lA A.G/X,ZNRLBӂAA@ .@0q!T;0!0H0q!;0!0cKO,qA q,@|@4 ~,A$K#A0!|H0؀~,AK"A0!|к!8`h} N KMOq`d;|"+c3 @}!U)>1}i@q@, |X1@@}$1_( \@}(* vA$Qa_|X1_@}$( \K@00q!KUO0!|!8`} N b K=OHbK-O0!|к!8`h} N `8`K!рA6;@00q tKUYO0!|!8`} N \2w:2bi~bHIB3q-53 .XHBXh;cfc8 @ 0q H0q KmO,qA,,}@L Ap}7B9@A9@})Sx}7C.@@KK9O,qA$~BbK }A8`H0q!$KT%ObK UA8`H,,A@DbK -A0 Ā8`8KO0 88KO,Ad0 88KuO,AD0 88KUO,A$0 88K5O,@KO,qA~b9`HA9@})P8(1k(9@BA9@})P8(q@ cH,X@ c8`H0q KRO8`HbKAqHp@,܀b0 40 8K5OqH( b $0 @0 DK Oq,A4KO,qA q"U 6}PU :@ `}*Hhi$H d}*Hhi 0!|к!8`h} N .t,u/vATAAP@\0q"0#$08KĉO,,qLFB@lq;|+|*3 @~K-OqK!O,qA(,,@Tb A(KOcKOHx8KyOc8KiOHPbA(KQOcKAOH(8K)Oc8KO0!|к!8`h} N 0q"0"0KAO,,qLFB@$q;|+|*3 @~KOqKO,qA,,@TbA(KYOcKIOHx8K1Oc8K!OHPbA(K OcKOH(8KOc8KO0!|к!8`h} N b@0"h0"l8KO,qAKO,q,A@H8`,9@@`j p"0!|!đHi} N 0q"pKNO0!|!8`} N bX0"X0"\8KO,qA,KO,qA,1@ (H4(0!|к!8`h} N 0q"00"T08 KuOq`e0q 8K,qA,1 @(H(0!|к!8`h} N 0!|!8`} N 0!|!} N 0!|!} N Csetsr|!<"b0#(0#,KaO4(8`@X0!P}`N hT:})AЀiL||N 0#00#0K-O,8 A|8`|+`i0c @|aTc>1)|cH,20#82@KKO8`XH4|88`|+|*0 @~H0#0#08 KMO`e0 8K, AԁX"}0!P8`iN b KUX0!P}N bK9X0!P}N 0#0$08 KO `e0 8K, A0X"}0!P8`iN bKX0!P}N 0$0$p08 K!O`e0 8Ky, AX"}0!P8`iN 0$t0$08 KO`e0 8K , A<X"}0!P8`iN X0!P}N X0!P}N ATsetxmit|!H <0`$,AKIMOH0!@}N 0!@N ADrmsg|A!< @B H;b L0<0}$0%K۱O,A{,AKA0%0%(8`KuO<0%,8`8K]O$0%80%D8`KEO</,+>(|@x@l$//,,A8/A0/A(,A ,A/LA A@ 0}%HKGO8`H8`H``L30}%l0AKGO8`x0!pH<0}%|@,& (>9@0<'H&+ ( A@8`0<&( + Lӂ@0<&( K, @ 0%A0%KG O8`H`@4K:1O,0}%<@KFO8`x0!pH0|4T~ 8ccK%O,0%0%AX8`KYO0%0%8`KAO0%0%8`K)O0%8`8KO8`x0!p}AN Aremcfm|}&ܑ! L`x|" @, Hb ;@Y][AKA\,@ <2&;,@Ā,@<$,//A<,A4/A,/A$,A/A/LA@L,0~&KEO,A0~&,KDOx0!p}8`N x0!p}8`N 8 cc|;|+c3 @|T>0|(`5|0A@|(}+>+|A(@a1BH@a1B,,O@!AԀ,@<$,//A<,A4/A,/A$,A/A/LA@L,0&XKCO,A0&|KCOx0!p}8`N bK YOxx}0!p8`N 8A`A A@ `}0(>@$|0+>@1|@H1|@@+ + A@4c3* + OR@3* + K,@,<0e&@ 0&H0&KBO8`HH@8cK5O,@$0| |f(@K eA6O@&@$0y'\;K?O-.-Hxa8|+|*0 @0y'x0'cKO`|-,@@ a8|+`0 @|T>0|0|e0@K A`o-@$0y';K?1O.-,Ha8|+|}*0 @0y'0'cKAO`|-,@@xa8|+`0 @|T>0|0|e0@`K A`v.@ 0y';K>}O-,Ha8|+|*0 @H,O@&cK=`|-A@! L@ă$c8KOc0'8`8KO0y'K!O:T>K#Ob3'KaO3'p;K1OYKOccc8KaO,yAa8|+`0 @|T>0|0|e0A$0y'K=1O--.,HK uA6O@&@$0y(KK"O8`KEOp3(,KOYH@8KOccc8KAO,y,@@a8|+`0 @|T>|e K}A`o-@ 0y(0K<O-.,Ha8|+|}*0 @0y(LK;OKO`|-AXbabH-bab-8`I.Ka9O;H-.H.,AbKO,A $AbKiAAaKYA@! LAbKAAA,A K9Oc0!|} N !TL0!N 0!}N Clplogin|}&!䑁!@, @; H& '&A,B<(z$@$b(0(P0(TKO,a8,@0@ 0z(XK9O0!}8`A!N 8HqO0!}A!N A hTf:|0l|0|N 0z(t0(0@K]O,A D0a@Km4A 4@0(8`K-O0`&`0(c&8`K O@0(0`8`CK^O~,H 0z(0(0@KO,,@0@ 0z(K8O0!}8`A!N 0a@K,A l,A KOa@8EH Ty>f,H 0z(0)0@K%O,A 0a@K5,A ,A KaOK@0) 0)$8`DK]O~Ty>,H pK,A 0)(0),0)08`HK]qO~,H 4܀,A@Ky,A X0z)4K7uO0!}8`A!N 0z)L0)h0@KO,A 0a@K-,A 8 @|8|+`0 @|T>0|08@ ԀP|;d|+|*3 @ KA; c?,H 00z)l0)0@KeO,A L0a@Ku,A <8 @|8|+`0 @|T>0|8,A,@ 0z)K6%O0!}!8`N bP|8|+|*0 @ ; k&KY,H P8`K0!}A!N K,A d0)0)0)8`IK[5O L9,H ,A ,@,0z)K5-O0!}8`A!N  0)ܐ$0)0z)0*080@KmO,,@,@0z*K4O0!}!8`N P;` a@a;|+|%*3 @ 0z*8<0*\0@K=O,Ad0a@KM,ATaa@8|+|*0 @a8|+`0 @|T>0|8,^@(0z*`K3O0!}!8`N 8 9 ,&8sA< &H0z*|0*0@KQO,A80a@Ka,A(@0*0*8`UKXOTy>,H0z*0*0@KO,A8 @|8|+`0 @|T>0|8A(0z*K2O0!}!8`N 0a@K,AK!a@8THfTy>,H0z*0+0@K1O,A0a@KA,A@0+0+8`WKWOTy>,HK,Aȃ0+0+ 0+$8`AKWO~,HX0zd0+(0+,KYO,a8,FA@0+0,K0+pH0+L,K0+p@`0@Hc&`0@K1O,A00a@KA,A d`8 <h'8(T~T@!U0+t0T8`VKVO~Ty>,H`c&0z+x0+0@K O,a8A|8 0a@|8|+|*0 @0z+0+0@KMO,AL0a@K],A<@0+08`VKUOTy>,H!0z+0+0@KUO,,@,@0z+K/O0!}!8`N @0a8K=O0z+0,,0@KO,,@,@x0z,0K/O0!}!8`N T8 @|8`|+|%*0c @K),A\,A KmO0,\08`KKTOTy>,H!0z,`0,0@K%O,,@,@0z,K.O0!}!8`N @0a8K O0z,0,0@KO,,@,@H0z,K.UO0!}!8`N T8 @|8`|+|%*0c @K,A,,A K=O0,08`RKSOTy>,HP.@0z,0-,H0z-0-,0@KiO,,@8@0z-0K-mOĀ0!|8`} A!N 0a@KA,Ap,A KmO@8mA8dT>`HyTy>f,H|K,A0-@0-D0-H8`XKR}O~,H@K,At0z-LK,O0!}8`A!N A,A KOc#ȁ0!|!} N !0!N 0!}A!N 0!|!N 0!}!N 0!|!N 0!}!N ȁ|0!} A!N Cdormt|!`T>,H8`dHb@0-0-8KO, AKO,A0`(AhTc:|`c||N , AD,0-A0-0-H0-0-8`SKNAOTc>H@b|xbtpH, AD,0-A0-0.H0.0.8`SKMOTc>HЀb DH, AD,0.A0. 0.H0.0.8`SKMqOTc>Hpb84HX, AD,0.A0.0.$H0. 0.$8`SKMOTc>Hb@<H, AD,0.(A0.,0.4H0.00.48`SKLOTc>HbLHH, AD,0.8A0.<0.DH0.@0.D8`SKLQOTc>HPbTPH8, AD,0.HA0.L0.TH0.P0.T8`SKKOTc>Hb\XH, AD,0.XA0.\0.dH0.`0.d8`SKKOTc>Hbd`Hx, AD,0.hA0.l0.tH0.p0.t8`SKK1OTc>H0blhH0.xK%IO8`H8`0!}N Asetat|!!B0~(8`@8`KA58`A-<1@>4Boe-.;;`; W?:@\0/|(@|x.HA`|-@|x.39KqOW?:K390w/A|.KOmca88K]O,@ cAtHaA-;K`,a0X88AHKAO\`,,A,d,A A;(;A ~|"+c3 @|T>0|LD BORLB3BAAbbC8KO,@T:d|g*K}OT:`|g*KaOhT:|t*KIOlT:|n*K1OpT:|(0eKOtT:|(0eKO0,,A\;@Ȁzc,AKqAzcK煀A,z\A~|+|*3 @K<0e/LKO, AaKAo8`H@K8oeK4b80g/(KO8HT~|"+c3 @|T>0|8|ce8@zK!O,@xW?:K, AaKaAo,,LBAbbD0e/pKOoXT0!P|} N A 0!PN  0!PN X0!P}N X0!P|N Clunet|ؐ!<, A =HK3MObx0!p}N A  clsconnx|}&!a@`9b<` $c@0/008`KO00:009b&:8`KO9,`9A41300s08(KO0!}8`N B -2,, A(@@:00`00lb8`"PKO2@,,8y9 . s(@ @L܁,A<130p0s0(KO0!|8`} N bȀ \K%OЁ" `h)ԑ(@00.H ,.A@ 00H00A\8,@ ,AB13Z!891! !<0a010189 KOHHB11! 89Z!<0a010189 KOHBA , @8Z8<01 01(01,0a 899 KAOH4Z8<01001801<0a 899 K O31@21PLb; , 0a@0a K1Os`fbc8`K}O,,@@A;/@\Ks O/:,=A@;-AU9A@KrOTh9@ / ,, A /. -A@A0A A, 0aK0: K:9K:9Kcc0101OJsBA|0s1010A;KQO,s,@$01@0s/K]O, 0aKsKۑOs`d|"+c3 @}!U)>1} @,?0s/AKO, 0aKL, @,|@t0s2,02<0K%O,sAp,A4=3y02@cKEOycK1OysHsKڱOs`d0a|;KMO9 |}|+|*3 @0a|8KOH.02D8`8K{MO@t02Pb8`8K{1O02d8`8K{O,A(02t8`8KzO3 ,+:LӂA14, AKfmO,@ h0s4K O0s5K O0s58K }OЃ,H @/@>15`, AKf O,@ 0s5x,K 1O,A 0s5K O0s5̃K O0s6,@06@KO0s6DKO0s6|KOЃH @>16, AKemO,@ h0s6,KO,A H0s6KuO0s6KeO0s7$,@07dKIO0s7hK=O0s7K1OЃH@H>17, AKdO,@Ā0s7KOЃ,H17?, AK#MO`dbcK1O088`KqmO,AKdAO,@<9 };|+3 @}U>1>=`} @1+}(H,d1|h@4؀08$KMAK UOЃH̀0s8HKOЃH,AKcO,@0s8lKOЃ,Hx0808b8`KpiO808088`KpMO8,@$Ё,@ā/@0s8@ 08H08,@ 08H08K O8:,@"b3S8䃂333h2c;33.cCbKO@0s8,A(KO@@3,.0s8K0s9KeO8| @2c;K|,@8,:@@T:1@=2(1H;19;`~ЃBđD; 0909bF8`KnO8,@$.;|+|%*3 @b|.0KO,A309} H}H!DU:~@.09(3~* b8`Kn OA("hW:}H}H}N 09t8`8KmO;`?, (:A8A8c(3, (:AA(3, (:K(:@3;09c8`KmYO,@p.|h.,A,0a8?KO0908`8KmOA0c0a8?KϡO0908`8KlO3hy;|+|*3 @,AP09b%KOy0b%KO098`8KlyO/,H809b%KO098`8KlAO/,,OB3A0c8?KO?0s/8KO9@}h@,A@,@/c8?KqO?y`eHyHԀyH̀yHĀyH19,0s9H|.KOH4T;|+|%*3 @,@(3hy;|+|*3 @Hy,A<09b%KeOy0b%KQOy`eHy`e098`8KjO0:0:<8`KjO80:@0:T8`KjOy0@8KO,s@t1:X,A0:t0:8`KjAOKO`d;bcKO|"+3 @}U>1?})@H} @,d1 }( @|,h, (AK\O,@t8,@d1:0s:KO0s:KO0s:KO0s;KO@H(0s;8KOH0s;PKmO@2R|@313{ApЃH Ѓ,@ "h i9 0};|+|*3 @KOo"0, it" @44(,A/9 (8`Hܒ9 (8`Hȁ@,Aā/Hā/tU(9 b0};|+|*3 @ce0;p8`8KgO0;|0;8`KgO,@0K O~0;0;8`KgO,A-0;0;b.8`Kg}O,@$"X9`i9 (8HD/A/LӂA@$"؁9`i9 (8H 0;0;8`KgOKO= , 9 (AHkO.,HHj!O.,,OBBL3AA@h,AX;HAL,8`d@@KܵOKO,3Thz- AA,8`d@ K܁OAT8`KOАhKO,@ H`OЀhHX1("9`i;A@"hU:} @}H}N 9 (K9 (K9 (Kt9 (Kd9 (KT9 (KD:9K04l04KeIO1340s4(KUO8`H9~.;|+|*3 @8KdOK,KO,sA49.K02Kx02Kp03 Kh03K`03KX1310s2 (8?KO8`H܀KEO,s`vA, 0aKTH0s1010A8;KO,s,@$01@t0s/KO, 0aKsKOs`d|"+c3 @}!U)>1}H,0s/AKYO, 0aK夁1310s1̑(8KO8`H0s1|KO8`H0s1TKO8`H9 };|+|*3 @</ ,OZ3BA9, KKO,sAT9, K`H@,A(?,9 x(A 9 (9 (8`0!|} N Csetlin|!H0 ( ,T:hA|dc|d|hN ,b8`K_O0>;0>8`K_O,0; @(|00>0>08`@ `K_YO0>4,0>H8`;;@ 8K_%O0T02|@T 6KA,v;Ѐ@8`~H|,;1@T((( 1(3|8@((( 1K,Hcg`; ,;c8`@4;|1H Aa(1, BAa,|8AW02bc|8bA8`gHT 6;Г;|8'HA,c0>L@88`K]O,@;cHH`Kh;0|h.|@ܓG0 (c8KOuOcx0!p}N A z_open|!<;ԃ,88@HD8`0!PN |0Tf02|0T 6AD8`0!PN ;8`|.,;@~@0!PN `H~MA,8`@~X0!PH@;Ё|01.0 8`X0!P}N Az_close|}&ؑ!p7:``|`c8@4<3>\H,/8`AL0!HL<,c0>`bA@8`K[yOc&0>h0>x8`K[aOc0>|0>8`K[IO;Ԁ,|88`@{}0!N W02|T 6A$cg}0!8`gN ;ch.|,@0!}ؐhN cgT}.8`@$0!|ؐg} N ,@X8`8 @$0!|ؐg} N |;|+c3 @|T>0'c&0>0>8`KZO@c~,c;`;@T0a888H@c0a888H{A,3{|A@c0a888;Ё||cc0!} N 8`0!|ؐg} N ,3W>c@4c,0a888@HzA`~cH$ccc%8HzɀA`~cKO}`ecD8`KXO@ 8`,@8`{Hpc0w>88@DHzaA,;Ѐ;}A8,0A$cH;8}c0!|} N C z_out|}&Б!``h<`;Ԁ,|0``8`@$!THf0!pN tHU02|0T 6AD8`f0!pN ;Ѐ.|,,;@Df0!pN 8`T@Df0!pN .8`@tDf} 0!pN a0>@ tD8`} 0!pN 0>8`KVOc0>0>8`KVOcF0>0>8`KVOc0>0>8`KViOA,|@,xt0!p|ܺ8`f} N 3?T,A(xt0!p8`|Ԑf} N ccE8`Ac#8HwрA`wc%,b0>;8`A\KUO0>0?8`KUO0?0?(8`TKUqO0?,0?<8`TKUUO;|0H3v?@3:@p4c03@Hw1AH f,Tf>( A(ATc|@4KtKqO`ecdb8`KTO;|0,0AtK-O`ecb8`KTeO,@ ,:b@ HH@(cT8`AfxtH(c,A :bxt0!p|} N C z_in|!<;Ԁ,|(@8`e0!PN Te02|c(Tf 6A8`d0!PN ;Ѐ|d0.|0,@8`e0!PN T};@8`Ld0!PN K9A,bA ;cXL}0!PN Az_flush|}&ؑ!<`;Ԁ,::܀@H8`f0!pN | Td02| T 6AH`8`d0!pN ;,|d.3?\,B`@H8`d0!pN ``@,:;A;bcHtA`~z.KiO-`ecc8`KQO,8`8@yxH(;8`|0@ @8xt0!p|} N C pz_seek|}&ԑ!pB<`z;; ,`c=:@`ܻpd8`e0!N @lccK,3@T0!|Ԑe} N bc|A ܻpd8`e0!N W02|z;T 6~.,@d8`e0!N 0?d0?pc8`KPO,@z;|v,@bHr]A;.b43@HqA,H0ewe,, AAb4KcbAbKHrAc=`yK;Ё|(|bܓ0!8`} N @L;b|(HqA0?t0?8`8KNO0!}8`N z;К[|v,|A@P0?0?c8`KNOc8K,@ 0!}ԐeN ;~@3\3[;` 3?b0a\8HqA,8`Axa|+`e0c @|aTc>0|c(0@|( @t`KO`ec~c8`KMOHL8`eHz;Ѓ|v#0?0?c8`KMO8`HLA@b0a\8K0z;Ѓ|v0?0?c8`KMYOc0!|} N C z_line<;Ԁ,|(8@8`N Te02|c(Tc 6Ab88`N ;Ѐ|.|,88`@ N 0e N @ z_getname|!0<;Ԁ,|(@8`0!N Te02|c(Te 6A8`d0!N ;8`(.|(,TAd,0d 0@A c@H0KMA,cAHnQA\| @c@c0!}N 0!N A z_getmode|!H<;Ԁ,|(@8`e0!@N Te02|c(Tc 6A8`d0!@N ;Ѐ|e.,@8`d0!@N HmqA,@ 8`dH0!@}N Az_getpos|!<;Ԁ,| @8`Hd0!PN Td02|c T 6AH8`d0!PN ~;0?|.},0?8`@H8`f0!PN KIO~;|c,@ 8`}X0!P}N A z_getline<;Ԁ,88@8`N |0Tf02|c0Tc 6A8`N ;8|.8`,@ eN dN @| z_getfnum|}&!<`;;,;`"܀9@8aL!D8`0!`N cc8HjـAccH\Th02|0}@8U 6AaL!D8`0!`N ;..8`,B@dy!D} 0!`N cHjA`xc@l88Hj9A,c@8HjmA`~cc8Hj Achd0!`H;|00f K]OHlHiAc43@HiA/H0f/, AAc4KcKhd0!`|} N Cz_count|}&ȃ!P0,:; ,( b`:;;::`:@h <b Ā0B0BKuQO7#,@@0|BK܅O8pc#}0!aN 8`ÀhT:|(<|(|N ; HH; H@; H8; H0; H(; H ; H; H; H; ( 8`AdhW%:|d||N bT>(:(=A@;,AK:IOTe8|4T@ +x@|}0D;|+|%*3 @D|4T@0aDKO,A00{CKyO0!|a8`} N D0aD(\@ E0(%(&A@`|(%(&A@L0p0KO,a|@00{CKO0!|a8`} N W~|4TA cW~,|0@ 0{C0CKHOapHD,0|@ 0{C0CKKOapH0{C0DKKyOap,,@8@0{DK-O8`ap|0!a} N |W|,A00{DKO0!|a8`} N ,AT{KO,@@܀80{D8KؕO0!|a8`} N 0aD8KOK)O,apAc0aDK,a@@Kߡ3DX`ec0DKO0!|a8`} N K}O`d0aDKO|0!a8`} N 0{C\K׭O0!|a8`} N @0{C4K}O8p0!|a`} N <0H;]<0@80a0D0D0Dc89 KO]8<0D0D0D0aH89 9 KO0aKO,ap,@0@<0DKֵO8`ap}0!aN L,,@ H @K9O,apA؀a,@B;;`,@\ccK,ap3{@,K݉`e0Ec;`KOH@3|(A0E80EHc8`K?OHLK],ap@<K3EL`eccKՕO0!}a8`N }c0!aN b<,0El0E0E@ B$HB̃BZ@ 1{AH1{Bla81aHa<0aL8;9 KOZ8<0E0E0E0aH89 9 KO0aKO,ap,A|8`,,A;@8K3OTe>(:(=A@;,4T~AK3OTe8|4T@,AK3OTe9@ (T:|A||N ::`8HГ8::`H0{F0F08 K>iO,ap,:A:`H@H0{F KӑO8`ap}0!aN 8::`H@0{F 0F@0`8 K=O,apA ,@:0FD0FX8`K0|8|,A~HA|8@800|bTA`UJ>|8G0B耛HbT8;|"+|*3 @~HD|0|8@(0|`}D(T>0B~acK޽,@HKM3F`eccKO0!|a8`} N D0{F0F8;K^Oap`f0F8`K:IOap,,@4A|4TAK O,ap;A0D8`|+|%*0c @0F0Dc8`K9OD4(T~A,A KO,ap3APD(\0aD@ E0(%(&A@`|(%(&A@L0p0K!O,a|@00{FKUO0!|a8`} N c0G0D8`K8O4WAKO,apAP=@00|(A `,@ a0ʀ8K`~Ha8K`~,@.0G$0G4c8`K8QO0G80GH8`K85O@,Ё|0!a8`} N cKՕ3GL`dcKO0!|a8`} N 0G`8`8K7OD(A 0aDKwOH0{GpK͡O0!|кa8`e} N 0{EKmO0!}a8`N 0{EKIO0!}a8`N @ 0{EK!O8`ap}0!aN <00Dp0D8 K7O,ap,@0@ H0DKO8`ap}0!aN KmO,apA a8K,@<K3D`eccK]O0!}a8`N 0!}кa8`eN KO,8A `,@\,@ p<0vI.; KO0vI;`K˭O0vIK˝O,@3J$ccKM4cd0vIAKiOccK,39TeT~A,T}zT`8TzrAH03J|"+`0 @|T>0|8|+3 |%*0 @,0vJ0AH`3J|+c3 @|T>08|+3 |*3 @,`3J `A@|+c3 @|T>08|+3 |*3 @,3JA@|+c3 @|T>08|+3 |*3 @,A KO,ccA0vJKO0vJ,HKE`dcKO0vJ,KɵO@(0|(@KaO,; A3{|(A0!|кa8`e} N <00J00J@8 K3O,ap,@0@ 0JDKO8`ap}0!aN KO,apA \aK,@<K93J``eccKȱO0!}a8`N 0!}кa8`eN <:-0Gt0G0G@ A8HAb[@ 1x@H1xAp3AHa8A<0a. 8L9 KO[8<0G0G0GcC89 9 KO0aKO,ap,Ap,,A;@K&OTe>(:(=A@b,AK&OTe9A @8 /,,AA HL:HDbH< /@$,,AA H;H `,A$ 0G0G8`K0O@KO,apAaK4,@,K3H`dcKƑO8`H@K#9O|e4T~,AD0xH,@0H ,H 0H(,@ 0H0H0H4K%O,@:bHX0@@ā[8A<0H80HT0HX0a89 KO[8<0H\0H`0HdcC89 9 KeO0aKO,ap,@,@0xHhKuO8`ap0!H,,@\ |0H8`8K/O,@D@$(+(-A@ bH :H@ :|А|KO,apA |a|K0H0Hb8`K.O0H0H8`K.iO,,@ALaK,@0K3H`dcKMO8`0!H.H .,LA|.;0H0Hc8`K-O@(,@ 88`H(acK,,@@@8`HK 3I`eccKÅO8`HA`aK`}0I(0I3KyO@؁}.|3( }++-@d(,({@X+}AP+;AH(?A@(.A8+'A0+\A((/A (#OZAA0L0aP@(0L0aPKIA0P8` KOHK-A0P8` KO@}.|K<0L 8` KOH4b|@0L|@AKՀA0P8` KO22At0L$8` KO0L(8` KO8` KqO8`H$}0!8`N 0!|} N C  savkeys|A!,;<8@L0L00LL08K*O,,A<"Ta8@,`d0LXK}Ox0!p}8`N 0K-O,P8AP,8 8`A@||+``0c @|aTc>0|@88 b\H88 b\|;`|+|*3{ @80Lx0LKSaO,`AtKmO,cA`a8Kex0!pHTKEO,c"AD0`LKQOx}0!p8`N x0!p}AN x0!p}N Adosave|А!b``"`<2:c#8KiOcKO T>KO8`K!O3L,3LAdKOKO3ccc8KLO`|KuO,@ccc8KԀbcCKyO~c#K%Ox0!p}8`N A (readtext|AȐ!B"``ă<`~2Z y2L;b8K OcKO3LU>K)O8`KO,AhKOKIO3bcc8KJO`}K!O,@bcc8KԀbebK%Oy0xLKObKOZ}0!A8`N ADreadpass|}&!6#x:``::@9:`@<20LH8`HĂ<,@3L0Lb%8`K O,,A.@@A<8cK5Oc:0L8`8K 5O,@,@$0!|8`} N 0pLK]O䃂Ȁ: T>KO8`KO T0L0M 8`KOKaO,@30M$1M<bԃB8`KYO`}ac$c8`KiO,,cEW>L3BA|KNO`}c-0M@.0MX8`KO T0M\0M8`KO,,A,AAA ApH T,@`KO,A8 ,AhKUOKO30M3pM3Bc#cdc8KGyO`},,0pM@,K}O8`8KO,HAh,@KO,@c#cdc8K; p;|+c3 @}U>|hKUA`o.@$0pMKO-,HD;|+|}*3 @ab#KO`y0Mb%c&8`K]O,,LBA@K}O,@3PN1Nȃԃ;`8`KO`acDc8`KO,,cW>L3BA|KKO`c-0N .0N88`KO T0N<0Nt8`KO,,A,A0A$A AH T,@K}O,A80Nxb#K O,A0Nb#KO,@ 0N0a\KeA0a\Hx,AT8 |;|+c3 @}U>0|(<@ 0N0a\b%KA0a\H0N0a\KA0a\KO T>KO8`K-O,AhKOKO33pN3Ncccc8KDO`,0pN@ K!O8`8KO,@hKIO,cccc8A0pNKO; ;|+c3 @}U>|`@K}A`s-@D0pNKO.,HK~K쒻Kh;K`;|+|*3 @b~H-,A0cKO`y0O0O$c&8`KO,@(x,A"܁8 c2|@.A(b$c8?K|)O?H .-,A,cK O0O(c8`8K5O@A$AaK{}AAbcK{mAbC0!|} N C4ckxlogin|!H8`8KOH8`}0!@N A0 ckxlogout#$x$$$$$$$x$$$$$$$$$$$$$$((((((((((((()T)T)T)T* (***4567@7dB8>B>@4@4ACDlDtEEJ|EJ|J|J|J|FPJ|J|FJ|G0|0@LA;;HLA;;;|+c3 @|T>0|8Pc0;@0cKOAL|+c3 @|T>0|80fKqрA7v08`A`AL|+|*3 @bcKO@008`KO,T:|8T:Ah|2,A\|0c|0@3dAHdaeA|+c3 @|T>08A|+3 |*3 @b2}c08`KYOb$A0h0rK$0r-KYO;A0h0rK3d3,}3A KpYAA0h0r0HKȀ},K̀HD0!@|} N HD0!@|} N C@parsdir|A!0;0<0~0DhK1O,,À<;` ;A,a|"+c3 @}U>0c|h, 0~3D8 @(0~KO0!}a8`N a;@|"+|*3Z @0 00c|c@, 0~@3h8 @0~$K]O8`H,a;@|"+|*3Z @0H00c|c@, 0~L38 @KO8`Ha8`|"+|*0c @KluO,@0!}AN 0DcKOOb0hKOOb0KOO,b9 @9 (8`0!}AN 0!}aN Acklogin|!9b0h0l8K9YO7,A`0}t008@8 K %O,A8Kk=O,A cKO8}8`h0!`}N Asetdcd|}&!``z-;8"cb̐8K}OcCBKOzKIO8`K!Oc#A$0x008K8!OH008K8O.,,@0|08KNO,܃Ѐ@dz,,0{0A 0D@0LKOH(bĀcA,0{P@KO f~H0l};|+c3 @}U>0|@8KN O,c#0D@,,A40{t@0,A0KOH8bc@ ,A$0{,@KO h~HKO`aDc}|c@Tc:|.08`KAOz,,0{DA0}0|@T:|0.A 0H0K%OH4bĀcA(,0{}0@|@T:|0.KO ~x0!p}N x0!p}N Adochk|ؐ!Pb00 8`KQOBd00(8`K5O0,0@8`KO;,,; A4ce0D8`8A ?KOccK- O`xKO`d0aT8Kg]O0aTK,O`w; ;0{ KA0{ ;:KA2TTh 6}@U:0{@KqA} }(@6 6H0a]KEAW 6}U 6HW800a`K!ATh 6}@U:0ac@KA}@c0X0d8`KO,cAxKe!O`~c0h8`8KOcc0x8KOccc8KOce0|8`8KUO0H<8008`K-O8,b`ApK O`f008`KOcd8` KIO`f008`KO8` KtO`f008`KO008`KOcd0|,888AKE9O`~ce08`KMOc00,8`K5O,,/@ L A8304c8`8KOc0D0P8`KhO0!}N 0!}!N A dologend|}&ܑ!胢`~,,;`B@\c_A4,0TAKaO}H0dKEO}0!AN 0x08`KO008`KO-,AKaqO`x.zH,;@;.z@ `yAc008`KqO008`KYOc0a8KbOa00a8KbO00a88K-O0aK(=O`wK O`d0a(8KbO0a(K(O`}3 0aKՀA0aKŀATg 63(|8T:0a8KA8: | |Ah0a1K}A0a4KmATg 6|8}@W 60a7T:KEA}|(T 6|@T80}'@-;A-c#33AK`UO`0z3Ѓb@3A3KOc0zKO0z0KO0z,@0(KO0z,,@0@KO,A|01@0D(U:A(}@.}@}N 0zKAOH H0z@0`K!O,A01Kc#,@(K_=O`dcKO0z0H$0z@3cKO0z0KO0z,@0KO0z$KOATc#HT0zpKaOK@0z\KQOK00zKAOK 0zHK1OK; c#0!|} N 0!|} N C  dologshow|!Kb샢8;@ 8;KuO`xcc8K^OA|+c3 @|T>0|0A= ;|+c3 @|T>0|8A08`|+`f0c @|T>0|8|0A8`|+`f0c @|T>0|8|00 |0,c3[(0D@4KO`fccccDc#KvAcHKvAc0\8`8K1Oh0!`}N A dologline|ؐ!b胢`0l0|8`8KOKE88KO`~; c3Vhcc;8K]1O!/,|+c3 @}U>0c|8A@3V!~8|+`0 @}U>0@!08|+`0 @}U>0|@8!;8|+c3 @}U>0|@8!|+`0 @}U>0|@|80 |8,30@008@40({@$|0(}@~1a@30ca@.@8b|@D|801(%@|8+sA$8a|1@|8(%K@<0x8%KEO0!|8`} aN ,AKMAA@00~KMQA@;|+|*3 @0!|л8`f} aN bKO0!}aN bt0K]}0!aN  P0|0408KO`~.(@(|c0!a} N AW:|||N b@0<0@8KmO,a8AT0DA 0dH0h@ 0H,@ 0lH0KdA8,A@0bĀKA0!|a} N ,@0bK 0!|a} N bK၁0!|a} N @0bȀKﱁ0!|a} N ,@0bK}0!|a} N bxKQ0!|a} N b40K)|0!a} N b0K|0!a} N b0Kс|0!a} N b0 K|0!a} N bt0 0Ky|0!a} N b0 TKM|0!a} N b0 K!|0!a} N b0 K|0!a} N 0|"\K|OH b|0"0"8K]O7@(|c0!a} N KGIO,a8Ab|Г0!a8`f} N b<0 K!|0!a} N b@0!K|0!a} N b@0!,0!08KuO,a8AA0b0!4K읁|0!a} N b0!XKq|0!a} N bh0!|0!8KO,a8A,/.LB3AAXA(0!|a8`} N b0!K݁|0!a} N b0!K뱁|0!a} N b0!K녁|0!a} N b0"KY|0!a} N b0",K-|0!a} N \b`0"0"KO7@$}0!caN KDO,a8A, bP@b<8H0!}8`faN 080`"0"8 KO`eb88KIO0!}aN 080`"0"8 KO`eb88?KO0!}aN c0"K,a8A,A`KBO,@0#KxmO~((@0#8KxQO~(/@0#XKx5O~,A KD]A0!}8`aN a8}0!aN bKO}0!aN b0`0#p0#t8K9O7AKBIO,a8Ab0!}8`faN bT0$K!}0!aN b0$0K}0!aN c0#xK,a8@؀~,AK@O,@d0#KvO~(+@0#KvO~,A KBA0!}8`aN ~0#KOX,,@t@c0#K$ObT,@0#K$yOh,@ 8`KB9A,d}A;` 3_#a; |+|*39 @8`0KAA,}A3_#a; |+|*39 @8`0KAA,}Al3_#a; |+|*39 @8`0KAqA,} A,a3#;`|+|*3{ @0bl,@0$K#EO~0$ H@<8`KAA,}A$8 3$|;|+|*3 @T8`,@8K@A,}A$8 3$|;|+|*3 @~0$ KO,@b80!}л!8`fN bX0$PḰ}0!aN b0$pK䡁}0!aN -&b3\&3;` ,cD0@@0|%pA0|%H0|%A0|%KO,a8@A,; Ata|+c 39 @|T>0|8|8@H`K?IA,3},A a@; |+|*39 @ADa8,.@0@bhH b|K=UO,a8;A ,8@hW:db3~|{bbx3{@K OHb||K Ob3Z|{@~3{K@bh.Hb|.@dW:3a"db3bBx}|~3@K -OH||K O3|~@}K̓88`@ 3~2,~2A K=A@~~,K|a80!} N 0@0}$0$bKO,aPA @,A܃TT(\@ċcK(fAa@0$b8K!YO,Apa@0%b8 K!9O,APa@0%b8K!O,<0A(a@P0T0PK=O@H@btK}O0!}8`aN bp0%K}0!aN b0%HK}0!aN bKԁO}0!aN bl0& K9}0!aN 8b<0&80&0|8|8@H`K9yA,3Z}, A a@; |+|*39 @Ada8,@K7O,a8Ab,@Db33},AK8̀A|3@},K,^@ I00`B0!}л8`fN ,@32,~2A K85A@~,K|a80!} N bKнO}0!aN b삡KЍO0!}aN 080`&0&8 KO`eb88'KIO0!}aN 0`&Ԁ0'0@KEO,a8,@@ @4uHa@,,A<@ @H0P8 |;|+|*3 @@K5IO,a8A8bȀ@KO0!}8`aN b3@.53'; ,c0@0w'h@0w'A0w'8KAO,a8!@A,;@At|+c@3Z @|T>0|8|8@H`K5A,2},A !@;@|+|*3Z @APa8,.-5@@bDH b@K4O,a8;A ,8@hW:Lb3~|~bbH3@KeOHb||KQOb3{|~@~3K@(bD0'0'b8`KiOH$b@0'0'b8`KEO.b@V:3@Lb3b"H}|@(KO|.cF0'8`KOH(|{KO|.cF0'8`KO3Z33{@}|K88`@3@2,~2A K3ՀA@~,Ka8H\b̂KyO0!}aN 0`'KgAO0!}8`aN 0!|} N }0!aN |0!aN }0!aN 0!|a} N 0!|} N 0!|} N |0!aN 0!}aN 0!|N 0!|} N C |setdial|A!bK1O0{'KeO;@,T:@  G0.,ApD0{(,@KeYO0{(KeIO,,/@0{($Ke)O0{(DHL@0{(,KeO0{(DH4@0{(0KdO0{(DH0{(8KdO0{(DKdO,@,W@0{(`KdO0{((H,WA0{(hKdO,WzA0{(lKdiO,W8A0{(tKdQO,WA0{(xKd9O,WA0{(|Kd!O,WrA0{(Kd O,W0A0{(KcO,WA0{(KcO,A0{(KcO0{((KcO,A,@$0{(KcO0{(̀,H 0{(KcqO0{(̀,A0(H 0(KcAO0{(,A0),H 0),KcO0{),A 0)8H0)0{*lKaaOcH-A,Ac0{*Ka=O0{*Ka-O0*8`8KO0{*,8 @8*K`O,@`0|8`@Pxt0!pHaH;KIOaHD#8, A P9@\8{,H0/Lc8KO,8`@KO,aDA8| ܀b9 8}H(1)}0B8`HX@,0{/TKQO0 K6ŀAT>K9O8`K?Oa@T>K7Oa@,@$0{/pKQiO8`xt0!pHKUO;@,,AA$0{/8KQ%O8`xtHb.|@$0{/KPO8`xt0!pHpADb8KO0{/KObԃcKUO8`K)O3/30LH@A KOcc0H8KIO,@@؀xtH+ K(k-@1A@@}@(\A(11?@}@(\@(}H(\A}}C)D0-aH11?@D}@({@8}#H1(\@(}}CA}|)aDH0}(H}#}}#)DaH3D}#0,A,+ K(k-KHP}; )}3|0H8|+`0 @|T>0=|(0|(,@DA0D0HKe O,@(0{0PKNOAbKO8`H<|@0HW:|e.,A$KAa@Tc:.@H8`|"+``0c @|aTc>0|,bAAcaH8|+`0 @|aTc>|`K]A@T:|h).@}T:|c(.,ADH8|+|*0 @H$cHcH$c|AbKO8`xt0!p|a} N Cdosetkey|!``,`e`b8A020a@K2AAH@c0<0@K=O,<8 8At||+`0 @|T>0|0,G8G@0f2KLO8`H,8,A||+|*0 @0!}N A protofield|}&!"B9 b0202!d!!!O8`x0!|} N |!d0!} N !d|0!} N C\setproto|!b0404K1O7A KAO,A 8`XL}0!PN Apsetdest|A!b0@040}4KmO,,;A<0}4䀁@P@$KGOx0!p}8`N d;` ( ( 8`A@8`0@+ ( LZ3@0@+ Ka|"+|*0c @KO,8AB`@0(|z,@`@E`( c9`@,3@I+ @3@I+ K, A ga|+`0 @|T>0|8(@t;AKAcKрA,z05 @@0}5KFQO8`Ha|+|*3 @8`8KObЀc;,a@;@(K95O,0}5,@@KEO;,cA;x0!p}AN x0!p}N x0!p|aN A setprinter|}&! ;,^a@DHLPT/F0;@8b KO胡}0!N @H(@ԃ0!K/ApT:| ,| |N b05058K5O,aH@HHK=O4aD@H0,AH05,/@05`05H0@05\\`H05\\`05Ā`8`SKiO胡}0!N H}Ѓ0!8`dN KO胡}0!N aKO0!}N ,-/R@H@HA0( /AT:|||N b08,080KۙO,aH@HK O,aD@H ,@P$!H|HA<`38@0@| .0|HA3@K@@|@A00~88KBMO耂}0!໡8`N 耢(0!}л8`dN K胡}0!N 88`,L88K*O4aH@407078`KqOL07107؀8`K5OaH}0!໡N KY胡}0!N 0d08088 KO4aH,@,@08K@OaH}0!໡N ad,,P@X+-@ 08K@O0!}H08K@}O0!}8`N @(09K@UO0!}8`N KO09`d0h`8 KO,aH@Hh,,P@X+-@ 09(K?O0!}H09PK?O0!}8`N @(09K?O0!}8`N K AO,aH@HLadhKO,aH@H,$KO``| aHA쀢KO``| aHA,0!}л8`dN b@08P08T8K1O,aL@HDK 9O,aH@H,LА8KmO胡}0!N ,/?AxAwAwL,C/jAf@|00: <48<tO!x092p909090a`889 K aO80a0909<O098199 LK )O";::!:;`:@;9#;.;/;@&0a`K AOaD`fabd8`KOaD,@H;,@K%O/:,=A@;,T8A ,A 0:L0:8`KyOL(T:|A0||N x: H 8x: H0p:K80><8K5O,aHAhLKAO,aDAh8H}؀Ѓ0!8`dN ,EADDAB/ ,/+AADA/ Ap@H0̐<L_P0a0>l0>0>Ԑ889 KO<T_0a0>0>0>889 KQO0aKO4aD,/@8A@0~>䀄K#QOaD0!}N L0̀ |(@L@KO,aDAgL<0? `0?8`KO,0|4@X8&"&"0!}8T~л8`dN L0?0?08`KQO0?40?HcK O,aHAf`KO,aDAfLH0?P0?d8`KOL, ,OFL+AT:H\|!.<80?h0?t8`KO0?x0?8`KO8`}}0!ແN aKO0!}N A=/,/,#A<\A;A:A5,,(//@t0!Hx0!}л8`dN 0~HK)O0!}8`N 0~HdKO0!}8`N b|KO}0!໡N ,NAA0+)AT:| ||N b0I0I8KO4aH@ aH}0!N K O4aD@ aD}0!N H8,8AH}Ѓ0!8`dN 0`J0J0TKO``,aD@0J TH,D,@ aD}0!N KO4aD@ aD}0!N TcKɕO8,8A䁁aH䁁a}0!N KO4aD@^4aD}0!N K偁胡}0!N ,A$/@8,A(胡0!}8`dN 0`J$KAa,A,H 0`J,KAa,@0J4,A8")0T0`J80H8KQOaDH,0T0`JT0HKOaDD,@,D,A aD}0!N H,A00`JtK O0!}8`N P8 T|;|+|%*3 @0T0`J0J8KO4aD@aD}0!໡N T<dT0KOK5O4aL@aL}0!໡N P,A8Pd8KsOTb8KOH80!}л8`dN 0`JK}Aa,g@/A$,@8/A(胡0!}8`dN ,A,[@0JH0JАa,g@0J"H0J")0T0H8KiOaDHX,[@0JH0Ka0K<0T0HKOaDD,@,D,A aD}0!N H,A00`K@KO0!}8`N P8 T|;|+|%*3 @,[@0KX H0Kx a 0K0T8KMO4aD@aD}0!໡N T<dT0KOKO4aL@aL}0!໡N P,A8Pd8KpOTa8KAOH80!}л8`dN b0K0K8KO4aD@ aD}0!N KO4aH@ aH}0!N D}Ѓ0!8`dN b0K0K8KeO4aD@ aD}0!N KUO4aH@ aH}0!N D}Ѓ0!8`dN 0` 0K0K8KO4aD@ aD}0!N D,@D0T0`K0K8KO4aH@ aH}0!N aTKUOaT`d,AT,A00`KKMO0!}8`N T(0AT+9@DT(AAT+Z@$T(aA@T+zA00`KKO0!}8`N TH4K]O4aH@ aH}0!N D}Ѓ0!8`dN b0L$0L(8KO4aD@ aD}0!N K۱O4aH@ aH}0!N D}Ѓ0!8`dN 0h0L40L8KO4aD@ aD}0!N D,,AHA 胡}0!8`N bKu O0!}N băKtO0!}N 0` 40LD0LH8KQO4aD@ aD}0!N bȃKtuO0!}N ̃bЀ0LX0L\KO,aDAS ,AAbԀ0L0L8KO,aDARK٭O,aHARD8`,,OA!AR耢D0!}л8`dN 0~L|0L0TKYO,aDARXb؀TKO8`}0!໡N ܀b0L`0LdKO,aD,AQ@0~Lh0Lx0T8KO,aDAQЀT8,@T老TcK5OЀ8HO8`}0!໡N KEO4aH@aH}0!໡N D,@`HT0!}л8`dN 1d0~00L0LKO,aDAPP8 |;|"+|*3 @TKeO,aHAPDT:|8 1|;|+|%*3 @8`T`(8+70Lӂ@PDLdKA,ATdK!ATdT8`(1+20Lӂ@OLD,@Tp88+n@@ LH@ L8HP8(n@p@Hp@ L880!}л8`dN bTKp O0!}N 2<0h20L0LKyO,aD,AN//&,AAhADA 胡}0!8`N K~O胡}0!N H O胡}0!N KR}O胡}0!N KvO胡}0!N b PKnO0!}N 0D0`L0M8 Kt]OaH?b TDH0QKoO0!}N b pKn}O0!}N b,KnYO0!}N 0`0M 0M$8KO,aDALKO,aHALȁD} hЃ0!8`dN 0`0I0I8KQO4aL@ aL}0!N K%OLaD,8`@ KO0T0`I0I8KO4aH@,aDKOaH}0!N aD; KyOT;|"+3 @|T>0| ,?@00`IKO0!}8`N aTK]OLaT,/,AdA<@b XT8KO0!}л8`dN b \T8KөO `8KTc8?;K}O?K0``0I0I8K}O4aL@ aL}0!N KmO4aD@ aD}0!N aLKO胡}8`0!N K胡}0!N b d0E|0E8KO4aL8`@ aL}0!N K1A7#a@4!0`EKO0!}8`N X80| 0BL8`(AIHb<t8;;@,0F0H8 @ 0{EH0{FHKoO,aDHA,WA/,/@A@Ax,/T~LL˂A`,D,/@@Lӂ/@A耞, ,+ALӂ/@ApT>|(|#.LK X008| B,AaKeA0!}к8`dN ؀,A0`HKO,AaK A0!}8`N ؀,A0`GKO,AaKϽA0!}8`N 0`GKQO,AaKyA0!}8`N DH,8@0KO4aD@aD0!}N D,@|,AaKA0F8`8KlyO~0F88K]O,ATd0F88K5O,A,d0F88K O,@KO4aD@aD0!}N L8,A P8H8 X|0BX808!H| 0B<LH,X@TL,@H؀,A 0FKYO0G$KMOX8&"&"t,A8,@tL,@hpX8,eAp/m@X8؀X8,A0`GhKO0!}к8`dN 0`GKuO0!}8`N ,AaḰAaD0!}N b h0C0C8KO4aH@ aH}0!N b l0C0C8KmO4aL@ aL}0!N K]O4aD@ aD}0!N ܀,ADH,@80`DK5O胡}8`0!N 耡H} pL0Ѓ0!8`dN KO胡}0!N b0C0C8KEO4aH@ aH}0!N K5O4aD@ aD}0!N H} tЃ0!8`dN ,@L0D0`D(0DT8 KhOaHDH0aL8 KcOaHH,@P0D0`DX0D8 ?Kh%OaHDH0aL0KcOaHHL0D0`D0D8 ?KgOaHDH0aL0Kc5OaHH,@ aH}0!N ,@(L8,AxL,Hp,@(L8,@DL,H<0`DT 6| T:| .KUO,@,AxaLeT 6|(T:`h|KO`e0D0D8`SK!O~}~0!໡N L,`T 6|(T:|@88,@H x,@t$KSO``| aHA@؀H,A$0`DKO胡0!}8`dN 0hT0A(0A8K9O4aD@ aD}0!N K)O4aH@ aH}0!N D}HЃ0!8`dN ,A0xH0 ̐a,AH\0BL0BPK5O4aH@ aH}0!N H8`( A= T:|(|(|N b@0B`0Bd8KO4aL@ aL}0!N L,@DKáO4aH@ aH}0!N l8Hl0`Bh0B0D8 KcO4aH@ aH}0!N D,@<D/A00`BK!O0!}8`N 0`B0B0L8 KbO4aH@ aH}0!N L,@00`BKO0!}8`N KMO4aH@ aH}0!N l8D`Ld胡0!}8`dN ,b 00C0CKO4aH@ aH}0!N KO4aD@ aD}0!N ,A\H0C$||(Ԁ |T8|( 0C(8`SKO}0!N H8,8@ H  ,H ؐ@dH/AXH, ALH 4T:| .,A4H 4T:| .,.@H 4T:| . Ԑ ؀ ԀeHO胡}8`0!N HbL0C,0C0KO4aH@ aH}0!N KO4aD@ aD}0!N H8,8@HHH,P88@ H}TЃ0!8`dN ,A00`C4KO0!}8`N Ḱ胡}0!N bX0CT0CX8KmO4aH@ aH}0!N K]O4aD@ aD}0!N ,ApH,0Cd@0ChH0Cl0Cp8`SKO胡}0!N H} Ѓ0!8`dN KvO胡}0!N b KWO0!}N b\KWuO0!}N b`KWQO0!}N ܀,A00`CtK O0!}8`N b ăKVO0!}N b 胡KVO0!}N P8 bP0`0A@K֩A|0AlKO4aD@8D,@0`ApK-OaD0!}aN KO4aH@aH0!}aN ,@40`AKO8`}0!aN t,A40`AKO8`}0!aN D8T8|(|(,P@PP8K/F@PaDKyO,@8P0`AK O0!}лa8`dN KOP``| 0A<00`AKO8`}0!aN ,AKL=O,@x0,"@ 00`BKMOHP0,@ 00`B,K!OH$000`BD0>HKyO,aLA%/,AA`A0!}8`N cKEO,~A$}0!໡N b0>d0>hKy=O,aLA$lKIO,aHA$XL0!}л8`dN 0~>L0>`0D8 KJOaHЀbȀDH8KF%O}0!໡N b؃KDO胡}0!N 8`KZY胡}0!N 0`>0>40D8 KJ%ODaH,8@DbDH8KEmO}Ԑ0!N ĀbȀ0=0=KwO4aH@ aH}0!N H,@H0=0=8`KHObKCOaD`f0=0=8`KHiOD,@ aD}0!N 胡0!}8`dN K O4aD@ aD}0!N H0=0=8`KGOH,,/AAPA 胡}0!8`N 胡0!}̀8`deN 80`=KuO488A H}Ѓ0!`N 쀢̀8,8`A KQO胡0!}8`dN t`T:|e"KAO}Ԑ0!N  |0h 0<0=Ku1O4aH@ aH}0!N H8`( A T:| ||N 0`=0=,0D8 KFO4aH@ aH}0!N D,ADD/A80`=0K۵O胡}8`0!N K]O4aH@ aH}0!N D,@ P8H D,@ P8胡0!}8`dN 0`=L0=x0D8 KEO4aH@ aH}0!N KO4aH@ aH}0!N aDKyO胡}0!N bЃK?]O胡}0!N 0aHK?5O4aD@ aD}0!N aH KuOH8,AԐH }Ѓ0!8`dN 胡}0!N 0D0`=0=8 KDOaHb`DH8K?]O0!}N 0D0`=|0=8 KCOaHb\DH8K?O0!}N bpK=O胡}0!N b؃K=O0!}N b K=}O0!}N 0`<0<0L8 KBO4aD@ aD}0!N KO4aD@ aD}0!N L,@00`|0`KA4xALx8 T|;|+|%*3 @0!}л8`dN 0!}л8`dN  0h0;\0;`Km=O4aD@ aD}0!N D,@0hH0;d0;hKlO4aD@ aD}0!N KO4aH@ aH}0!N D}(Ѓ0!8`dN D,@0hH0;l0;pKl-O4aD@ aD}0!N KO4aH@ aH}0!N D}$Ѓ0!8`dN KO4aH@ aH}0!N D}$Ѓ0!8`dN 0h0;|0;Kk!O4aD@ aD}0!N KO4aH@ aH}0!N D}ȀЃ0!8`dN 0`0;0;8KjiO4aD@ aD}0!N b@0;0;8KjO4aL@ aL}0!N K O4aH@ aH}0!N D,/,/A`ALA8@LX胡0!}8`dN LKЀLKLK3;ēx0hX0< 0<$KiO4aD@ aD}0!N D,cAD/b@KO4aH@ aH}0!N D8,c8@||H||},Ѓ0!8`dN KIOaL8`KOax0<(0TKbEO4aH@,aLKOaH}0!N aL; KǥOT;|"+3 @|T>0|,?@00`<,KO0!}8`N D(AT:| ||N Tc8?;KO?H8 T|;|"+|*3 @H8 T|;|"+|*3 @H8 T|;|"+|*3 @Hd8 T|;|"+|*3 @H<8 T|;|"+|*3 @H0`<@K͡O0!}л8`dN 0`0|` 08@@|(1(%@|(a+%@T0H1@|((%KԀbTKuO胡}8`0!N 0`|` KUA4A@T;|+|%*3 @0!}л8`dN 耂}0!ແ8`N bK%O}0!໡N 0<T<_0a050505А889 KO8<_350a<050505889 KO8 |8|+|*0 @0aKO4aD@LD,AD/@0`5KuOaD}0!໡N L0 |(@L@|L8`/c@K50!}N Tb06KVO4aL@aL}0!໡N L, @<܀,A,0`6KO0!}8`N KMO4aD@aD}0!໡N L`/ Ad`,AT`/AD`,A40`6>?P?|?BBBEtFFGBG8O8GdH$O8HHHJO8O8JK$K|LXLXO668L8x8889(9T969:T::;0<0|0! ;|+c3 @|T>0|8!0;`|+cf3{ @|T>0|8|0!;`8`|+cf3{ @|T>0|8|0!3aD|+`f0c @|T>0|8|0!8`|+`f0c @|T>0|8|00 |0,b@,A$,`cc0bAKAAH$!`; 0wb|+|*39 @KO`f1wbccccEcadcjKAc0b8`8KuOH0bKA0!}N A 0 dologdial|!b80b0c 8`8KO08KYOXL}0!PN A\dialtime|!b80c0c, 8`8K}O08KOXL}0!PN A\dialint|Ԑ!`yc&8`0c0;3hcD:0c@;3cLtKO8؃Bc#KO`ccdc8`KO,,AP@\W>,ALcE,@<KFYO,,A@$,HcHH:,AhW>x0!p}N A ddinc|}&!䑁!``~b cc0cP8`KO.,tA(,@b,@c0{cXKO~"8,Bȃ$Ab(K|O( @,Ax,@l,@0,/A 8 A8T>K|OH4A0,/A@8 A8T>K|mOc@ KO~,@Thd0!`|!} N Chttslow|}&A葁!`,3c\3cpb A8`KTz~c~@ccF8`K1O( ,) A$cCA K O8` @ KO@,@hd0!`|A} N aL0!`N Cwaitfor|A!`; `0ct8`|+`z0c @|c8`8T>KMO0c;0c{8`8K)O|+c3 @|aTc>0||cce3`AP3|@@@KA,AD,|cce3A|@@K8`h0!`}AN 8`K A(didweget|!8`0c0c8K1O8`KEAb8`KqAb8`KaA0c0c8`8KOXL}0!PN Adreset|!,0`,( ,* A8A KO8` @ KOHD|} 0!@N D0!@} N Ctdialoc|4,,AA4A 0ed(N ,&0cb (@8 T:|c .b8TAT:|(.|c(|hN ,0dd,@0dd0}N ,0dd4A0dd8}N ,0dd<@0dd@}N ,0ddD@p0ddH}N ,0ddL@T0ddP}N ,0ddT@80ddX}N ,0dd\@0dd`}N 0dddN }N A\getdm|!!<',,;A؀@cDAԀH,c$EL3`@4{3KUO,|A|c$3@ {K,c$33@0~KO,|A,c$3@ ~K܁h0!`}!N P8KP8K!D\0!`N P!D0!`N A$ getdialmth|}&ܑ!P; !80}dhKuA`d0a8KSOa8,A`"8a%83KeO9 9`})HA(aK??1K, BA aK?"i0}d|KA`dbKSO0}dKрAT`dcKSO0}dKAbX`dccKSO0}dKA`dccKSmO0}dKuAa84$,LB3AL"\b`0DKO,A,, B<"P9`@j)H *i!80}dKA`d0a8KROa8,Al"d8a%83KO9@9 }IHA(aI1I, BA aIBha8*KnABH"L9`33 c c}i)*B3]x3;c,A,3.KPO@3c,K؁"@3X3;c,A,3.KPO@3c,K؃"D,A80dcKO,@t;,@cc0dKP5Obl#, @0dKPO>, @c0dKOOh?, @8`KmA,d~A; 3}d8|+|*0 @?8`1)?KmuA,~A\3}d8|+|*0 @?8`1)?Km5A,~A3}d8|+|*0 @?8`1)?KlA,~ A3d;|+|*3 @?1)?Hc0dKO,@`KO0dKO,@D;,@cc0eKNO>, @Tc0eKNuO0}eH@;, @cc0e KNQO>, @c0eKN5O0}eKqA"`da#KOIO0}e KQA"p`da#KO)O0}e,K1A"t`da#KO O0}e8KAa84$,LB3A!L0aLKMOaL,A;0P8 83PKOx||.|,3A4KMQO?||1)?A.,3K0aL8KMO0!|} N C ` getdialenv|!`f 0eD0eX 8`KOK0}e\,b; b@ 0elH0etKO0e|,0e8`8A4KOKO`d}b,0}eA KO  /,,/A0}f cAB0fDcFA0}fAdK]O0f0f8`8K!O0 KMA(;8` T; A,KmyO}b,H 0}fKO0f0f;8`;8KOH0fP8`KO,,0}fX;;cLB3A\KOzc^,A0HhA,0}f\A KiO~,@0}f`KQO0}fH$0}fd,A0}f|K-O0}fK!OcE0f8`8KO,@}b,HKO0 KA0f00f88`8KO(;8` T; A KlOH,,;;@0}eKuOH80}f@(0}e,0eA0eKIOH K=O0~ KEA(8` TA KkyO0f0f8`8KOH}b,A KgA|b,A KgA,8`@;h0!`}N Adialfail|}&!p":,;99@ (,8 |8|+`0 @|T>0(8 |f;|"+c3 @|T>0|0|(,@\0qgKOKAqb,A KeAb,A KeɀA}0!N 3gcKGOKM,@4T,AtP,,@,A@L,@K~A,AcKdQAT>8 |f8|+`0 @|T>0| ,@,c0g\0acK}Ac0KFYOg0gd8`KO,@g Ag ,@H[,@0gl0g8`8KUO4TA Kv O,AB, A8`K(O0c8KO,@0qgK Oc0qgKOqb8,A KcAb,A KbAK=0!}N B, H , g HB, ,@A8`KvO, A|8/Al   ,ATKaOg qb,`d@0,A$0qgKO, 4TH, 4TOB3A<,Ag,H(g,Ag,H(g,@ 0g萑gb3qg샢 Bt8,8` @KeOqgKuMOgccKqb8,@8`H54qfA,A@b3: ,,0qg@(0h A0h(KOc#KyɀAH3: KUOb8`d,/A,A䀜,AKsOc#H(@K)Og c#HHYyg c#KyUAb0,b@,8` Kf0h,0h@8`KO,APg 8` ,A@KdIO8`KsO8`K|ɀAbKU OgcbcHT,, /A@x<,@h,,AA$`9,;H4TA(@,A`9,;HA@x<,@h,,AA`9,;H4TsA(D,At`9,;Hh,@X,,AA<`9,;H0(H,,OB3A `9,;A0hDc8`8 KObgcK8`8H2,qfATb,,A(,0qhT@0h|A0hKOb4b@gcK,, A@ <,@8`K0|(@,gc0h8`KOqggKH0h0i8`8KO( ,Ax8 |8|+0 @|T>0|(@Lc0i 8`8KaO8` KxuA(d K8`Kx]A, H00i40iL8`8KO, H , A8`KxA0iP0ih8`8KO8`KoO, A܃9,Apd,,A Ag9Ky.8H4T9A(dL,A|g9KA.8Hld,,A AHg9K .8H84T9A$(dP,Ag9K.80il0i|8`KOA8,Ax0i0i8`8KOq88`8KsрA`n.0i0ia8`KmO@(0qiKO0qiKuO0qj0KiO@9.,AA,@0qjXK1OHЀĀd,,AAg9K.H4TA(dT,Ag9Kߝ.HlȀd,,AALg9Km.H<4TA,(dX,Ag9K9.H.AHq8, A<8`8KraA5@$0qjK-O, 4T1H, 4T1OB3A.,/'A,A@䀂̀,@ 0j0aKpAg0aHtp8 ,m,/oA8A$,eLB3BA$8 (0jH ,sAA8 (0j0aKpAg0aKq8, A,8`8KqIA`n4, TH4, TAA0Ѐ/@Ԁ,@؀/@܀,@x/@hb,A$0jbc8 KoAH0kbc8 KoAgbcK!8`8H+9HAx9,ALЀd,,AAtg9K,Hd(gel9KܵHHԀd,,AA,g9K܉,H(gep9Km,AЁq8,A8`8KoA5A,A耄,,./LB3ATA,A8`,H$d,@ (d|,,LB3AT~@ĜKm4T3( A/,,@0| 40| A,0|H @(!@@4TTA4H=U,A,@HDrf,H,,A0l(bcK,A耑,A3H @ + A`@( AP8`KATc~Kq3+ ( ,LjA@ + A@( A f,AP,A@8`KlQAKrO,TdzA ,@0ql,KOa0p0pH0lDbcK,@0lHbcK ,; @0lPbcK,@0mdbcK,@l0m|bcK,@$,Apfa0p0pH8 |3m8|+|*0 @88fH@8 |3mh8|+|*0 @88fH 0lTbcK-,A08 |3lX8|+|*0 @8H0lhbcK,A08 |3ll8|+|*0 @8 H@0lbcKӭ,A08 |3l8|+|*0 @8H0lbcKm,A08 |3l8|+|*0 @8H0lbcK-,A08 |3l8|+|*0 @8H0lbcK,A08 |3l8|+|*0 @8H@0lbcKҭ,A08 |3l8|+|*0 @8H0lbcKm,A08 |3l8|+|*0 @8H0mbcK-,A08 |3m8|+|*0 @8H0m4bcK,A08 |3m88|+|*0 @8H@0mLbcKѭ,A,8 |3mP8|+|*0 @88fHD8 |81f3lL8|+|*0 @HfH A0(AĀ8T:|(|(|N 0nHbcK,Af8,H0nTbcK,A1f8,H0n\bcKб,A1fr8,HX0nlbcKЉ,A1f8,H00n|bcKa,A1fR8,H0n bcK9,Af8,H0nbcK,A1f8,H0n bcK,A1f8,H0n,bcK,A1f8,Hh0n8bcKϙ,AL1fR8,H@0mbcKq,A1f8,H0mbcKI,@0mbcK5,A1f8,H0mbcK ,@0mbcK,A81f8H0mbcK,@0mbcKν,A1f8,Hd0mbcKΕ,@0nbcK΁,A4f8,H(0qppKyO1fr8Hf,@4TKa0p0p8`KO8`KàAf8`,,@Ka0!H x8`@,KXO0p0p8`8K]OH8`KXO0p0p8`8K1O8`,A(Ka9A0pe8KO,,A@,Kj}O,TdzA,@0qpKwOK],@Ā,@ ,A@KO4qbA,f0qq,@ 0q,H0q8KwuOH\f,,A,0qq<@0qTbH 0q`bKw9OH 0qqd@ 0qxH0qKwOqfKqqb,A KC9Ab,A KCAf,8 @H0nbcK,Af0qn8Kef,K8`K-Tc~qfK]f0n0n8`K=Of(A(B@f@@1f8,K80nbcKO,@f0nbcHp0nbcKO,@1f0nbcHD0nbcK}O,A0nbcKeO,@ 1fr0nbcK,Af8,K0nbcKʱ,A1f8,KX0nbcKʉ,A1f8,K00nbcKa,A1fr8,K0nbcK9,A1f8,K0nbcK,A81f8K0nbcK,A1fr8,K0obcK,Af8,Kl0o bcKɝ,AP1f8,KH0obcKy,Af8,K$0obcKU,A1f8,K0o$bcK-,A1f8,K0o,bcK,Af8,K0o4bcK,A1f8,K0obcKȽ,@0obcKȩ,Af8,KT0obcKȅ,@0obcKq,A1f8,K0pbcKI,A1f8,K0pbcK!,Af8,K0pbcK,A1f8,K0p$bcK,A1f8,K|0o@bcKǭ,Af8,KX0oHbcKlj,Af8,K40oTbcKe,@0o\bcKQ,A1f8,K0ohbcK),@T0oxbcK,@@0obcK,@,0obcK,@0obcK,A1fR8,K0obcKƱ,A1f8,KX0obcKƉ,A<1f8,K00p0bcKa,A1f8,K0p0|0, @ c0r0ahKPA0ahH0r0ahKP}A0ahKmOtb,9@FA K7UA}b,A K7=Aؒ}0!к8`N 0bp~8KUO,@8`KMOcc8KO,@8 |;|+c3 @}AUJ>0|P, @ c0r0ahKOA0ahH0s 0ahKOmA0ahKluOtb,9@FA K6EA}b,A K6-Aؒ}0!к8`N ~8KMO,@0s(cK~UO,At0ts4KiOc0ts`KiOtb,9@FA K5A}b,A K5Aؒ}0!к8`N ,,A@fT(9`HT(@8fT>, @U48A(,t,t-t./@48H(U,/t,-LBA 8@,@8 f|;`|+cf3{ @}AUJ>0|P0@H|0(;@48`-H4,A }c0s|KM5Af8`-KH O@ ,@9fH؀ ,A8 f|;|+c3 @}A,t(UJ>0}P }0fA|ab,a|@0A A@b,|@0@,Ab,aKH}0fKБf,8Aff.H,$1F<|P@ TfaH|@f.80|(,AcKa!A(k,A8Te:|(d|(|N 8f8HTf8HH,A0rwKZO8f8H,A0rwKZO8f8H,A0rwKZO8f8H8`Kf8H,/@DeK`)A,1@,,A80rwKZAO8fH(,A0rwKZO8f8H8,A0rxKYO8f8H ,/@DeK_A,)@,,A80rx KYO8fH(,A0rx KYuO8f8H,2@8`XKmf,Hx8` `KYf8H`,@(,AD0rx0KY Of,H48`Kf8H,,<@0,A0rx@KXO8f8H@8` Kf8,H8`%Kf8H,:,;/A ,=@(,A0rxXKXIOf,HtA@8`%KMf8HT,@$,#,/2@,/A@8` K f8HA 8`8@Kf8H,@$,@,2/,/@8`.KfHT,0|8, 3}@;,04TA,-./H ,-3,0| c8`8KO,,A40|8`8KyO4,A`KO0|,0|@8`8KIO,AX8 |8|+`0 @|T>0|(cKIO,@<8`h0!`H0gcKc0|D8`8KOz4,A KO0|\0|p8`8H 8`KO0|\0|p8`8KyOgcK]c0|t8`8KUO8;,Ad0|0|8`8K-O{88`8K]A`0|0|c8`KO8`K9OKYOH0|0|c8`KOch0!`}!N Amdmhup KUOch0!`}AN AXdoftp|A!btBc,0z ܃PA,8 b0|;|+|%*3 @H80(`,(:`1'9A$Ada',(:1'9@KAO,A|,0!0z A(K,9O8`|hHTK(KEAKOK~O`T>KOch0!`}AN AXdoping|}&!p```c:@0!8`8KIO,: 9@V}0!N : ~;|+c3 @|T>0|8|h@V}0!N KQA`s.A ~;|+|*3 @bcKO`u~;|+c3 @}({U>|g@ApKA7A4~;|+|*3 @v,A KAAxbcKuA0!|} N ,,;:;`OB+BAU:b68+\b({,+}@23{;H4L1OZA<4bb213{@2b;`H2Hb0A6(babb0!(`8`@UK!Oz2,b;`;A K]AcKuA,zA ~2|z+|*3 @3Z( @$2+ @2+ KbH$`2H`2;,|A@+\b({,Kp,V:LBAd|v.3,A KAcKA,|v.A4~;|z+|*3 @0!1} @,h|gHA|g@KA,|x.A A(;|"+|*3 @K@$0s$K"MO8\B 2100dH$0s#K"%O8`H$A0s#0#0(b&KO,a\.W8Ax|x.,A KAA(;|"+c3 @}U>|g@KA,|x.A<A(8|+|*0 @.K@#0s#K!eO8\B 2100dH#,A,,AT@@̀TAW8.A0s$H0$X0(KEO,a\.@@#8s(.KO,s(AcKAs(A;|+c3 @}U>|g@KA,|x.AA(;|"+|*3 @K0s$K MO8`H"8|W89.KÀ0s$0$0h8 KO,a\A"\hW8|A.K܀,@D .@0"W89.K`0s"\KO8\B H"0s"0KO8\B H!䓁W89.KAb쀇W80$0$KO4a\.A|.0aK@!0s$K!O8\B 2100dH!pc0$\0$t8`KOA0s$x0$0(b&K%O,a\.As(;KOs(A|+c3 @}U>0|@hW8@ |x..AKꥀAh0gK김A,|x.AA(8|+|*0 @.K@ 0s$KO8\B 2100dH hc0$0%8`KOA0s% 0%,0(b&KO,a\.@@ 0s%0s(Hs(KmOs(A;|+c3 @}U>0}G@Ah!\b'~P1@@}#81g( \@|8(vA$a\ag~P1g@}#8( \KAW8|..,A`K5A~8.s(A8|+`0 @}U >1}Hh|gH@`KA,|x.ALA(;|"+|*3 @K,0s%4K}O8\B H@W89.0aK b $0%p0%tKO,a\W8A|y9.0aKAb (0%0%KO4a\AL0%0%8`KO\W8|A.KpAl.@0s"0#P0(H0s#(0#P0(@ Hb&KO,a\,W8A|x.,A K础As(;K%Os(A|+c3 @}U >1}Hh|gH@KyA,|x.AA(8|+|*0 @.K@@0s#T@ 0#XH0#pKO8\B HA<0s%0%0h8 KAO,a\AhW8|A.K 8hW8|A.K A0s%0%0(0hKO,a\.AhW8,@|x..A KQA(,.LBAA8|+`0 @}U>|g@K1A,|x.AhA(8|+|*0 @.KD0s&KO8\B H@0s%KuO8\B 2100dHēK0K0&H0&`8`KO,AD4.@8P0s&d,@ 0&H0&KO8\B HD<.A$,@H ,@t,@,0s&KO8\B 2100dHP 13&$0&䀽(%,b?(-,AA A,0s'K1O8\B 2100dH49T-0'4b&8`KOT0'Db ,0'TB 08`" 4KO, 8b쐧 < @ DD" Hb LB P T$ X ' \" ` d, h lAbT 6|8T:|@,A ,A a,A,A  ,A ,A ,AG, A  HG ,A  dH$,A0'X0'h8`aKO,A p t(',@ 8̂ x, |  @@ (5'0'l0'8`8KuOH`,,@@ (5'40'0'8`8K-OHT,@ 80'0'8`K~O@|(0'b&8`K~Os(KOs(`e0'b&8`K~O(,@,0s'KO8\B 2100dH,@D,A,@40s((KuO8\B 2100dHĀ,@8x,A,0s(\K-O8\B 2100dH|; 8|+`0 @|T>bKiO,0'0y@K%A6A8|+|*0 @0|89/(/8XA}ɮ;~6ɮ|ɮ0~69KkOa\bKߙA\,@,b0s(KAO8\B 21HbbKO,@ xa,,A,0s(KO8\B 2100dH8@0s(Ȉ,@,0s(KO8\B 2100dHKYO,`zAlbT<0\00\K(yO{cDK&O,@,0s(K1O8\B 2100dHb cDKO@D,A8,@,0s)4KO8\B 2100dH,$,,@dA(0s)PKO8\B 21H,A80s)KmO8\B 2100dH,M‹BA4,A,0s)K)O8\B 2100dHx@h,A,A@L ,A .@,0s*(KO8\B 2100dH,.,NRL3BAA,0s*TK}O8\B 2100dH̀T.@XX ,A9 } p}8|+`0 @}U>|@|?`B T 0*b&8`KyO0P0(0*0s*0hKMO,a\,A0-U(:|A.1  (`0*3(0,1)3(AX=1|@@A 3(0,1)3(A=1|@@K 10U:|8.b8`b03*KxOcc,:P;`@4KjO }U|+2 @|T>1~8}|+3{ @|T>1|8|80| b&0*0+ 8`@x}|+39 @|T>1|8}|+3Z |%*0 @}|+2 @|T>1|8}|+3 |%*0 @H KwOA0(0*KL-H0s*K O9'\B H@KAO,a\AL-Hl9- @,,A0s+$0+0b&HT0s+@H@,@0s+\0+0b&H,A0s+x0+0b&H0s+0+0b&KO,a\Aa|g4TA 0s+a,AKaO;@ aA8|+0 @|T>1|8@taH3g,A K؅AccK؝A,aHADAa8|+|*0 @쓁L9-HL-HL,@|H,Ap8 ]|;`|+3{ @|T>1h8|0g<0|8KO0+|80b&8`KuIO@8,@,0s,K QO8\B 2100dH b;@;`,-H,@;`,-A@0,40,Dcf8`H0,<0,Dcf8`KtO,A00s,L@ 0,|H0,K O8\B H 0,0,c8`KtYOWg8b |8Ț;0,(b&8`Kt-O@@S(|4TA00s,K -O8\B 2100dH |S(; !8|+0 @|T>1|8,^@00s,@ 0-H0-K O8\B H !8|+|*0 @ @<0-$b&8`KsQOceb 0-4b&8`Ks5OH80-Db&8`KsOceb 0-Tb&8`KrO,@ATP*  '8 b? 3S-d'8 }|8|+|*0 @|4T (A 0-p0-tb&8`Kr]OH ,A !',@A@ |4TA8` cKۭO,b A1|8h0g@DK̀A,s!TA(;|"+|*3 @~H 0/$0/0/ c8`KlO,A4A$0s/$KO8\B 21HP H b?'c0/X0/hb 8`KlO,Hb Hԃb ,;b&@ 80/l0/|8`KlIO,@b 䀁8KO,@b 老8KεOd,@b 쀁`8KΕOl,@b h8KuO,@a؀ 8K),A .A ,A, 0/ \0/8`KkUO|,AH d0/ 0/8`Kk!O 0/0/8`KkO .@0  (('0/0/b&8`KjOt,@p 4T~, A =H\; 8|+0 @|T>1|80gKA,}A;|+|*3 @,A@,,A@(,Ab#'(H8`8K\O|g4TA0s/KO0s0KO,AD,A4x,A$0s01I}KPH@|r.;.A KAcKA,|r.AV.!(|+|*3 @K01018`Kd9O,A$0x1KEO;3|};Ha,Abd8Km" $~ 1)Bq,AK-A!8`, A8`K1O`0101c8`KcOK=O7@ K]Oc01028`3`Kc]O02c8`KcEO~ >4B3|};3,.3A KmAA}.,K,9@@"cIH@0x1\KO;3|};K 0x1pKO;KpV.K0x0KO8`HL0x0KO;K@A@8"0x0KyO3|K 9@"cIXT0!P|} N Cdoxconn|}&!``~: .|,`b0LA8c0`2$KO0!|8`} N 3AT"22D22L3(P;` :cbbKO`t-3Z:`A\2-a}(|+|*2s @}K O(`dcCKO@:cK,@KO`t-A,@b (8b2b(Hb ,8b2b(0s|H A,`C0, BA`@|.-@02PK}OHb?@DV@:|3T333~cKO@33~K|T:|sb$:KOH(,.LRBA-2XV@:@D33V:b:3b{b?c^@b&,2W:8A$|w.K IO|`4T~HaK|w.KUO`t,|3{AD}b$|sKO@ || |}3BW:~3.Hb@b&,KX|3Z@b{b?c^K,H-@<3T21,~21A KA@~,Kb0!|} N Cdoadd|AȐ!`,:@,0u2|KIO0!}8`؂N ,A,0u2KO0!}8`؂N 3(0u2030 cKfeO,u,@,@0u3 KO0!}8`N BT:` (~a;|+|*3 @ ̀ru(,@ BP=H BP=3(;c$KNO~a(|+c3 @}U>~a;|+c3 @}a Uk>1J}KP}|}JX|@@c~a|+c3 @}AUJ>1P~a|+3 |*3 @330~a|+c3 @}AUJ>1P~a|+3 |*3 @H0u34K-O |b xH, a,AAl ,},A\,;AP8KQO,3,@\@ }8,AḰ,Ah (},AX,;AL8KO,3,@@ }8,AKc8KO 0`fb 403\KO,uA $,13t`A 0u3xH0u3c038KO,,uLFB@\ ,At(,Ap5cP0P0KO(ccKO,@40u3KAO8`0!}H샒(H~a;`|+|*3{ @KO,uA8`K=A7AxB 8 ,A  ȓH, @~az;|+c3 @}AUK>1H}JXU|hXK̀A,u(A܃z~a;|+|*3 @(~a;|+c3 @}AUK>1H}JXU|hXA H@KMA,u(AH~a;|+|*3 @( W1J8`WhHP0u4$KO8`H<0u4LK}O8`H(;K<;K0u4tKUO8`0!}AN 0!}N ALaddsend,,/@ 8`@N 0c_AL 8`N @, arrayitoa,@@8``,?,[0 LA`,_,z0cAL 8`N @@ arrayatoi|}&Aȑ! 82(0x5\05h:b:`K{qO,x ,:@@,@x0x5lKO0!}A8`N P9 0D(}!;|+|*3 @|0Hx(K1OD!H,xa*,@@:@:H,A(0x5KeO0!}A8`N KEx14U#:KA7C.0x5:@,KO0!|A8`} N c]35@35b3cc0aXKAbc0aXKyO6c,A8(,05:`c#@K)O,A,c#K9Ox(`dc3cKO|@@3cK`b0x5068K}O,x ,8AXU#>;AbbKO,0x6@PKO;,c^H|H.0x680XKO:`H@b0x5068Kt360,cc^c0aX@T8U%>KϙA0aXKO,W:3|Acc0aXA8U%>K;,c^3@4~~,3A K)AA~~,KcCK A06\06dbf8`KSObc聁0!|A} N 0!}AN Cdodcl|!0@806h06tKwO,,0D;@0@H06xKO`}0!8`N bP8 @|;|+|*3 @c0Ha@KMOD`~,H,@`0606@P0D8 KS)O7,@006@ KeO`}c0!N KO,,W:Ap06BX@@(KO`0!}A8`N |.D,06@(KO`0!}A8`N ,06H@(KO`0!}A8`N ,cA,07KyO`}0!A8`N KUTc>(@D,@,074K9O`}0!A8`N 0"\@8KO8`HT:.KEAD`~|||80;A0|09 |.3|H.1)BD|8|8W:@<|00AtD3|8AD3|8KHH`@@A<|.8|}0KOD3|03A|.8|}0K|z.KAAD8`.|.0!}N `}0!N `0!|aN Arszarray|ؐ!P83(07P07hceKsO, ;A\bP;@ 0D(A; |+|*39 @0HcKO,cTw:X@(07lKO0!}8`N |.07,@(07KO0!}8`N KDT}>078`KNeOH07078`KNMOc07078`KN5OTce07078KrO, 0XALA~_(8`|+|*0c @~0\ccKO7cd08@(07KO0!}8`N KXT{>08 8`KMO\0808 8`KMmOcf08$08,8`KMUOKAO,(@AW:D@080KEO8`H4\,cc}XX.X`@,/H\,@0/@,@(;H H\,//H/@,8A8D,@ }.H@8A8X, | @ |\A$|X.|@(\08L08T8`H KO`~D08L08T8`KL!OH08X08`8`KL Oc08d08l8`KKOX08p08x8`KKO\08|088`KKOcf08088`KKO!DHAX|\W:A3838c#W_:AW=:KO`eccF8`KKQO|.|.|.39|KO|.3|.cdcF8`KKOH3Z|3A\c#@8`v0!}N 0!}aN 0!|N A  copyarray|!0@80808KnO,a<,;@0@h08KeOhP}0!`8`N P8 @|8`|"+|*0c @@KO,a<0<0HAa@KO508̀<@@KO8`hH,H,AaU :X@08KߝO8`HxK|P.T~>,(@8`A,c8@09KaO8`H,(@09D@K=O8`HH!L,@09KO8`Ht,Ё\@ H;W:@ }(.!L|HA<}.<|~@KMOL3|@3A}.<|~@K8`0!|a} N p|0!} N Cxclrarray|}&!P`}a0909 0|(||+0c |%*0 @t @T:|(.,0@|). D8K;O82ȃ/T,U,A /@ȃ H8`090:8TKD O0:0:8`cKCO0:0:(8`KCOcKOaD`~0:,0:@8`cKCO0:D0:X8`KCOc}0!N ,@$cK}O0!}N ,AL/AD,A<,A4/A,,A$,A/A,5A ,6@$aK O0!}N /EA,,A$,gA/A,QA ,@$aKO0!}N /k@8KyO,|@HK^O0!}N ,@耢 L8,A(0|:\KMO0!}8`N KO,|@H8`8K4O,@(0|:KO0!}8`N 0:0:0:8`LKO,eA KOc}0!N ,*@TKQO,aH@H P,A0|:8KQOc}0!N /@Ȁ T0|0:0:KoO,|@HKO,| @HhTA KOaLLT)HLLT) AKTO| TAh$/@<8|$3|8$@|$K8 T1A,0:0; ;8`K?O ;TA8`KIO ;T`,Al ,b (|~T.38AKOTk|{38A KO@|~TK8 TTrA88 ,A Ȁ,A``/TAP,A K1A,A KAc K A,A,K8 ̐ 8  |4T~`0!|a} N ,@D0|;0;(0(cKg-O,|@Hc}0!N ,A /@ aK0!}N ,@Ѐ,A\,A XT@<@ XT@(0|;,KӡO0!}8`N ,,A@4,A$}c0!N KaO0!}N ,\A .@,At,A \T@T,@ \T@40`;HKҵO0!|8`} N aȃK=O|0!} N /@0K3OЁ|0!} N ,9@x `b d0;t0;KjO,|,@00|;KO0!|8`} N @HXKO,| @H@|,'@cK%O4/|,AhAHA$|c0!} N 0!|8`} N ؀,A0|;KO|c0!} N K9O``0|4А| T~`0!|} N ,A/;A,hA ,@,aKҵO0!|} N /;A ,7@ h\,@0`;,0;0(8@`H``K^UO4 @h ,@40`;KO0!|8`} N 0!|e } N 8 0a(|;|"+|*3 @0(\\@((%A(&@\0\\8 (%A\(&@La\00$KO4 @(0!|e } N 0<0<80(Ka}O4@(0!|e} N e(KaO4ad@0<<d h,A(d,Ad0`<@KOb ld8 hK}O,@8d0aKwOЁ|0!} N d88,AhhHhh`0!|} N ,YA$/XA,zA,GA /S@,At,A pT@T,@ pT@40`0|(0|(8`(}AHD)t0at0=KA0atKm)Ox|0|T:||8K=O,;AГHa0!|a} N ,_A,DA /@0, A,@0=H0=a0>0(KUeO4@(0!|e} N Ȁ(. K O(@@Ā,A ,A耢(0e> KOHЀ,@,(0e>$KO0 K݀AH,A$,@<,A,0!|л8`e} N ,@X80e>((`K=O0 KEA0!|л8`e} N T(0>48`KA8KZ%O|0!} N ,@(K\O0!|} N ,A />@(80>@0>T0(KS9O4@(0!|e} N ,A$,@<,A,0!|л8`e} N 8`(0>X8K)O(KyO(`e0>d8`8K)iOK9O,A8( ,AāBP(* |08\+\0@`|0(n*N+b(BA((lA *LA+\LƓA A@$|I (1%* |(|I* 0(1)* |0,A+\0KhP ; 8;|9 00>p 8`K(9O |0(|"+3 @|T>0|<0|`0>|0>8`K'O~0(0KO,@,0!|л8`e} N P 0>|00(`8`8K'eOȀe(KVO|0!} N ,]A,A /Z@,aKGO0!|} N ,u@,A@x,A00|>KO0!|8`} N 0|>0>0(0 K/1O,|,@4@~ 0|>K}O0!|8`} N  ,A00|>KEO0!|8`} N P8 |(|8`|+|%*0c @0?(0|? 0?<0(KNO,|A}KO,|A}p|(;KO,@H`0!|a} N ,3@$K50!|} N /@$K0!|} N , @\KO,|A|KO3?@`dcKO8`|0!} N A@0|?D0?X08 K%-O4| ,@@{lȀ0|?\0?t0(KM-O,| A{؀|(PKO|(`d8 |8`|"+|*0c @KO,| A{8`KyO,@,Ё|0!a8`} N ,A0|?xKO|8K 9O/O, ,H@,A00|?|KaO0!|a8`} N K O,|AzKzqO 88a0!|a8`} N / @,A00|?KO0!|a8`} N KqO,|AzH8`8KO,@00|?KqO0!|a8`} N 0@0@ 0@$8`FKO,eA KyeO0!|a8`} N .@(K61O0!|a} N ,nA,A/VA ,@,At,A T@T,@ T@40`@(KMO0!|a8`} N aKZMO0!|a} N ,[@4cKOЁ|0!a} N /^@T  b 0@P0@dc9 KOO|`f0@l0@|8`K UO,@cK`O| `f0@0@8`K !OKiO 8,.,!/:AA@,#/&A(A@88 |HH8*H88H,,;AXAH0|@;KO|HuO0!|a} N 8*K8.KĐK,+@,b HO0!|a} N ,/@\b HOa,A0|@KO0|@KOa|0!a} N /i@KO,|Av|KyO4|A KIQO,8A88KOKO,A Ё`0!|a} N ,A,-A /J@0A 0A(0(KB]O4 @h ,@40`A,KO0!|a8`} N 0!|ae } N b (82KOK~IO4@(0!|ae} N  Ȑ(`KsMO0!|a} N ,IA,A/A ,@,aKO0!|a} N ,8@(K-qO0!|a} N /dA,.A ,@D 8He83ADK^O`d0c8 KO48~ @쀢 ,@eK:]O4a@40`AxKO0!|a8`} N 00aK}O0` KA0`K}AT` 6|0eT:KaA|||@<0Q|,A`|(8 T:|~(. ;,AK}-A T:).0,` T:@|~(.,K̀8,d@8 2A3xB3(3B"B : ccdbK>O(;`cc8`K)O,(A.({48@A80,A0,K耘(0,0|,@p|H A `0(}@A`,|0@<|0,A0,A,K쀘(~|"+3 @|T>0|0`K{A ,T:|z).(AӼ~8|+|*0 @At 0,` @ccdKt 0,` @X  ;T:|(.,AKzA T:).0,` T:@|(.,K̀0BP8`0BdK9O,@$a0!|} N ,Ap8 T:|(.0Bh ,8`AKO 0,` T:0Bh@$|(.8`,K̀0Bp0B0(K@O4 @(0!|ae } N ; (;Kv1O(`d|"+3 @|T>0|0`KyA4 @40`BK O0!|a8`} N 8 (|8`|"+|*0c @8,A,d@8 e 8;K%O}H88`(0B8K-O(K2Ot T:|0.,AЀ,@ KcO,Aht,@X,@0`BKO,d@0`BKO,8@0`BKO0!|؀e} N 0!|ae } N /@0|B0B0(K9uO,|,@4@l0|BKO0!|a8`} N KuO,|Al0!|a8`} N @ b 0C0C KC5O,|,@00|C$KiO0!|a8`} N AkKMO,|Ak0!|ae} N @LKtO,|Ak,Aj,Aj8`KmO,)@0CP0Cl0(KK~%O} `0!|N ,A;0Hc8`KO ,A\W:3H |c33  c.8`KeO@$c3,c.8`@؀a0 KO8`0H0H$8KOT>;K}O|0!8`} N ,`@,A$,@<,A,0!|лa8`e} N T~00H(K{A~0Hp0(K)=O4@(0!|ae} N ܀,A<0`HtK O8`|0!a} N ,@40`HKO0!|a8`} N Ѐe(KO|0!a} N , @ db h0H0HK-O4@(0!|ae} N eKi5O0!|a} N ,!@,,At,A lT@T,@ lT@40`HKuO0!|a8`} N 0H0I$0(K!O``,@0I((H8,@(0!|ae} N T8 }(|;|"+|*3 @(K^uO4@(0!|ae} N ܀,A40`I,KUO0!|a8`} N (,@ peKYOH<P t0IL(KxAKO0!|лa8`e} N ,"@ȃ0Ԁ0IT0Ip8K+-O4@(0!|ae} N K]O4 @(0!|ae } N ЀeKO|0!a} N ,1A,0@ 0Ix0I08 KIO4 @(0!|ae } N 0I0I0(K$1O4 @(0!|ae } N (KYO(`e,A(0eIKO,1@ KNOH H0I0I8`K}O,@ H x0T:|(T8|(.,Atx||0T:|0.,@h H x0T:|8T8|e0.0I8KA,A H x0T:|8T8|e0.0I8KyA,A| H x0T:|8T8|e0.0I8K=A,A@ H x0T:|8T8|e0.0I8KA,@x" x3yI3I3I3؃ HBxtcdT:|(T8|(.8`8KO8`UKJOKFOKFOcc8`KO,T:|(T8@|~(.,AԀ||0T:|0.0I,8@K%A,0IT:A@|(T8|~(.8KA,0IT:A|(T8|~(.8K̀A,0IT:A|(T8|~(.8KA,@cdT:|(KĀ H,A H |T:|(.,A H |T:|f(.KYՀA8` HKYA |T:4|f).A, H |T:|g(.0JKrAKDO H0J0J8`KO |T:|(.0J8`KO0J,0T:|(.8`KO|4T~`0!|} N ,N@KWeO4 @(0!|ae } N ,A40`J@KAO0!|a8`} N ܀,A40`JdKO0!|a8`} N 8`KO0!|a8`} N ,$@Ā ,5A40`JKO0!|a8`} N 0 (8 0J0(0 KeO0J%0J0(01 8KO4 @h ,@40`JKO0!|a8`} N 0!|ae } N ,A40`JKO0!|a8`} N P8 (|8`|"+|*0c @(0K 8`8KO(KO,A8(0eK,KO0!|a8`} N P8 |8|+0 @|0T>|`0KP0Kd0(KeO4|0 @(0!|ae } N (,Ab?0(|(cKUOP0Te KO0{Kh(`K2O;%;(;0Kl8`8KOc0Kx8`8KmO 00cK;uO 3,  @00cK؃8c88K-Oc8`0K8KOPЀeKw%O|0!a} N ,W@`88ܐ8`,8KpyO4 @(؀`ܐ8А800!|af } N ,@`8 8`,88KoO4 @,`$8А800!| ae } N ,y@40`KKyO0!|a8`} N ;,%@B0D_<00a 80K0K0K89 KRO_0hL8<0aD0K0K0L899 KRO܁_;`8<;0ah0L0L 0L899 KRMO0a KRO,zA;,@KOT`>(:(=A@;.AKOT`9A @KOT`9@Ȁ ,, / AAx@T0L,@$0a KX0`L`KO0!|A8`} N 0!|A8`} N a蓁KaK쀢L,AL8`,@FPL<0KPO(KNO4 @(0!|Ae } N ,A$,@<,A,0!|лA8`e} N L ,A40`LKqO0!|A8`} N 耢 x, A x8H,A x8,Ad(KKO(`e,@40`LKO0!|A8`} N 8 f( T>KO x~0!|A} N 0`L(:(=A@;.AK޽OT`9A` (T:|Ap||N HX!HP5 0uM8 A00M0 8 KO,u A  ,|A`HeH@$@KOT`9@`0uN0N 0(K O,u(8`A(a|+|%*0c @ HeH?0`MK~=O8`H?|3M,@~u A8K*O`dc0 8 KO,uu Aa,HeH?4! H@KOT`9@0uN40NL0(K O,u(8Apa|+0 @|0T>|,?0a8A(a|+|*0 @KF OaHd0`NPK}!O8`H>eH>t0`NK|O8`H>\0`MK|O8`H>D:@>0|@0P0P,4(KZIAKMO0!|лa8`e} N ,AA,aA,@ b 0P40PDK AO4@H,@0`PHKteO0!|ae} N 0P\0Pd0(KO4 @(0!|ae } N (K0|8 ||+3 |%*0 @0c8@8`KO88?|H A 0,BA00`0KEO,A\ Ȉ0RH0RX8`;KOHO|0!a} N 0R\0Rl8`KЭO8`|0!a} N ,@܀0Rp0R0(KaO4 @(0!|ae } N 8(;K)O(`d0RKf%O(0RKzO,8AĀāHĀā`0!|a} N ,@쀢,@0RKjiA4(Ab(8K1O8,@40`RKeQO0!|a8`} N T< }0;K1O0R<0ƀ0(0 K O4@,@Pe(KWO,@l(0SKdO|0!a} N ,A(0!|ae} N ,@T8H|T(<0K0O8<0KaO,A40`SKcO0!|a8`} N K.mO4$@(0!|ae$} N ܀,A<0`S,KcEO8`|0!a} N T,A,T ec;8KOH 8P,8(A(80SL`8K=O,A Te KGAH$Te 0SPKGyAT~(0SXKGYAKK O~(K-O~T>KGO~|0!a} N ,@|܀,A<0`S`KaO8`|0!a} N ,@0SKf-A4(Ab(8K-O8,@40`SKaO0!|a8`} N T <0cK-YO8<00S0(cKO4@(0!|ae} N b (cP8;K,O,(A(80S`8K O,A Te KEAH$Te 0SKDAT~(0SKDՀAKHO~(KO~T>KEqO~|0!a} N ,@K* O4@(0!|ae} N  0~SK^O0~S,A ЀH0TЀЃ K^O,A8 ,A( 0T K^O0T K^uO 0fT$,A ԀH0T8Ԁԃ K^-O,A, ,A 0`T@K]O0TTK]O0TK]O8`|~0!a} N ,@0`T0U$0(KiO4a@$a0!|a} N bP8 (|;|+|%*3 @8 (|8|+0 @|(`T>0({|@L؀(0|0(}@T؀(08|1(0(H(؀(8*|)(08|),@؀(|0(*@l!؀(0|0+*@P9@(4}GI`0@0(|H(*@ |0+*@}GI5&0KԀ,A ,@40`U(K[O0!|a8`} N e(K#MO4aATe0UT8 K@AK"O0!|a8`e} N (0eU\K[!O0!|a8`} N ,@(K)O0!|a} N ,@K%O4@(0!|ae} N Ѐ0`Ux,A0UH0UKZEO0!|a8`} N ,@hK$O4@(0!|ae} N 0!|лa8`e} N ,@hK$qO4@(0!|ae} N 0!|лa8`e} N ,@pK$O4@(0!|ae} N 0!| $лa8`ef} N 8`,@(K1O0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(KaO0!|a} N 8`,@(K-O0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(K]O0!|a} N 8`,@(K)O0!|a} N 8` ,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N 8`,@(KYO0!|a} N 8`,@(K%O0!|a} N 8`,@(KO0!|a} N 8`,@(KO0!|a} N ,@tKO48`@(0!|ae} N KO0!|лa8`e} N ,@b (Ȁ0U0UK)O4@(0!|ae} N ,,Ad@@ ,b 00U0UKO4@(0!|ae} N b 0U0UKaO4 @8 ,A(0!|ae } N K9O4$@(0!|ae$} N  4 T:|).0!|лa8`e} N 0!|a8`} N b 0U0UK]O4@(0!|ae} N ,b 00U0V KO4 @8 ,A(0!|ae } N KO4$@(0!|ae$} N  8T: 0!||9.лa8`e} N ,@ȃ0V0V008 KO4 @(0!|ae } N KO4$@(0!|ae$} N ЀeKyO|0!a} N ,@0V40Vl0(K}O4@(0!|ae} N T(0VtK5A0V|8`8KO,A40`VKPO0!|a8`} N TЀeK O|0!a} N ,@(KmO0!|a} N ,@(KƥO0!|a} N ,@K!O4@(0!|ae} N l ftx0VKOЀ||(T:~|8KlO|0!a} N ,@KaO4@(0!|ae} N l ftx0VKOЀ||(T:~|8Kl O|0!a} N ,@KO4@(0!|ae} N l ftx0VK OЀ||(T:~|8KkMO|0!a} N ,@x <b @0V0VKO4@(0!|ae} N ,/,AA@0V0V0$8 K%O4 @(0!|ae } N $0V0W 0$8 KO4 @(0!|ae } N $KO4 @(0!|ae } N ,A,@40`WKKO0!|a8`} N `,@$`䀥|(@`䀢\,@$\耥|(@\a䀁KȉO4 88A H쁁`0!|a} N ,@5X040WT0WdK%O4@(0!|ae} N (À T:|(||N K\0!|a} N Kdi0!|a} N K`u0!|a} N KmO0!|a} N eKj0!|a} N 0`WhKIUO0!|a8`} N Kh0!|a} N KO0!|a} N 8`,8@ 0<< D^0a0W0W0W8899 3KYO^9 80a<0W0W0Wđ!<8K)O0aKqO4}@(0!|ae} N L0|@@dL 00W0WKO4@80!|ae} N L KmO4 @(0!|ae } N ,/,AAA$0!|a8`} N  H L,0`WA0WܐH0WKFO8`|0!a} N  LK HKKYO4 @(0!|ae } N KAO4 88A H`0!|a} N KO4 @(0!|ae } N 8`0W80WP8KOKO4 88A H`0!|a} N Ѐ0eRKE9O8`|0!a} N  0 0Q0QKݡO4 @(0!|ae } N  ,@Ȁ8,ؐAXK&yO,88AH `0!|a} N 0!|лa8`e} N 0!|лa8`e} N  p00Q0QKyO4 @(0!|ae } N KaO4$@(0!|ae$} N ,AP;e ;KAO,AhhАH<hhАH(0eQ ;KBOЀ,A,,./AAA@Ȁ ,A( ,0A Hx ,A( ,A 0H885 ,@ 0lHT8|(T8|08 0`QK O,@KIO80!|ae} N  ,A( ,0A Hx ,A( ,A 0H885 ,@ 0lHT8|(T8|08 K쀢 ,A( ,0A Hx ,A( ,A 0H885 ,@ 0l|H||T8|(T8|08 K$ ,A( ,0A ttHx ,A( ,A 0pH885 ,@ 0llHllppttT8|(T8|08K\0`COcKaOc}0!N 0!|} N 0!}N 0!|} N 0!|a} N 0!|A} N C(docmd\|xx|x\ x\\ !!"0"0#D#|$$bccbcHbb@08L\l|ʌʌ$Dhh|A!KO , ?b 00ޛ؀;@@4"iH,, @`"\@ hIK%O7,0~܃ @33K0| ,@,K9O0!|!8`} N .:A;@!;H ^;,Ac^@;@!KmO,0}@,,D@, `"\@ dIK9UOAh3db`,3ALcK9)O{20c|@KdO,:AAd,@}0AK8O2@@W]:b c|}A,W:23c3`" H @2WD>,A|y.}?.,,0w;A<0@0$K8UO0w(K8EO|.0w4K85OH\0wH0׀T;A4H48`Ht0!|!8`} N 0׀hK7O0wlK7O|~|~0c|@KcO,:A|3Z3@@28`0!|} N !}0!aN C dohopts|!`,Ӏ b @=b Ā00Ƚ(KϥO7,@@pKO,;A\KO,( AHW: A`|d.|d|hN ;HH;H@;H8;H0;H(;H ;H;H;H;0-( Td: 8`A|d(,b |(|N T:A " |@.K3QOx0!p}8`N 0|\H遁x0!p}N 0||H]x0!p}N <0ePHx0!p}N 0~DHx0!p}N 0~;0Hux0!p}N 0|8H遁x0!p}N 0|H́x0!p}N 0|xHx0!p}N 0|0|(|(0|@AP9 ( @H%0|@( A$@(%0|@( K( LA4``0@A鈍%`( A0@K@(`0( @0( K0|0K!Ox0!p}л8`eN x0!p}AN x0!p}N Aldohlp|!`KqO, c<A0eTKO8`XL}0!PN AThmsg|ؐ!`~KO,@ xh}0!pN 8`HPKO,@4,@$, @`\ :?e0{\KO3;`;,A3^W:`; c#KO|~.0;8|+c3 @|T>0|(30@,|H @a1( B@a~ @(|.,AKGO,:AW:|.,@H0{dKO8`x0!p}N A hmsga|!7,@b LKAX0!P}N b L0K)A,400A(T8|(|(T>|00H ~U2.H,'AAcK̀A,4W~`AxeKĭA,40AHd4KĉA,W~S8T>A 40T~S8T>H42.H\|2.HH2.H8u2.H(b8`~ġH0|2.H404Ab8`~ġ0!|} N Csequenc|! ( $}@0, $;;@K O@D0,@KlODX0!P}N Apmyflsh|a̐! (;@8:`,@d $b3%2܂DH;; TL408`@|BK΍O`c0XW>0`8`K^O,,W~À(,@PALKcbK9O,:`,A8@p[,Hl8H\,T,L3|2s6A@0|1@,P8`AH,@ |( A0,D0H|,D0A |)D|+`e0c @|T>0|(,@T|dKOT|+c3 @|T>00L|+0c |*3 @xH`KA,|e4T~8A4KMKO6c,A48@:`,H 8,@TL4K聁0!}aN aLAh`0!N A dorseqb (88N @failrseq|A!B $Ke 08 |c^8|+`0 @|T>1)dH,,0|@ `;`3D (A,cf,cc8`0dA K#O,08`@TK݀Ac,8 8A܀0x,08`8AK#9OxH81AL| 8HL|T0z\P1!C BK1O,,AP00L8`A8K"O,A(0,08`A8K"OK၁x0!p}AN Arecvseq|}&ܑ! 0; b $;|+c3 @|,T>0&(A8 (Ec&,ce8`0AK!OccH (cc0KO,8`@tKMOK5O,D,0|A KڑO,,A0|8AKfOx!T0!p}aN cc0K O,cc0A0KO,cc0 .AKO,@dKO,D,0|A KO0|,8A KfAOtx!T0!p|a} N BDc~cW@~,cAK O~~,@c$ccKO,,,Ac#cdA KعO,,A0|0KeaO<8` ,@KaOKIO(,؈A/$@D,,8` A4@KOTc>H8`KOTc>KOHP(AD,/A@48` @KOTc>H8`KٱOTc>KO,,A8` AKفOKcOxt0!p|} N x!T0!p}aN xt!T0!p|a} N C dooseqb (8N @failoseq|! $ (38ԃ 4KE `|cc8K%O,8`,AK)OKȁX~}0!PN A|outseq|!! 0 (}4,A0,A 80$8`8KEOB0,@KOzb0ccc8Kl5O,;@@ $0(cecKQAcKYOh0!`}A8`N 9@,@(Ā,@ <,A9@,],At,@L}(@x}(HU&:|0.,,@ @F],,@ D,,AHt,A$cd0}@K5O8,H$cd0}`KO8,A$t/A8,A@,A8b $=4y(,A\; KOcd|"+`0 @}U>0|0|+0c |%*0 @y,@,A,,Ace08`8KO,,Ad@`KqcbK}O,/A@HvKO7,A@`;43HX,,,/ @A0|}9@A$,@AD0|y9D43A,Kx0!p}H,KOxAX}0!pN x0!p}N xAX}0!pN A flushi  0 @P`p |! ̀b Ѐ,0`0l|A88`8KMeO8`~8`X0!P}N H0!PN Atstreamon|!H  Ѐb ,00A8`KLOH008`KLOH0!@}N Adrdebug|}&!" 2A2122(2L2ap12KԝO`f3ab8`KL9O,; ,_A@; Ԁ ؁8|8} H} @U(4|@0(HA T:|8.|8|N K5O,8`@HlKO,8@ KP K8`,@H4 Ȁ,@xKO,8`@H KO9$11ԑ' 9@HG 1 d9 QT'K 8`gHKQO,8`@H98 KpK!O,8`8 @HT88`IKʵO,8A K KY8`,@H Ȁ,@xKO,8`@HKáO9$11ؑ' 9@HG 1 d9 QT'K| 8`gHlKO,8`8 @HP898`IKɭO,8A K KQ8`,@H Ȁ,@xKO,8`@HK™O9$11ܑ' 9@HG 1 d9 QT'Kt 8`gHdKO,8`8 @HH88;8`IKȡO,A K  KI8`,@H Ȁ,@xKO,8`@HKO9$11' 9@HG 1 d9 QT'Kl 8`gH\K O,8`8 @H@ 9 ;TzT918`IKljO,A K K18`,@H؀ Ȁ,@xKyO,8`@HKyO9$11' 9@HG 1 d9 QT'KT 8`gHDKO,8`8@H(9C8`IKƕO,8A K K98`,@H Ȁ,@xKO,8`@HKO9$11' 9@HG 1 d9 QT'K\ 8`gHLKO,8`8@H09K8`IKŝO,8A K KA8`,@H Ȁ,@xKO,8`@HKO9$11' 9@HG 1 d9 QT'Kd 8`gHTKO,8`8@H89G8`IKĥO,8A K  KI8`,@H Ȁ,@xKO,8`@HKO9$11' 9@HG 1 d9 QT'Kl 8`gH\ Ȁ,`A xT,@h@ xT@T D,/,A,LZA@," X80 0$8`KC%O0(048`KC OKeO,8`@HKeO9$118' 9@HG 1 d9 QT'0<0H8`KBOK$D9D,H@KO,8`@H ,A,  (D !H9 (' Ѓ 0gLKO,A( 9!D AH 'H8`gHd, @ 9, ,A,@0q\KUOKO,8`@HKO9$11l' 9@HG 1 d9 QT'K@,A T,@@ T@0qpKO K8`,@HH Ȁ,@xKO,8`@H KO9$11' 9@HG 1 d9 QT'KĀ 8`gH ,A ,@08`8K?OKO4qA|08`8K?OKUO,A<008`8K?Ob ;8KOH008`8K?MO"i9 K-O ,9 A` '8KmOKOKQOK=8K|̀g K%O8008`K>O9,AhKO,8`@H qKO`f.A8.808`K>5O8HP9( @<008`K=OqKO.H.@Ѐ Ѐg;KO K8`,@HH Ȁ,@xKO,8`@H KO9$11' 9@HG 1 d9 QT'KĀ 8`gH@8KKOKYO80 00;8`KA`.,A,A@0qKօOH008`KO,A,d,A008`8KO 0,A0,A 0 8`8K O0qKuO98`K=O9,AKO H0$08c8`KO@,A,d,A0<0D8`8KO, @0qTKEO1'@ c|0'1 HGB8||H}H,0T>A,, 1L+BA, @ aG|0K1(B8|Q|@}*@,0T>A@,, 0OE BA,,@1!o0} GIB8|A0h0x8`KqO,A|0a(0L88K5O|`f0|08`K1O8,AX 0,H X0gqXKIA,Hg,AȀ,Ah0(KƑO,@0c0LKyO,8@00H008`KuO,H\AP0(K)O,8@00H008`K%O,H , 0,A|A0,A 08`8KOx,A 0qKO9H0qKO9HA,,A00(8`8KIO0qK-O,ATX,@HKmO H<0qKOH(@0q(KO H0q8KO Kـ8`,Ab Ȁ,@tK%O,8`Ab`K)O9$11H' 9@HG 1 d9 QT'K 8`gHa,A0d,A 0L0T8`K=O,A \T,@@ \T@0q`KЩO K˱8`,Aa\ Ȁ,@tKO,8`Aa8KO9$11t' 9@HG 1 d9 QT'K܀ 8`gH`̀0gK%O,q,@0qxKO Kـ8`,A` Ȁ,@tK%O,8`A``K)O9$11' 9@HG 1 d9 QT'K 8`gH_@L,A T,@@ T@0qKO K8`,A_ Ȁ,@tK9O,8`A_tK=O9$11' 9@HG 1 d9 QT'K 8`gH_93.;KYO,0@`.@ K܀ x9@,W:|g@.;KIO,A KɐKO,@0q,8@8;KO Kȍ8`,A^8 Ȁ,@tKO,8`A^KO9$11' 9@HG 1 d9 QT'Kȸ 8`gH]KO,@0q,8@8;K)O Kǥ8`,A]P Ȁ,@tKO,8`A],KO9$11' 9@HG 1 d9 QT'KЀ 8`gH\,A,d,A008`8Kz O,A \T,@@ \T@0qKyO KƁ8`,A\, Ȁ,@tKO,8`A\KO9$11' 9@HG 1 d9 QT'KƬ 8`gH[KOKRO,A D;gK)OHKO8 Kő8`,A[< Ȁ,@tKO,8`A[KO9$11' 9@HG 1 d9 QT'Kż 8`gHZ,A0d,A 008`KwO,A |T,@@ |T,@0q K]O Ke8`,AZ Ȁ,@tKO,8`AYKO9$11 (' 9@HG 1 d9 QT'KĐ 8`gHYA \T,@@ \T@0t0gKyOt0gKQO,A0q ,KIO KQ8`,AX Ȁ,@xKO,8`AXKO9$11 <' 9@HG 1 d9 QT', H , @l;0gK5O,@ KD@0q @KiO H0q PKUO K]8`,AX Ȁ,@tKO,8`AWKO9$11 h' 9@HG 1 d9 QT'Kˆ 8`gHWx 8`gHWh,A0d,A 0 l0 t8`KtO,A xT,@@ xT,@0q KO K!8`,AV̀ Ȁ,@tKmO,8`AVKqO9$11 ' 9@HG 1 d9 QT'KL 8`gHV|00cT>KeO0g|0acKeO00acKeO0T>0|80acKeO,A \T,@@ \T@00aKuO00aKeO0aKAO,@0aK)O,A0q K!O K)8`,AJԀ Ȁ,@`KvuO,8`AJK{yO9$11 ' 9@HG 1 d9 QT', H , @D0a0KO,A0q KUO HKO KM8`,AI Ȁ,@tKuO,8`AIKzO9$11 ' 9@HG 1 d9 QT'Kx 8`gHIh 8`gHIX,A0d,A 0 0 8`KfOb,A XT,@@ XT@0q (K O K8`,AH Ȁ,@tKtaO,8`AHKyeO9$11 @' 9@HG 1 d9 QT'K@ 8`gHH00a;(01)U<>|00T>cKaO0|80acKaO,A \T,@@ \T@00aKO00aKO0aKO,@0aK}O,A0q DKuO K}8`,AG( Ȁ,@`KrO,8`AGKwO9$11 T' 9@HG 1 d9 QT', H , @0a0KqO,A0q XKO HKO K8`,AFL Ȁ,@tKqO,8`AF(KvO9$11 h' 9@HG 1 d9 QT'K̀ 8`gHE 8`gHE,A0d,A 0 l0 t8`KbO,A 0T,@@ 0T@0q KaO Ki8`,AE Ȁ,@tKpO,8`ADKuO9$11 ' 9@HG 1 d9 QT'K 8`gHD0gK O,AKO H0q KO K8`,AD4 Ȁ,@tKoO,8`ADKtO9$11 ' 9@HG 1 d9 QT'K 8`gHC,A0d,A 0 0 8`K`O,A T,@@ T,@0q KUO K]8`,AC Ȁ,@tKnO,8`ABKsO9$11 ' 9@HG 1 d9 QT'K 8`gHBxA \T,@@ \T@00gKqO0gKIO,A0q KAO KI8`,AA Ȁ,@lKmO,8`AAKrO9$11 ' 9@HG 1 d9 QT', H , @d x'80iKO,8A K00q KYO Ka8`,AA Ȁ,@tKlO,8`A@KqO9$11 ' 9@HG 1 d9 QT'K 8`gH@| 8`gH@l,A0d,A 0 0 8`K]O,A T,@@ T,@0q ,KO K%8`,A?Ѐ Ȁ,@|KkqO,8`A?KpuO9$11 D' 9@HG 1 d9 QT', 8`H 8`gH?8A \T,@@ \T@0q HK5O K=8`,A> Ȁ,@hKjO,8`A>KoO9$11 d' 9@HG 1 d9 QT', 8`H, 8`@Pa00`f8KݵOq,,@ 0 hA`DK5OKO8 K!8`,A=̀ Ȁ,@tKimO,8`A=KnqO9$11 l' 9@HG 1 d9 QT'KL 8`gH=<,@ 0 p`KQO KY8`,A= Ȁ,@tKhO,8`A1|@03(\(K@,`1(\@da8H\@8 `||8|+0 @|T>1|81@0|8()@$8\9f0cH`g9\9v09(0>9)|H!9|H0H`g9 \'(S9 v0'9 (0'A9 )|P'!(G|H09 '@9$0H@9m0800KQO,@̀,@ 0q H0q KO Kŀ8`,A/p Ȁ,@tK[O,8`A/LK`O9$11 ' 9@HG 1 d9 QT'K 8`gH.cK%O,AȀDЀg;KqO K8`,A. Ȁ,@tKZ9O,8`A.tK_=O9$11' 9@HG 1 d9 QT'K 8`gH.cKO,8A K0qKO K8`,A-Ā Ȁ,@tKYeO,8`A-K^iO9$11(' 9@HG 1 d9 QT'KD 8`gH-4@,A pT,@@ pT@0q,K!O K)8`,A,Ԁ Ȁ,@tKXuO,8`A,K]yO9$11D' 9@HG 1 d9 QT'KT 8`gH,D09 0T>0}8(|@0h0K#MO,@0qHK-O HKuO K%8`,A+Ѐ Ȁ,@tKWqO,8`A+K\uO9$11`' 9@HG 1 d9 QT'KP 8`gH+@0qdKiO Kq8`,A+ Ȁ,@tKVO,8`A*K[O9$11' 9@HG 1 d9 QT'K 8`gH* ,A,A$T@@$T@0qKqO Ky8`,A*$ Ȁ,@tKUO,8`A*KZO9$11' 9@HG 1 d9 QT'K 8`gH),A4d,A$ Ѐ 008`8KFO9ȁ'b}(Cx Ѓ 9KO8`KO KX9OА~KXO?}H(Ѐ,A4d,A$ Ѐ 008`8KFO9ȁ'b}(Cx Ѓ 9KO8`KO KWuOА~KX1O?}H( 0qK5O K=8`,A' Ȁ,@tKSO,8`A'KXO9$11' 9@HG 1 d9 QT'Kh 8`gH'X L,A\K?MO,8`@HKTO L9K 5O8`KO8` 0! H&Ё9 'hH&؃` 9 ,'A " <hd'8 @ D0,8AL H L,A 8`Kw-Oq,H0h PKOqHb PK1Oq,Ax,@,@ T8H X8K)O,@0qKO K 8`,A% Ȁ,@tKQUO,8`A%KVYO9$11' 9@HG 1 d9 QT'K4 8`gH%$,,OB3AL,A$0 8`KZO L,H,KO,@0qK^O L,A0t8`,AKR9O8KO8` \K!O,@ `,@9 K8`,A$8 Ȁ,@tKOO,8`A$KTO9$11' 9@HG 1 d9 QT'K 8`gH# KOKـ8`,A# Ȁ,@tKO%O,8`A#`KT)O9$11' 9@HG 1 d9 QT'K 8`gH"̃0 d008`K)O9,\@ 9b hK[O,@ D gKOKŀ8`,A"p Ȁ,@tKNO,8`A"LKSO9$114' 9@HG 1 d9 QT'K 8`gH!080L8` KO,@ l9 b a,AH,A \T@(@ \T@0KkOaԃ pKYO,AKOb P tHDgKOb P tK1OKKqO,@0qPKOK!8`,A ̀ Ȁ,@tKLmO,8`A KQqO9$11d' 9@HQTG" Q d G8KL 8`gH < d9 91\KOb P tK=OKK}O,@0qhK!O K)8`,AԀ Ȁ,@KKuO,8`AKPyO9$1| 9T 1 dB'`9,HB`9,A  <h"d88K 8`gH PgcKO,@~KOK̀~KO`}~KiO,A<Ā,@, 8`,Ac88KeO 0,AX,@H x xh hc8K]OK |,A(0qKO\90\K d D1,Ap @,AL H L,A 8`K}Oq,H8h PKQOqHb PKmOqH b P,APKOq,AKO8qHKO8qHL1'(M(P@@ 8" 00a`KOuA08`KOqHT@8 0a&0a KO=A0 8`KaOqH h`d`K5Oq,A` x`,A0p,@  gKO,H4,gA T8H 8KO,@0qKO K ,A ȁ,@KGYO,8`AKL]O91'$1 ' 1T d9 'Ԁ,AKO8KKO8K'8`H8`H~ KOK%,A ȁ,@pKFuO,8`AKKyO91ē'$1 ' 1T d9 'KX'8`HL8`HDKO Kg]O,A0 cKiO`f>c08`KQO K5,A ȁ,@pKEO,8`AKJO91'$1 ' 1T d9 'Kh'8`H\8`HT ,@ |,ATԀ,A4\,0\@0qKOKK~OK0qKOK ,ATԀ,A4\,0\@0qKaOKK~QOK0qKEOK x`',A0p,@  gK-O,H4, gA T8H 8K5O,@9,/A@,A90qKO K ,A ȁ,@pKC]O,8`AKHaO91 '$1 ' 1T d9 'K@'8`H48`H,Ԁ,AK|OKK|OK | D1,P|8`A qH d,Ap @,AL H L,A 8`KuOq,Hph PKIOqHTb PKeOqH@ P,A`KOq,Hb hKOq,Ab h PK^qO,@ KOK),A ȁ,@pKAyO,8`AKF}O91$'$1 ' 1T d9 'K\'8`HP8`HHKzO8K4P| 8`;KO8`KOq?8`Hb h PK]QO/q,,.AALƓA,@0qpKO K~,A ȁ,@pK@5O,8`ApKE9O91'$1 ' 1T d9 'K'8`H 8`H`,A0qKMOKymO8K~Ԁ,A<Ā,@, ,A0T8` 88KO K}ɀ,A ȁ,@pK?O,8`ATKDO91l'$1 ' 1T d9 'K}'8`H8`H0q@KO K},A ȁ,@pK>iO,8`AKCmO91P'$1 ' 1T d9 'K}L'8`H@8`H80q(KaO K|i,A ȁ,@pK=O,8`AKBO91<'$1 ' 1T d9 'K|'8`H8`H g Ky1O8,Aa  =,@Ѐ ,A ,@0qKIO K{Q,A ȁ,@lKAO$(1 ' 1 d9 1T'Kx$'8`H 8`H Kx tgKuO,@0q K|O Kw!,AX ȁ,@8`HX8`HP8`KO" P|i3<,;`A`|,@,8cKO,@3@ ȃЀ0P0l?8`KOЀ `}gK1O8`B K9O?:cK5OKOKO,@@Ā,A0B ,@$0qpKsO ȁ\HB ȁ\, =}KxA0 cKPO`f<c08`K!OKl ,A,@hK-]O,8`AK2aO1g$1 ' = d9 1T'KlH>8`H<8`H4ЃЀ 9>KO8`KOK0=O} K0O=~Hԓ'8`H8`H0qKoO8`ȃKO;|Cx Kjɀ,A ȁ,@K,O,8`ATK1O1$1 ' = d9 1T'Kk 0! |} N "C\wart|}&!pbxb |c,:::Ab b x" x  Āq no ȂB xrB ̂ dzwb Ѓ" {y{b| Ѐc{Pb Ԁ ؀b ,b @8},@bc,@(A(btc,Ab8c,@8,A b c,Abc,@bc,@Ȋ.@(8`,A8KO8`~ -@(8`,A8KO8`~A@0{KOHȃ(x(vA@pbc,@,~ O,A W8`,A8K}O~ N,A~ T,@8`KiOb c,H~ N,A T8`,A K5O~ O,A W8`,@8KO,@(sA|},A0{KJQO00 8`8 0KO,ATbc,AD0$0@8`8K{OH(Ȁb c,@ KYOH9Ј~ N,b A T8`,A K)O{,Ab c,Abc,@b,c,@@4~,8`A 8KQO8`~ .H :.@4~8,8`A8KO8`~ H.A ,@0{DKObԀ ,b @\ 0b,c|xdA4bc,A$ 0\8`8Kz)OH 0h8`KO{P,A|d8`{P{,yA8`zx|ob ܐ0!} N Cproto|a̐!p Ђb"| ȉSBЁ):"A86P90x08`K-O9, A,KO,@" L9@),AZ}0!aN 3(g@l" ), )(LAT+ F( XLӂA@ 9 }:0!aN 0vKFO0!}aN 9, Ap"0),@`"t), @P"ā),@ " ), A 08` 88KO0!}aN bB09 01)|H~|+0c |%*0 @" ), A; 6,AL<, A"(), ,H"$), ,/ L3OFBA c; ~8`|+`i0c @}A,UK>1I|X}A A(,|H|}! A i|0}! |cKIO=8`, @0K!5O=, H"), H =, As0h,s/ vAA@,HlB xU# 6J|i, BTc:}CPA 4H<8H4B xU# 6J|i, BTc:}CPA @0;A(0T>0_T>3c8`KOc-Fb-M~8`8KO,@.OA 08`8AcA@tK?AA`{cf0d0t8`K9OW`W~zW`A ԑ,A: ,AЀ ,@7H0nKZO008`8KO8`HK>A`~c0x08`KO,,.@P@@@8H4cbeKaOH 008`8:KAO70AcbK ,@2n,A8 T|;|+c3 @}AUJ>08,({@T("0@|8(}A@4|8("@(~92s0bec8`KOH; 0 be8`KeO,A,A `T@@d `TAT0(!@D ܐ 8 08`8KOH ܀,,@@ bc K]O,Hh0B  ,88A 8 ,A `bcKFO |ЁB j,@$0,0D8`8K!O8`H؀T0H0h8`KOT,@$0nlKWO8`0!H̃~KO008`8KO,A 8KO,8`@8Ԁ,@$B  j|K?EO8`0!|} N CsgetinitS,TT@UDVLWTXlYdZ\[T\]L`4bPceeegjllXo4prtvz~X H\pXdX DLT$Xļtȴɘl\Ь|(ؐ؜بش<4`|Tc>N @identT`>(A8?T>N @xleft128T`>(A8?T>N @xleft160|($Tc>T 6| .0( A T:| .| |N (@4b 8j08`i0H@ |dH4,,/AhA$,/A8AdA |dH,,AAA |dHb 8e08`A0Hb 8e08`O0Hb 8e08`U0HPb 8e08`a0H b 8e08`o0Hb 8e08`u0H 8`s0e0H0*(T:,| A4| |N ,/AA(,/LLBӂALA( |dH8,AA |dH b 8e08`A0Hb 8e08`O0Hb 8e08`U0Hb 8e08`a0H`b 8e08`o0H0b 8e08`u0Hb 8a08`A0HЀ 8`a0e0H |dH/,,AA,/,/A|dN @xl1ge Tc>|dN @xgel1}&Tc>/{,[-| A,\/].}A8 A\ Ap AH@,~ AȀ A AH 0fe8e8`A0H0fe8e8`O0H0fe8e8`U0Hd0cd8e8`a0} N e8e0ce8`o0HD0fe8e8`u0H 08`se0} N Bxgeas}&Te>/{,@-|8`"A,[/\.]A08`?Axb A@8`?A`8`|AXHP,},~8`?AD8`?A<8`'A4`H,08`je8`i0H`} N } N Bxduas}&T`>/`,[-{8`eA,\/].^AHb A|b Ab Ab AHp,|,}/~AȀb Ab Ab A H,08`ee8`A0H 08`ee8`O0H08`ae8`A0H08`ee8`U0Hb 8e08`a0Hp08`ee8`o0HL08`ae0H,08`ee8`U0H`} N } N Bxfias}&T`>/{,@-|8`eAh,[/\.]A(8`aAD8`?A<8`cA48`?A,H$,},~8`uA8`eA8`"A`} N } N Bxfras}&T`>.`/\,{8`oA,@/]-|AL8`cAp,[.^A8`aA\8`aAT`HL8`eAD8`iA<`H4,}/~8`eA 8`uA8`eA8`uA`} N } N Bxfcas}&T`>/{,[-|8`aAh,\/].`A(8`?AD8`cA<8`eA48`uA,H$,},~8`oA8`eA8`iA`} N } N Bxitas|!H(Tc>$T 6| .(,+@t @,0`d8E8`O00!@N `@,0`e8e8`o00!@N H Tc>|dH0!@}N Axneas}&Tc>.{/[,| A,\/]-}A, A8AX APHA AH0fe8E8`A0H8`OH0fe8a8`A0H\d0cd8e8`a0} N 8`oH 08`ae0} N B(xnoas}&T`>.{/[,|8`aAP,\/]-}A 8`AA,8`CA$8`OAH8`cA8`oA`} N } N Bxxpoas}&T`>.{/[,|8`?AP,\/]-}A 8`!A,8`NA$8`?AH8`nA8`cA`} N } N Bxxspas}&T`>.`/\,{8`eA,@/]-|A`b A,[.^A 8`EAb ApHb Ab AHl,}/~ AȀb Ab Ab AH(08`ee8`A0H08`ee8`O0H08`ae8`A0H08`ee8`U0Hd8e0cd8`a0Hp08`ee8`o0HL08`ae0H,08`ee8`u0H`} N } N Bxswas|}&Tc>0(-|T: A|` cx|`|hN /#,} A4,@/{.~A(ADAP A} N A$AL} N 8`u} N 8`a} N |8`e} N |8`c} N |8`e} N |8`i} N |8`e} N |8`o} N 0`d8e8`a0} N d0cd8e8`o0} N 0`e8e8`u0} N 8`u} N Cxchas}&T`>/`,@-{8`aA,[/\.]A(8`AA\8`EAT8`OAL8`UADH<,|,}/~A$8`oA(8`uA 8`"A`H8`eH`} N } N Bxhuas(Tc>$T 6| .(,+@l @(0`d8E8`O0N @(0`e8e8`o0N |dN @xdmas|Td>0Q0d"(0(+A T:|ec|e|hN L,/A,b($ADÀb($cAxH8`fH8`H8``H8`^H8`OT 6| . ,0@8`Ee8`O0N Tc 6|e. ,8`o@L0`e8e8`o0N 8`?Hb |c |e}N N AXxdgas}&Td>./,8`sA\,/-A 8`LA88`fA08`SA(H8`-A8`*Ab | |e } N } N Bxr8asT`>(#8`M `N @xukl1Te>( 8`#M |d(N @xl1uk Tc>|dN @xl1fr Tc>|dN @xfrl1 Tc>|dN @xl1du Tc>|dN @xdul1 Tc>|dN @xfil1 Tc>|dN @xl1fi Tc>|dN @xfcl1 Tc>|dN @xl1fc Tc>|dN @xitl1 Tc>|dN @xl1it(Tc>$T 6| .(,+@l @(0`d8E8`O0N @(0`e8e8`o0N |dN @xnel1Td>/,,/A(8`M 8`M 8`M |e N 8`N @Dxnel9 Tc>|dN @xl1neTd>/,,/A(8`M 8`M 8`M |e N 8`N @Dxl9ne Tc>|dN @xnol1 Tc>|dN @xl1no Tc>|dN @xpol1 Tc>|dN @xl1po Tc>|dN @xspl1 Tc>|dN @xl1sp Tc>|dN @xswl1 Tc>|dN @xl1sw Tc>|dN @xchl1 Tc>|dN @xl1ch Tc>|dN @xhul1Tc>|dN @xl1huTc>|dN @xl1dmTd>/,,/A(8`M 8`M 8`M |e N 8`N @Dxl9dmTc>|dN @xl1dg(Tc>$T 6| .(,+@l @(0`d8E8`O0N @(0`e8e8`o0N  |dN @xdml1Td>/,,/A(8`M 8`M  8`M |e N 8`N @Dxdml9(Tc>$T 6| .(,+@l @(0`d8E8`O0N @(0`e8e8`o0N |dN @xdgl1 Tc>|dN @xr8l1Tc>|dN @xl1r8|}&!($Td>T 6|e. 0c( Tc:|`A\c|`|hN ( 8`j@ KEOH8`i}0!@N H|e }0!@N /,-A,/.A 8`eA8ADAPb |c H,8`eAHATA`b |c HKO8`AHKO8`OHKO8`UHKO8`aHKyO8`oHxKiO8`uHh8`sKUOHD|8`s} 0!@N ,/.8`eA,/-A@At,.AAT8`aAb |c HALAXb |c H,,8`aALN8`eAdApb HKO8`AHKO8`OHKO8`UHKyOHD|8`a} 0!@N KUO8`oHTKEO8`uHDK5O8`AH4K%O8`aH$|c HHb }|c 0!@N HD|} 0!@N Czl1asTc>|dN @x43l1Tc>|dN @x85l1Tc>|dN @xl143 Tc>|dN @xl185Tc>|dK @x43asTc>|dK< @x85as(Tc>$T 6| .(,+@l @(0`d8E8`O0N @(0`e8e8`o0N $|dN @xaql1(Tc>$T 6| .(,+@l @(0`d8E8`O0N `@(0`e8e8`o0N $|dKN @xaqas(Tc>|dN @xl1aq,Tc>|dN @xl2l10Tc>|dN @xl1l24Tc>|dN @xl2as8Tc>|dN @xl252|dN @xl2mz0Tc>|b<|c N @xl1mz@Tc>|b,|c N @xmzl1@Tc>|dH%@ @xmzl9DTc>|dN @x52l2@Tc>|dN @xmzl2HTc>|dN @xl21250LTc>|dN @x1250l2DTc>|b4|c N @x52asLTc>|b4|c N @x1250asDTc>|b,|c N @x52l1LTc>|b,|c N @x1250l1Te>(L8`M |d(H#xN @ x1250l90Tc>|b8|c N @xl1520Tc>|bH|c N @xl11250|!T`>(H8`A$`H% |XL}0!PN L0!PN APxl91250|!Tc>H$X<}|L0!PN A4xl9mz|!HTc>HK}40!@|eN A,xmzas}&Td>/,-8`A,/.A(8`Ah8`A`8`AX8`APH<,,/A$8`A48`A,8`A$b,H8`Hb, | |e } N } N Bxl2neTc>|b0|c N @xl243Tc>|b0|c N @xl285,Tc>|b(|c N @xl2aq0Tc>|b |c N @xl2dg|!T>cK%A,cA K5AXL}Tc>0!PN ALxl2sk}&Td>/,-8`A,/.A(8`Ah8`A`8`AX8`APH<,,/A$8`A48`A,8`A$b H8`Hb ̀0| |e } N } N Bxnel2Tc>|b0|c N @x43l2Tc>|b0|c N @x85l2Td>,,/8`M 8`M $08`M | |f N @<xaql2 Tc>|b0|c N @xdgl2|!T>cKA,cA K AXL}Tc>0!PN ALxskl2}&Td>/,-8`~Al,/.A(8`@AH8`[A@8`\A88`]A0H$,,8`{A8`|A8`}A b4|c } N } N Bxl2ge}&T`>/{,@-|8`Ah,[/\.]A(8`AD8`A<8`A48`A,H$,},~8`A8`A8`A`} N } N Bxgel2}&Td>./,8`]A,/-AL8`@At,.A8`$A`8`~AXb4HL8`[AH8`\A@b4|c H4,/8``A$8`{A8`|A8`}A b4|c } N } N Bxl2hu}&T`>.`/[,{8`A,$/\-|AL8`Ap,@.]A8`A\8`AT`HL8`AD8`A<`H4,}/~8`A 8`A8`A8`A`} N } N Bxhul2Td>,,8`M 08`M | |f N @0xr8l2Td>,,8`M 0 8`M | |f N @0xl2r8T`>pw(_0`A`Tc>N @ xasskPTc>|dN @xlcacTTc>|dN @xlc55XTc>|dN @xlc1251\Tc>|dN @xlcbu`Tc>|dN @xlck8dTc>|dN @xlcsk(Tc>$T 6| .(,d8?@ |dN A``T>N @DxlcashTc>|dN @xaclclTc>|dN @x55lcpTc>|dN @xbulctTc>|dN @x1251lcxTc>|dN @xk8lc|Tc~|dN @xskcy(T`>$T 6|(.(,Td~b|8?@ |c N A`T>N @Hxascy(Tc>$T 6| .(,hd8?@|d|eN A``T>N @Lxacas(Tc>$T 6| .(,ld8?@|d|eN A``T>N @Lx55as(Tc>$T 6| .(,td8?@|d|eN A``T>N @Lx1251asT`>(_8`?A`Tc>N @xskas(Tc>$T 6| .(,xd8?@|d|eN A``T>N @Lxk8as|!HTc>KTc>HK}Tc>0!@N A0xl1sk($Tc~T 6| .|,L |dN @,xaslc|!H(T`>$T 6| .Tc~,P@$`KTc>|eH0!@}N 0!@N A\xasac|!H(T`>$T 6| .Tc~,T@$`KQTc>|eH0!@}N 0!@N A\xas55|!H(T`>$T 6| .Tc~,X@$`KTc>|eH0!@}N 0!@N A\xas1251|!H(T`>$T 6| .Tc~,`@$`K]Tc>|eH0!@}N 0!@N A\xask8T`>(`8`?M 0`({Tc>@M `N @,xash7|!HTc>K)HK}0!@N A(xl1h7|!HTc>/,,/A0A8A@(AD@LKĽTc>H0!@}N 8`a0!@N 8`o0!@N 8`0!@N 8`0!@N Tc>H0!@}N Axl1lh|!HTc>KHK}0!@N A(xl2h7|!HTc>KMHKi}0!@N A(xlch7T`>(8`?A`Tc>N @xlhasT`>,,8`M (8?8`M @ T>N `T>N @<xlhl1Tc>|dN @xlh62|!HTc>KHK}0!@N A(xl162Tc>|dN @xlhh7T`>(_({8`?LA!@`Tc>N @$xh7asTc>|dN @x62lh|!HTc>KŁHKQ}0!@N A(x62as|!HTc>KHKE}0!@N A(x62l1Tc>|dN @xh7lhT`>(`0`({Tc>@M `N @$xaseg|!HTc>K!HK}0!@N A(xl1egTc>+M ((+M M M M 8`?N @0xl2lg}&Tc>(0Z*0UAp0P+(/,OL+BAP.A<,/ALB3A48`?} N A @} N 8`H8`?} N Bxl1lg|!HTc>K湁HKe}0!@N A(xl2eg|!HTc>KHK!}0!@N A(xlcegT`>(8`?A`Tc>N @xlgasT`>(8`M `KxN @xlgl1Tc>|dN @xlg69|!HTc>KHK}0!@N A(xl169Tc>|dN @xlgegT`>(`({8`?LA!@`Tc>N @$xegasTc>|dN @x69lg|!HTc>KŁHKq}0!@N A(x69as|!HTc>KKiH0!@}N A(x69l1Tc>|dN @xeglg Ԁ,,/8@LA 88(8JA d8`N d8`N d 8`N d8`N @xjpnxas 8Te~,,8@T,,A$88(8`J@$d8T:8|1.0T:|1.0`N `e@ 8T:|1.0`N @jpnxkt T~fT~,,T9@T,0g}00@`e,|p0e0A`e,08`@`N `@l,,A8@<9U:80h|).0Tf:8`$|d1.T:8`B|d).1U:|).0T:|).0hN d`8`N @jpnxkn8`ddN @xkanjf|! `g,8`A`;@TK97c33@<}Tc>K݀A,8`A$|c3@}Tc>K8`X0!P}N Axkanjz|!!`cTd0,;`T:; ;@@d,Tg~/ @0Ka`zH,,@A 0@T:| d0HXK%`zHL|8d,00@| ; K`zH0|K!`z; ,;3@H3T>KuA,8`A,|c3@T>Kԓ<|8`h0!`}!N ATxkanji8`d,d(d$N @zkanjf8`N @zkanjz|ܐ! ԃ(/,`x,0@d,c T:A((0|0,`xd80!N KIA,;,//,(A@,,O\˂Aa/,,/A(8`M 8`M ,8`M |e N 8`N @Dxl2l9Tc>N @xl258}&Tc>(/,-AA`,/.AA4A8A<} H`,A@ADAH} K8`?H@8`SH88`sH08`Z} N 8`OH8`oH8`YHKҴ} N } N Bzl9as}&Tc>(/,-AAp,/.A A(/,-AAp,/.A A((8`M  8`M |e N @(xl958T`>(8`?M `KN @x58asT`>((8`M `@ 8`N KN @,x58l1T`>((8`M `@ 8`N K N @,x58l2T`>((8`M `@ 8`N K҈N @,x58l9,,3/4Te:A(Lӂ8`A|(.,T@ 8`N ,,^M L 8`N @\ cs_is_nrcTc:|.8`,,M 8`M dTcN @4 cs_is_stdTc:|.8`,M `N @$cs_size|}&ȃ!``}- b.:cf000@8`KJ!Oc0D0T8`KJ O,A ,.@8c0X0l8`KIO0!|a} N A@8cf0p08`KIO0!|a} N cW:Bă@ 008`KIaOHp}J..  00@8`KI5ObHDORs.-AA}[/}[P@t008`KHOcfW{:00048`8KHO}\."ȑX}}.}.}_.:vUHbN @ident_uTc~|@|(|(@|M ||L d N @8 iso_8859_1_uTc~|@|(|(@|M ||L d N @8 iso_8859_2_u Tc~|@|(|(@|M ||L d N @8 iso_8859_3_u$Tc~|@|(|(@|M ||L d N @8 iso_8859_4_u(Tc~|@|(|(@|M ||L d N @8 iso_8859_5_u,Tc~|@|(|(@|M ||L d N @8koi8_u0Tc~|@|(|(@|M ||L d N @8 iso_8859_6_u4Tc~|@|(|(@|M ||L d N @8 iso_8859_7_u8Tc~|@|(|(@|M ||L d N @8 iso_8859_8_u8`L `N @tx_identT`/T`0Td~A 8`N ,8`L `N @, tx_usasciiT`/T`>(T`0A 8`N ,T`~@ 8`+N 8`L `N @@ tx_british|T`/T`>0 (A 8`N T`0T:Ad| .| |N 8`@H`8`[HX8`\HP8`}HH8`{H@8`]H88`^H08``H(8`|H 8`nH,T`~8`@`}N Atx_fr_canadian}&T`/T`>-A8`} N /,Ad,/.AA`A,A0T`1T`~HTA(A,T`1T`~8`H@8`[H@8`\H88`{H08`|H(8`}} N 8`~H8`@`} N B tx_danish}&T`-T`>/A 8`N ,|-A,/.A$ALAPATAXT`1T`~8`H,,/AXALAXA\T`1T`~8`HT8`]HT8`#HL8`{HD8`~H<8`}} N 8`@H$8`\H8`[H8`|H @`} N Btx_dutch}&T`/T`>/A 8`N ,-A,/.A$ALAXALAXT`1T`~8`H,,/A`A.A8`} N /,A,/-A@At,.AATAXT`1T`~HAXA\T`1T`~8`H,/AXA\A`AdT`1T`~8`H`8`#H`8`]HX8`~HP8`[HH8``H@8`@} N 8`\H(8`}H 8`{H8`|H8`@`} N B tx_french}&T`/T`>/A 8`N ,-Ax,/.A$ADAHALAPT`1T`~8`Hp,,ALAPATT`1T`~8`HL8`@HL8`[HD8`\H<8`]H48`~} N 8`{H8`|H8`}H @`} N B tx_germanT`>(`({Td~+@ `N (Tc~+LBL 0L@B8`M T>N @L tx_hebrew7|!T>(c+(+A,KA,cAKŀAT>W~H0(L\ ALTc>0!PN +0(L+ALTc>0!PN +0(L\ ALTc>0!PN 0z0(PL+ALT>0!PN Td:8`A| p| |N 8`rH8`aH8`aH8`eH8`eH8`gH8`gH8`iH8`iH8`iH8`oH8`oHx8`tHp8`tHh8`tH`8`tHX8`tHP8`xHH8`xH@8`iH88`iH08`tH(8`tH 8`bH8`hH8`uH8`pXL}0!PN L0!PN A tx_elot927}&T`>(Td/@ 8`~N /,A 8`N -Ax,/.A$ADAHALAPT`1T`~8`Hp,,ALAPATT`1T`~8`HL8`@HL8`[HD8`\H<8`]H48`{} N 8`|H8``H8`}H @`} N B tx_hungarian}&T`/T`>/A 8`N ,-A,/.A$ATAHATA8T`1T`~8`Hp,,ADAXA4T`1T`~8`HL8`@HL8`[HD8`]H<8`^H48``H,8`{H$8`}} N 8`~H @`} N B tx_icelandic|Td/Td>0 (A 8`N /T:A|| |N ,,/A A$A(AAATc>AN 8`\N 8`~N 8`~N @H tx_jis0201r<Td>0`a|@0|@8`M <0@M `N @4 tx_jis0201k|Td>(P(Tc~0A4(8`A(T:8`A| | |N 8`aH8`bH8`wH8`gH8`dH8`eH8`vH8`zH8`iH8`jH8`kH8`lH8`mH8`nH8`oH8`pHx8`rHp8`sHh8`tH`8`uHX8`fHP8`hHH8`cH@8`~H88`{H08`}H(8`yH 8`xH8`|H8``H8`q}N N ATtx_koi7}&T`/T`>/A 8`N ,-Ah,/.A$AdAADA8T`1T`~8`Hp,,ATA@ADT`1T`~8`HL8`HL8`HD8`} N 8`H,8`H$8`H8`H8`H @`} N B tx_portuguese}&T`/T`>/A 8`N ,-Ax,/.A$ATA@ADAhT`1T`~8`Hp,,A4AXALT`1T`~8`HL8`#HL8`@HD8`[H<8`\H48`]} N 8`{H8`|H8`}H @`} N B tx_spanish}&T`/T`>.A8`} N /,A,/-A@Ad,.AA\AhT`1T`~HAPA\T`1T`~8`H,/AhADAXAdT`1T`~8`H`8`@H`8`[HX8`\HP8`]HH8`^H@8``H88`{} N 8`|H 8`}H8`~H8`@`} N B tx_swedish|T`/T`>0 (A 8`N T`0T:Ax| | |N 8`#Hp8`@Hh8`[H`8`\HX8`]HP8`^HH8`_H@8``H88`{H08`|H(8`}H 8`~H,T`~8`@`}N Atx_swiss|T`>(0`Tc>(A|,A T:| | |N ,/8`AHA ,A A8`}N ,AA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`N 8`N 8`N 8`N 8`}N N A tx_8859_2|T`>(0`Tc>(A,A T:| p| |N ,8`AA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`N 8`}N N A8 tx_8859_3|T`>(0`Tc>(AX/A T:|  | |N ,,8`A$AA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`N 8`N 8`}N N Ax tx_8859_4|T`>(0Tc>(^Ad/A T:|  `| |N ,,/!A A$A(A 8`}N 8`N 8`N 8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`N 8`}N N A tx_8859_5|T`>(0Tc>(FAT:/A|dc|d|hN ,,8`A8`A8`A8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`}N N A tx_8859_6|T`>(0`Tc>(AP0`|(JA T:|`c|`|hN A Tc:|ccp|c|hN ,,/ 8`AAA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`N 8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`N 8`}N N Ap tx_8859_7|T`>(0`Tc>(7AP0`0(A T:|`c|`|hN A Tc:|cc||c|hN ,, / >8`AAA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`N 8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`}N N Ap tx_8859_8}&T`>(/1Td>-@`} N ,^AX,/0._AA,A0A4,Tc>HPAH<8`H<8`H48`H,8`} N 8`H8`H A8`} N B tx_8859_9|T`>(0`Te>(@ `N ,A T:| | |N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`HTc>A8`}N Ad tx_8859_10}&T`>(/xTd>-R@`} N ,}A,S/`.aA A`AdA8A<,Tc>Hp,~/ A,A0@T8`} N 8`HL8`HD8`H<8`H48`H,8`H$8`} N ,Tc>A8`} N B tx_8859_15|T`>(0Te>(?@ `N ,AT:| d| |N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`HTc>A8`}N A\tx_koi8}&T`>(0RTe>(@ `N 0(-/.LE AA,,/ADA|-/.ALZAlA`,Tc>HtLBsAL,Tc>H`,RA8,/SALZA$,Tc>H8A$A(,Tc>H$8`H$8`H8`H8`H A8`} N B tx_decmcs|T`>(0`Tc>+_A0`:0(('A T:| d| |N A Td:|||N A T:|D||N /S,1,8`AdA0/A,B/RAHALAPAT8`}N <0d0/ D| A0AAA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`N 8`N 8`N 8`N 8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`N 8`N 8`N 8`}N N A tx_nextstep|T`>(0`Tc>(_A,!"A T:| | |N ,/!8`AdAL,S/vA A ,xAA8`}N , !AA8`}N ,"d,"e/%AAAA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`}N N Atx_dgi|T`>(0`Tc>+_A0`:0((A T:| d| |N A Td:|||N A T:|D||N ,"/,"`8`A(0`Tc>+_A0`:0(('A T:| | |N A Td:|<||N A T:|||N ,",/"d8`AhA,x/"ApAT,1/AA(,R/SAAA8`}N ,AA8`}N , D,"AA /!"AdAh8`}N ,"AhAl8`}N <`0,"+| AxAL/","HAPA ,"A4A88`}N ,"`A0A48`}N 0,"e A4A ,%AA8`}N 0| AA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`N 8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`N 8`HH8`N 8`N 8`N 8`N 8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`}N N A tx_quickdraw|T`>(0`Tc>(_A,!"A T:|  <| |N ,/!8`AdAL,S/vA A ,xAA8`}N , !AA8`}N ,"d,"e/%AAAA8`}N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`}N N A tx_hproman8|!HT`>(0`Tc>+_A|0`]0((|A T:|`c!||N A Tc:|c c#<|c |hN A bT:|#|d|hN ,"H,/%8`AA,/"AAD,/A\A ,/AAA`H,A@AH`H, ,"ApA / ,"A(-BTc>/A.y8`A,,/CAp8`A-/.A(8`A8`A8`A8`AH/,/AA8`A8`A8`AHx-z8`Ax,D,Z/[A(8`A`8`AX8`AP8`AHH4,{,|8`A48`A,8`A$H8`H`} K} N } N B@ tx_mazovia|!HT`>(0`Tc>(_A0`ڰ(A T:| %|| |N A Tc:|c c&| |N ,%$,% /%8`A@Ap, /%A A<,1/%AA,AA`H,%AA`H,%,%/%AAAA`H,%(0`Tc>(_A0`ڰ(A T:| 'p| |N A Tc:|c c(| |N ,%$,% /%8`A@Ap, /%A A<,/%AA, AA`H,%AA`H,%,%/%AAAA`H,%(+(A0`(LBA Tc>N 0`0(#+ A T:|`c)d||N A Tc:|cc)||N A T:|cc*d||N ,B,=/8`AhAT,-/>A8A(,/AAA8`?}N ,AAA8`?}N ,, AxA(/,APATAX8`?}N ,!"AA8`?}N 8`N 8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`N 8`N 8`N 8`N 8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`N 8`N 8`N 8`-Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`N 8`N 8`?}N N A tx_cp1250|T`>(0`Tc>+A0`0((A T:|`c*||N A Tc:|cc+X||N A T:|cc-||N , ,/~A8A((+0A( L+B.}ATc>} N bT:| A.||N /`,~8`A,R/a-AL8`A,S.xA8`A8`A8`?H8`A8`A8`?Hp, /!"8`A|8`At8`Al8`AdH<|8`-} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N |8`} N 8`?|} N } N } N Cd tx_cp1252|!HT`>(0`Tc>(A0`ڰ(A T:|ec.|e|hN A Tc:|c c2|c |hN ,%,%/%8`ApA,/%A$A<,/AA,AA`H$,AA`H,%,%AA/% AA`H,%AA`H,%4,%AA(0`Tc>+A<0`z0(H(A T:|`c2||N A Tc:|cc3||N A T:|cc4,||N ,,A4A88`?}N ,!"ApAt8`?}N 8`N 8`N 8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`N 8`N 8`?}N N A\ tx_cp1253}&T`>(/1Tc>-Ah,^8`A\,/0._A 8`A88`A08`A(H8`A8`A`} Kx} N } N B tx_cp1254|T`>(0`Tc>+7A$0`P0(D(,A T:|`c4||N A Tc:|cc5||N A T:|cc6||N ,,/ 8`AA(,/AALAp8`?}N , ,!"AAA8`?}N 8`N 8`H88`N 8`H(8`H 8`H8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`H8`H8`H8`H8`H8`N 8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`?}N N AD tx_cp1255|T`>(0`Tc>+\A0`0(F(.A T:|`c7T||N A Tc:|cc8||N A T:|cc9||N ,,/8`ADAL,R/AA ,SAA8`?}N ,~AAH8`?}N ,, /!"AAAA8`?}N 8`N 8`N 8`H8`N 8`H8`H8`H8`H8`N 8`Hp8`Hh8`N 8`N 8`N 8`HH8`H@8`H88`H08`H(8`H 8`H8`N 8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`?}N N A tx_cp1256|T`>(0`Tc>(A0`(A T:|`c:|`|hN A Tc:|cc>|c|hN /<,>, /!"A A$AhAl8`?}N 8`N 8`N 8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`N 8`N 8`?}N N A tx_cp1257|T`>(0`Tc>(A0`('A T:|`c>|`|hN A Tc:|ccAl|c|hN ,/,#8`AAd,x,AHA0/,/ALAAA8`?}N ,/A AA8`?}N ,/ AA(,/ APAAx8`?}N , ,!"AAA8`?}N 8`N 8`H8`N 8`H8`H8`H8`H8`N 8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`N 8`N 8`H8`H8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`N 8`Hh8`H`8`N 8`HP8`HH8`H@8`H88`H08`H(8`H 8`N 8`N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`N 8`H8`H8`H8`H8`Hx8`N 8`Hh8`H`8`N 8`HP8`HH8`H@8`H88`H08`H(8`H 8`N 8`N 8`H8`?}N N A tx_cp1258|T`>(A Tc|`cB ||N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8` H8` H8` H8` H8` H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8` H8`!H8`"H8`#H8`$H8`%H8`&H8`'H8`(H8`)H8`*H8`+H8`,H8`-H8`.H8`/H8`0H8`1H|8`2Ht8`3Hl8`4Hd8`5H\8`6HT8`7HL8`8HD8`9H<8`:H48`;H,8`H8`?H 8`@H8`AH8`BH8`CH8`DH8`EH8`FH8`GH8`HH8`IH8`JH8`KH8`LH8`MH8`NH8`OH8`PH8`QH|8`RHt8`SHl8`THd8`UH\8`VHT8`WHL8`XHD8`YH<8`ZH48`[H,8`\H$8`]H8`^H8`_H 8``H8`aH8`bH8`cH8`dH8`eH8`fH8`gH8`hH8`iH8`jH8`kH8`lH8`mH8`nH8`oH8`pH8`qH|8`rHt8`sHl8`tHd8`uH\8`vHT8`wHL8`xHD8`yH<8`zH48`{H,8`|H$8`}H8`~H8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8`?N }N ADtx_cp37|!HT`>(0Tc>(^A0`ڰ(A T:|ecF |e|hN A Tc:|c cG|c |hN ,%,%/%8`A`A,/%AA<,/AA,AA`H,!AA`H,%,%AA/% AA`H,%AA`H,%4,%ApA(0Tc>(?A,O0Y0`ڰA T:|`cG||N AP(0`](A T:|c cH|c |hN AlTc:|c cI@|c |hN (0ڀ(A Tc:|c cI|c |hN A bT:|J|d|hN ,"a/,%8`AA/,"AAT,,AA(/,/A$A\AdAl`H,/AAA`Hp, /"AA ,!/"AAA`HD,"),"HAAA`H(/%,%,A AT,"d,%AA(/"e,# /#!AAAA`H,% /%AAA`H,%/%4AA ,%/%$AAA`H,%<,%AAAx`H8`0!@N 8`Hp8`Hh8`H`8`HX8`HP8`HH8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`H8`H8`H8`H8`H8`H8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`0!@N `H"H0!@}N 0!@N Atx_cp856|!HT`>(0`Tc>(A\0`ڰ(A T:|ecJP|e|hN A Tc:|c cMP|c |hN ,%,/%/%8`AA\, ,%AA(/%,%/% AAA(00Tc>(A,0``0A T:|`cM||N AP(10](A Tc:|c cN0|c |hN ADbT:|N|d|hN (|A bT:|OD|d|hN /",,#!8`AA//AAT,,A`A(/,/ApA0A8AX`H,/A0A4A`H|,, AA(/,/AtA4ADAT`HH, /"AAA`H,/"d,%AAT,","eAA(/"),"H/"aA0ALAAP`H,#/# APAA``H,%/%A\A ,%/% AAA0`H,%,%A(0`Tc>+A(0Tc>(]A00`(|A T:|ecT|e|hN A Tc:|c cU|c |hN ,%,/%8`AAL,/!AA ,/ApAxA`H,","AAA`Ht,%,%AA /% ,%AAA`HH,%AA`H48`0!@N 8`0!@N 8`0!@N 8`0!@N 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`0!@N 8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H|8`Ht8`Hl8`Hd8`H\8`HT8`HL8`HD8`H<8`H48`H,8`H$8`H8`H8`H `H }H0!@}N 0!@N AXtx_cp866|!HT`>(0`Tc>+A|0`|0ڰ(J(A T:|dcW|d|hN A Tc:|c cW|c |hN A bT:|Y$|d|hN ,%$,% /%8`AAp, /%AA<, /%AA, AlAt`H,%A|A`H,%,%/%AAAA`Ht,%(0p(8`AX0`٠( A T:|`cY||N A Tc:|ccY||N ,%,!/&:8`AA,/#A0| @0| @(+Tc>+A0^((AT,A T:| Z| |N ,/8`dAA(,/AAA8`}N ,AAԁ8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`3}N 8`}N 8`}N 8`1}N 8`DN 8`xN 8`TN 8`N 8`tN 8`}N 0+(AA(,A T:|([,|(|N //8`gATAd,,AA0/,/ AALFӂA8`}N ,/ALBӂA8`}N ,z,A\A,/|,~/LLFA0A48`HP,/LB3A(A,8`}N 8`aN 8`aN 8`cN 8`dN 8`eN 8`I}N 8`i}N 8`Y}N 8`}N 8`l}N 8`n}N 8`o}N 8`O}N 8`o}N 8`r}N 8`s}N 8`t}N 8`u}N 8`zN 8`N 8`iN 8`N 8`"N 8`}N ( 0m+ A(6A8`ADT:|(\4|(|N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`i}N 8`k}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`}N 8`x}N 8`}N }N (!0ߐ+!A(A, } N 8`} N 8`} N 8`} N 8`} N 8`} N 8`} N (%S0(%yA\+RAT8`ÀT:|(^P|(|N 8`H8`H8`H8`Hx8`-Hp8`|Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`HpHl+%z0ڭ+%A\(&AT8`AdT:|(_|(|N 8`H(8`H 8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`Hx8`Hp8`Hh8`H`8`HX8`HP8`HH8`H@8`H88`H08`XH(8`H 8`-H8`H8`HH(&0G8`A0(A(,%0eڅ0@@AD(+0J(A Td:|(`8|(|N @L,%,%/%H@(0(( @LA T:|(`|(|N ,%,%/%A A<,%/%AA,%LB3A8`H0,%AA8`H,%,%/%AAAA8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`H8`} N 8`} N 8`} N 8`} N 8`} N 8`} N 8` } N 8`} N 8`H8` H8`H8`H8`H8`H8`H0٠( A(+%(%A P+!*%P(!A@+%lA80(L˂@ ,<0AT:|(b<|(|N H 8`%PH 8`%H 8`%QH 8`%H 8`%TH 8`% H 8`%WH 8`%H 8`%ZH 8`%H 8`%]H 8`%H 8`%`H 8`%H x8`%cH p8`%$H h8`%fH `8`%,H X8`%iH P8`%4H H8`%lH @8`%} N (&0`+&A(OA<0AT:|ep||N H$8`%H8`%H8`%H 8`%H8`%H8`%H8`&fH8`%H8`% H8`%H8`%H8`%H`H('0+'A\(AT0ٛ0ٖ(+LA)LBA/&@,&B,&`/&cL3LFAA<0d} N ( p+ LA8`!} N *O+ (O@˂AA4@8`0} N ( t( y+ 0+ AT>A`} N 0߆0c߰(A Tc>@<`0cÀT:|f||N 8`+H8`-H8`=H8`(Hx8`)HpHl+(+A(Al0(\L\ @\<`0cAPT:|g||N 8`bH8`BH 8`CH8`H8`DH8`EH8`eH8`FH8`GH8`H8`hH8`H8`iH8`KH8`kH8`lH8`H8`mH8`NH8`nH|8`OHt8`oHl8`PHd8`pH\8`RHT8`SHL8`sHD8`H<8`tH48`TH,8`UH$8`uH8`VH8`YH 8`yH8`ZH8`zH8`3H8`wH8`AH8`aH8`IH8`iH8`OH8`oH8`UH8`uH8`H8`HH+*+A,(A$<0LP+@`} N (p*_(A4+A,(@P<AH0A@`} N +*~+Ad(A\(A0+LD @,z@<0dA } N 8`'} N 8`,} N ( <( A0A`} N +!* +!OA<( A4( Ax+ Ap<Ah0A``} N (!P*!(!A4+!"A,(!&A0<A(0A `} N +*![+A,(!^A$<0LP+@聁`} N ( (* oA+A(A(A+A0P(,L˂@<`0cAT:|hx||N 8`hHP8`jHH8`rH@8`wH88`yH08`H(8`"H 8`'H8`H8`H8`~HH<( 0A( A+ + A@( ( A@* + "A@( &( 0A@+ 9A( :A* <( >A@( DA+ AA@8`%Q} N @8`%P} N <0d} N | @0A8| @0A,`} N |} N N } N C tx_lucidasub| "$ 8|(f ܉ `|i@0|@ |e9 9@A(b(T:|c(.AT:|0i,|0|N a UJ029 |H 1)|(T02|H 1)|(T02|H 1)|(T02|H 1)|(T02|H }J(|P 0 萤 8`}N N A utf8_to_ucs2|Th>(( 88`@ 8`H<@ 18`0`i(|H 1)AT:|(iD,|(||N a|Hp 1#UѾa|Hp 1)UѾa|Hp 1)UѾap|H 1)UѾap|H 1)UѾ}+x|H 쁁0 }N A ucs2_to_utf88`N @ isunicode$%$$$%%%%%@%P%%%%%%%%%%%%%%%%%%%%%%%%%%X%`$$$$%8%%%%%%%%%%%%%%%%%$%%%%%%%%%0%%(%H%%p%x%% %h%%((((((((h((p((((((((())** ***$*,*4*<*D*L*T*\*d*l*t*|**************............................./222/22//2222/22/222/222/2222222200 2022020$20,2040<22220D0L20T0\220d20l0t20|2002022020202002222002002202002222011 111$22221,141<1D1L1T2222221\1d1l1t222222222222222222222222222221|1221122111122112222222112211221112222 222$2,242<2D222222222L2T2\2d22222222l2t2|2223T663\3d663l3t66663|6636333363366663663336366333344 444$64,444<4D64L4T64\4d4l4t664|44464664444444446444565 5655$5,54666666666665<5D5L5T66666666666666665\5d5l5t5|56655556666666655665566666666666666666666666666666666666666555566666666666655666666666666656699969966999969669996999699999999677 777$997,97497<7D999997L7T7\7d7l97t7|7997977777799797977999997777898 889998$8,99848<9999998D8L998T8\8d8l998t8|889999999988999988889988999999888998899999999899999 999$999999999,94999999999<9D99999L9T9\9d9l9t9999999|999999999999:h:p:x:::::::::=P:::::::;;;;; ;(;0;8;@;H;P;X;`;h;p;x;;;;;;;;;;;;;;;;<<<<< <(<0<8<@?p>>>> >(>0>8>@>H>P>X>`>h>p>x>>>>>>>>>>>?p?p?p?p?p>>>>>????? ?(?0?8?@?H?P?X?`?h@8CC@@CC@H@P@X@`C@h@p@xCC@@@@CCC@CCC@C@@@@C@@@C@C@AAAAA A(A0A8A@AHAPAXA`AhApAxAAACAAAAAAAAAAAAABBBBB B(B0B8B@BHBPBXB`BhBpBxBBBBBBBBBBBBBBBCECCCCCCDDEDD D(D0ED@DHDPDXD`DhDpDxDDEDDDDEEEEEEEEEEEEEEEEEEEEEEEEDDDDDDDDDDEEEEE E(E0E8E@EHEPEXE`EhEpExEEFIIIIIIIIIIIIFIIIIIIIIIIIIIIIGGIIGGG G(G0G8IIG@IGHIGPGXG`IIIGhGpGxGIGIGGGGGIIGGGGGGIIGIGIGHHHHIH H(H0H8IH@IHHHPHXH`HhIHpHxIIHHIIIIIIHHIIHHHHIIHHHHIIIIIIIIHHIIIIHHIIIIIIIIIIIII I(I0III8I@IIIIIIIHIPIXIIIII`IhIpIxIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIKxKKKKKKKKKKKKKKKKLLLLL L(L0L8L@MpLHLPLXL`LhLpLxLLLLLLLLLLLLLLLLMMMMM M(M0M8M@MHMPMXM`MhOOOOOPP PPP$P,P4Pc8`00KO008`KO};,}A|,?|}(@40|}09008`KyOH<},,L3A08` KYO8`}8`}((A@D},A$},@008` KYmO8`}}}H(A bTT:}@.|c@|hN (8@8`}008`KٕOH+[(P(\8`@ }H+`A(/+LAAl8`*_}008`K9O@`bc,AP008`8;K Ob98H (L;8`Ad}/9A9=}H9A430c8` KXOc08`K؍OHA}8`XTH(/(+;8`LA\},A@},@430c8` KWOc08`KOH @}8`XTH(?+(8`LAAPb(ic,A(@܀}3|~30 c8KsQA,@KQ8`}}}Hc08KsA,@,Ky}cKWO8`}}}HP},A8` ,0@|cKVeOc08`KO8`}HT},A@},@430c8` KVOc0,8`K֍O8`}}}H@}8`XTH(@8`XTH|h,A`}8]<"X|P9@@ 1#=8H4iH]8]CH(\8`;@},A@},@430c8` KUOc0<8`KՕObc,Ac0L0d8`XKaOX}=80!PI8`N "}i,AT8}<1H|bX9`@$#9`}iA1c8QHci}8}c8`XT0!P|} N Cdchkaes|!P;lt,8@KTO``Xt}l0!P`N A\ckcputf|!Pld0,0l,8`A@L0h0|8`KOlt;KTAOtlX0!P}N L0!PN Ackcputc|!P8`p,|A|KCO,|0Ad0e|K3O,|@8 |(@`K3O,| @p0dHA p0d|d0XL}0!PN Ackcgetc|!bP33;; ;@; H@KU}O{`fcc8`K Oc,,A[8H@ ;8`KSA,{0;@A<08`KѩO,,8`3A`@8,H ;,8`A 00dh0!`}N A$kbget|}&!`Bb 3 ܫJ2БA8PKO:`nnaYK_aO\, @0nKfOX0!}8`ãN BX80 LB 8`KmOKHAL0n KfyOa܂B HT:@ 0H |P.KaO0nKa O0nK`OH0nK`OBDJ, A<\0nHK`O_0n4, A 0KHO,@D0ndK`aOa܁XKEeA0!|a8`} N L P008`KO008`KO008`KQO,/,A,AT/A0,A -@ V, @6N, H/@ V, AvN, Hh,@$[;, @;U>,H@0U W, ABJ,@nHU>,HALN, ÁA3P.~+2}8,XxA 3}Q.NH, A0 0 (8`8KK=eONP, @D,A8`KONP, @KeO,A KOnPNL, AB8`KOA<,@L0n dD,@0 tKSO,H ,@0n KSOBjB(0 0 8`KaO0 0 8`KIOA \O, @0n KSQO0n KSEO.H 4a܂B K8AA0 0 8`8KOKa܂B K8AKnOB`e0 8`KOKda܂B K7݀AKnQOB`e0 T8`KOK,a܂B K7AKnOB`e0 $8`KIOK{W~, Aa_U>,A BW>J, A K"OB́J, A,A K=OBW>J, @U T,AcK}O`}-@$N@, AcKO`}-AH0 0 c8`;KO@2;Hr7,LB3AXY/, ,A<@.TN, K,@nTN, KNT, AcN,@, AK6ɀA`~nW>, AK6A`~N, AW>K5N,, AAN, AxBJ/ AhN,AhN,,@HO/ @<8`ḰX, A,Z,@ 8`KqOO, H@0O, @hN/ @\MP8, @DB|J, A4cKYX, AZW>,@ KO; cK)X, AZW>,@ KON, A(N,@X0X8` 8K8aOB W>J,A8KlO,A( Tj:|P.b B K]OKaK3݀AKP,XW 6}JUJ:0 ~|P.A 0 H0 B;JUK 6}JXbUJ:|P.K3A9@ }A|+c3 @LW>1J}_PN8c0 $8`KO0 48`8KO9@OKAKaK3AKOKimOB`e0 8`KOKH8`K7OB K4nDM, P8@DBT:J|.,A,0 x8`KIOB-J}J.NDKB܁J0@|BW~J, AhBJ|P@Xc0 0 8`KON5JNAN3jHKYTc~H-NDKtNc, @,AK2ŀA`nW>, AK2A`NW>, AK5Y, AtW0,@d, NX/ ,A0@L8`K8OKO.Xt,,H,@ 8`K8yOKaOnXt,,@.X@nX}k8, Ht}k8, U}>@āB ;J, A; ,HhP, AXW,@LU, @B$J, ,HB(J, ,A@; ,H ;,At8` K7OKOV, A8` K4OcW>HJ, A$cKtOK5UOX, HK4=OX, AZ, , L1A; W>KO-NDK0n KLeOnHKВnaK/A8`0!|} N Cpconect|!P0K4O0K4}Ob,@0K4aO0(K4UO0xK4O00K4=O40AcHKT~~,\0c8`0x0TK}Oc|@@A`K}A,cAKAT~>0~(Tc:/ |}AЀc|}|hN K'OH08`9P8`L0HK2OH0K4qO0 K4aO~t,A x00K- AxH8~0,xA00H 00K,ՀAxK3O~,@0b0,A x0K,AxK3Ob0x,A 0$H0,K,eAx LK3O}04,x8A8K,1Ax PK3QO}0L,x8A8K+AxpK3O}xTc>KUO3d`eccK+AxK2O}0p,xA 0H0K+AxK2O\0x,@0K+YAxK2}O~,@ KdO8`K9O,A4xK-O3`eccK+AxK2%O0K2OH8`9P0HK0qOH-,!At,0/?.@@A(A@KT~>c|@@K@08`,@TK.!O0KEO|Tc>K-!O,@0KDO8`HXT0!PHK.OH8`K1AOTc>K%OH,, AhA/A$@K#=OXT0!P|Ht8`,A@8,@0x9998KYOH(K. OH,A|A8(\8`@\3\4cch1hA1#?cH KIh P=|cH8Tc>( ( LAphh4c1hA1#?cH Kh=|cH8Tc>( ( AAhh4cK8`hh0hK5qO,Tc>A(K/OTc>KmOXT0!PH8`K,OH܀b܁8`,@ KrOXT0!P|H8`K,OHt8`,A@8,@0x9998K}OHLK,-OH@90HK-OH(cK.OTc>KOH K+OXT0!P|} N Cdoesc HPP4p,( FfA$LL*%@,aN L*%@ aN %|!?A A#fHEAxD0!<|N A L| N //\/\\C-Kermit library, 7.0.003, 13 July 1999ckmatch stringckmatch patternckmatch skipfileselectfileselect fdatefileselect safileselect sbfileselect snafileselect snbfileselect filesizefileselect minsiz skippingfileselect maxsiz skipping*.~[0-9]*~fileselect skipping backupfileselect xlist emptyfileselect xlistfileselect skippingfileselect selectingABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=>?456789:;<=  !"#$%&'()*+,-./0123chknumevenoddmarkspacenoneinvalid%02ld:%02ld:%02ldUNIX File support, 7.0.146, 15 Jun 1999 IBM RS/6000 AIX 3.2rm -f cp mv pwd ls -l ls -l cat Maillpdf df who /usr/adm/wtmpWTMP open failedWTMP write errorWTMP record OKcksyslog s1cksyslog s2cksyslog s3%s: %s %scksyslog errno/var/log/iksd.logdoiklog openxferlog open failure %s: %mdoiklog open errnoxferlog: %s open okzopeni namezopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinrzopeni fopenzopeni fullnamefile[%d] %s: open failed (%m)file[%d] %s: open read okzopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULLzopeno fp[n]=stdoutwazopeno appendzopeno fullnamezopeno fopen argzopeno failed errnofile[%d] %s: %s failed (%m)appendcreatezopeno zobufsizezopeno ZOFILE nonblockingzopeno ZOFILE unbufferedfile[%d] %s: %s okappendcreatezopeno okzclosezclose zclosfzclose zclosf fp[n]zclose fclose failszclose error flushing last bufferzclose iklogopen**%.24s %d %s %ld %s %c %s %c %c %s %s %d %s _ikskermit*zclose iksdmsgzclose returnszsinl zchin failzsinlzinfill kactiveZINFILL feofzinfill calling ttwaitzinfill ttwaitZINFILL freadZINFILL ferrorZINFILL errnoZINFILL count 0 EOF return -1ZINFILL count 0 not EOF return -2 %czoutdump zoutcntzoutdump wrotezoutdump write errorzoutdump write returnschkfn out of range/dev/nullzgetfs readlink(lookup failed)zgetfs S_ISLNK needrlinkzgetfs readlinkzgetfs readlink errnozgetfs readlink result/dev/nullzchki stat failszchki not regular filezchki stat ok:zchki access failed:zchki access ok:zchko/dev/nullzchko: Malloc error 46 zchko izchko itsadir.zchko access failed:zchko access ok:zdeletzdelet fullnamefile[] %s: delete failed (%m)file[] %s: delete oknzrtol name/dev/null.%snzrtol fullnamenzrtol sizing MAXNAMLENnzrtol sizingNONAMEnzrtol new namezstrip beforezstrip after tilde-strippingzstrip afternzltor name.././nzltor fullnamenzltor name2zchdirzchdir 2zchdir 3HOME.zgtdir SVORPOSIX CWDBL./zxcmdzxcmd outwzxcmd pipe failure/bin/shzxcmd pid/dev/nullSHELLzxcmd shpathgetpwuid()zxcmd...-czxcmd fork failurezxcmd pidrzxcmd fcntl 1 pipe flagszxcmd fcntl 2 resultzclosf filnumzclosf outzclosf pclosezclosf pexitstatzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzclosf wait statuspzclosf wait pexitstatzclosf fp[filnum]zxpand entryzxpand xdironlyzxpand xfilonlyzxpand fn 1*zxpand fn 2zxpand isdir 1zxpand fn 3zxpand okzxpand fcountnzxpandnzxpand xdironlynzxpand xfilonlynzxpand xmatchdotnzxpand xrecursivenzxpand xnobackupznextznewnznewn max 1znewn max 2znewn namepartznewn len.~*~znewn A matches.~%d~znewn A new nameznewn B delta.~*~znewn B matches.~%d~znewn B new namezrename oldzrename new/zrename dirzrename no dirfile[] %s: rename to %s failed (%m)file[] %s: renamed to %s okzcopy src argzcopy dst argzcopy files identical: stat()source file not foundzcopy srczcopy dst 1zcopy files identical: strcmp()zcopy source is directoryzcopy dst 2zcopy open sourcezcopy open destzcopy final readzcopy errnofile[] %s: copy to %s failed (%m)file[] %s: copy to %s okzgperm------------------------------%ozgpermziperm----------zipermzsattr buf.st_mode & 0777%ozsattr lpermszsattr gpermsU1zdtstr timearglocaltime returns nullzdtstr tm_yearzstrdt YEAR-2000 ALERT 1: localtime yearzdatstr year%04d%02d%02d %02d:%02d:%02dzdatstrzfcdatzfcdat lstatzfcdat statzfcdat stat failedzfcdat buffer.st_mtime;Zx0NzstrdtBad creation date zstrdt date check 1Bad creation date zstrdt date check 2Bad creation date zstrdt date check 3zstrdt so far so goodzstrdt yearzstrdt fails - yearzstrdt 4 bad date zstrdt 6 bad date zstrdt 9 bad date zstrdt 12 bad date zstrdt 15 bad date zstrdt tmx 1zstrdt tmx 3zstimezstime datezstime: nothing to dozstime: zstrdt failszstime: tmzstime: A-pkt date ok zstime: Can't stat file:zstime lpermszstime gpermszstime system id%ozstime file perms beforezstime isguestzstime ckxpermszstime isguest sb.st_modeU1%ozstime octal lpermzstime mask 1zstime mask 2zstime gprotectzstime S_IRUSRzstime S_IWUSRzstime S_IXUSRzstime mask xzstime mask x|maskzstime flagzstime S_IFMT x%04ozstime file perms afterzstime: sb.st_atimezstime setpermszstime DIRECTORY bit onzstime DIRECTORY bit offzstime chmodzstime 0: can't set modtime for filezstime 0: modtime set for filezstime 1: comparezstime 1: comparepacketmail %s < %szprint filezprint flagszprint printernamezprint printpipecat %s | %scat %s >> %s%s %s < %szprint command:echo%s %s splitpath***splitpath mallocsplitpath malloc failuresplitpath xpatlastfgen patfgen current directoryfgen scratchfgen xpatslashfgen string spacefgen can't malloc string space fgen xpatfgen xpatlastfgen xpatabsolutefgentraverse add: end of path segmenttraverse entry sofartraverse entry xpattraverse entry xpatlasttraverse entry pl -> nparttraverse xpatslash absolutetraverse xpatslash relativetraverse xpatslash ckmatchtraverse add: recursive, match, && !isdirtraverse sofar 2traverse segisdirtraverse itswild traverse existstraverse not foundtraverse sofar 3traverse opening directorytraverse opendir()traverse opendir() failedtraverse skippingtraverse add: recursive && isdir && segisdir or matchtraverse mresult xpattraverse mresult pl -> nparttraverse mresult sofartraverse mresult xmatchdottraverse mresult nambuftraverse mresult itswildtraverse mresult segisdirtraverse add: match && !itsadiraddresult itsadiraddresult isdir errnoaddresult skipLOGNAMEtilde_expand?Privilege cancellation failure /bin/shsh-c/bin/shz_exec commandz_exec arg 0z_exec arg 1z_exec errno/bin/shSHELL-i-cisdir lstatisdir statisdir errnoisdir S_ISLNK islinkisdir islinkisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseekzfnqfp fnamezfnqfp xpzfnqfp while *szfnqfp zgtdirzfnqfp buf 1zfnqfp buf 2zfnqfp len/.////../zfnqfp overflowzfnqfp pathzfnqfp name?Local resource failure: malloc sgetpwnamgetpwnam()userzvuser ckxsyslogzvuser CKSYSLOG definedlogin: user %sftpanonymouszvuser anonymous ckxanonlogin: anonymous login not allowed: %s(unknown host)ftpanonymouszvuser anon forbidden by ftpusers filelogin: anonymous login forbidden by ftpusers file: %s(unknown host)ftpzvuser anon sgetpwnam(ftp) OKanonymouszvuser anon sgetpwnam(ftp) FAILEDlogin: anonymous getpwnam(ftp) failed: %s(unknown host)zvuser sgetpwnam ok/usr/bin/bashzvuser shellzvuser checkuserzvuser refused 1login: invalid shell %s for %s %s(unknown host)zvuser refused 2login: %s login forbidden by ftpusers file: %s(unknown host)zvuser sgetpwnam NULLlogin: getpwnam(%s) failed: %s(unknown host)checkuser name/etc/ftpusersrcheckuser userfilecheckuser linecheckuser REFUSEDcheckuser OKWTMP logoutiksdckermitzsyslog syslog openedzvpassxxxxxx(null)login: anonymous guests must specify a passwordxxzvpass deniediks_%04x(unknown host)WTMP loginzvpass anon chrootzvpass anon chroot FAILED/zvpass anon chdir FAILEDzvpass anon chroot/chdir OKzvpass non-guest chdir FAILEDzvpass non-guest chdir OKzvpass setuid FAILEDzvpass setuid OK/login: anonymous %s %s(unknown host)User %s logged in. login: %s %s(unknown host)USER=%sLOGNAME=%sHOME=%sUNIX Communications support, 7.0.214, 21 Jul 1999 IBM RS/6000 AIX 3.2/dev/ttynoneLINESxttgwsiz LINESCOLUMNSxttgwsiz COLUMNSle_inbufchars waitingle_putcharbuffer is fullle_putsle_putsle_putstrttgwsiz TIOCGWINSZttgwsiz tt_rowsttgwsiz tt_colsttgwsiz TIOCGWINSZ 00***************SIGHUP received***************sysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! sysinit jchdlr: SIG_IGNsysinit jchdlr: SIG_DFLsysinit jchdlr: othersysinit uname machinesysinit uname sysnamesysinit uname releasesysinit uname versionUSERsysinit uidbufJOBACCTPRINTERDISPLAYUNIXLOCATIONsysinit startupdirttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 *NOT* definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen netttopen got open network fdPipe errorFork errorwfdopen failurettopen net xttopen got open fdttopen fdflagttopen timottopen alarmttopenmodemttopen ttyfdttopen alarm returnttopen ttyfdttopen errnottopen EACCESS/dev/null%s is not a terminal device ttopen not a tty/dev/tty ttname=CTTNAM cname ttyname ctermid ttyname redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %dttopen lockpid%s %sttopen ioctl TCGETA ttold.c_lflagrtsAIX line disciplinettopen O_NDELAYttopen fcntl O_NDELAYttopen fcntl failure to unset O_NDELAYCan't unset O_NDELAYttopen xlocalttopen executing close/openttopen calling carrctlttopen carrctl okttopen ioctlttopen ttspeedttopen ttyfdttopen *lclttopen lock filettclos ttyfdttclos netconnttclos closing netttclos ttyfd after netclosttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donetthang get settingstthang speedtthang turning O_NDELAY ontthang TCXONCtthang TCXONC failedtthang TIOCSTARTtthang TIOCSTART failedtthang TCSETAF failedtthang close/open, OPENFLGStthang restore settingsttres tty modes restorettres errnortsttres AIX line discipline rts restorettchkpid lock pidttchkpid my pidttchkpid kill errnottchkpid pid testremoving stale lockRemoving stale lock %s (pid %d terminated) ttchkpid unlinkttrpidttrpid zchkittrpid fdttrpid string read%dttrpid integer readttrpid short readttrpid pid/etc/locks/etc/locksttlock readlinkttlock linkttlock linkdevLCK..%sLCK..%s%s/%sttlock link symlock%s/%sttlock lock2ttlock lock2 cleared%s/LTMP.%05dttlock flfnamttlock tmpnamttlock creat failedUUCP not installed or Kermit misconfigured %10d ttlock hdb pid stringttlock: lockf returns errnottlock unlinkttlock found tty lockedttunlckttunlck lockfile seizedWarning - Lockfile %s seized by pid %d ttunlck unlinkWarning - Can't remove lockfile: %s ttunlck lock2 unlinkWarning - Can't remove secondary lockfile: %s rtshardflow TXADDCD (rts) errorrtshardflow TXDELCD (rts) errorttpkt parityttpkt xflowttpkt speedttpkt ttpmskttpkt netconnttpkt carrierttpkt 2 stopbitsttpkt 1 stopbitttpkt 8 bits + even parityttpkt 8 bits + odd parityttpkt 8 bits + invalid parityttsetflowttvt ttyfdttvt tvtflgttvt speedttvt flowttvt network connection, skipping...ttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttpkt 2 stopbitsttpkt 1 stopbitttvt 8 bits + even parityttvt 8 bits + odd parityttvt 8 bits + invalid parityttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failsttsspd TCGETA ioctlttsspd TCSETAW ioctlcongspdttgspd ttyfdttgspd c_cflag CBAUD 1 ATTSVttgspd ioctl 2 ATTSV xttgspd ioctl 2 ATTSV errnottgspd ioctl 2 ATTSV speedttgspd codettgspd speedttpushback nttpushback my_countmygetbuf IMPROPERLY CALLED with my_countmyfillbuf readmygetbuf errnomygetbuf TCP errormygetbuf SERIAL errorSVORPOSIX myfillbuf calling read()SVORPOSIX myfillbufSVORPOSIX myfillbuf ttcarrSVORPOSIX myfillbuf errnottinl calling tn_doop()ttinl tn_doop() returnedtxu_start and !inserverme_start and serverttflux my_countttflui le_inbuf chttflui ttpipettflui netfluittflui ttyfdttflui ATTSVconbgt process group testSVR4ORPOSIX jc test...sysconf fails, jcshellsysconf(_SC_JOB_CONTROL)jcconbgt jcconbgt jcshellconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconnoi%din_chk entryin_chk carrier lostin_chk close-on-disconnectin_chk FIONREAD return codein_chk FIONREAD countin_chk FIONREAD errnoin_chk my_countin_chk nin_chk resultttxin MYREADttxin myread returnsttxin xttol nttol sttol dblflagttol tryttol okttol write errorttol TCP errorttol partialttoc timeoutttoc flowttoc errnottinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl unsavingttinl myread failure, nttinl myread errnottinl EINTR myread ittinl untimed network myread fails^%c... Canceled... ttinl skippingttinl lengthttinl extended lengthttinl bad seqttinl EOP lengthttinl ittinl csavedttinl removedttinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttincttpushttinc le_getcharchttinc myreadttinc restoring oldalarmttsndb ttyfdsndbrk ATTSVCan't send BREAKttwait select errnottwait OKttwait select xmsleep SELECT 1msleep SELECT 2msleep SVR4 selectgtimer%fgftimerztime GFTIMER gettimeofdaycongm getting modes/dev/ttyconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb cccbrk.c_flagconcb c_cc[VINTR]concb returnsconbinconres cgmfconres isatty okconres restoring ioctlconchk contypttincttpushttinc LocalEchoInBufchconinc(0) errnoconinc timeout logic errorconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlttgmdm K_MDMCTL definedttgmdm TIOCMGET ioctlttgmdm errnottgmdm bitssuspendpsuspend errorpsuspend ok?Sorry, device is not open ttruncmd systemttruncmd waitttruncmd wait statuspttruncmd wait pexitstat%s%s %s :Network support, 7.0.171, 24 Jul 1999TCP ck_linger can't get SO_LINGERTCP ck_linger error: SO_LINGERlenTCP ck_linger SO_LINGERexpected lenTCP ck_linger SO_LINGERlinger_opt.l_onoffTCP linger SO_LINGERlinger_opt.l_lingerTCP ck_linger can't set SO_LINGERTCP ck_linger new SO_LINGERTCP ck_linger SO_LINGER unchangedTCP sendbuf can't get SO_SNDBUFTCP sendbuf error: SO_SNDBUFlenTCP sendbuf SO_SNDBUFexpected lenTCP sendbuf SO_SNDBUFiTCP sendbuf SO_SNDBUF retrievedTCP sendbuf can't set SO_SNDBUFTCP sendbuf old SO_SNDBUFTCP sendbuf new SO_SNDBUFTCP sendbuf SO_SNDBUF unchangedTCP recvbuf can't get SO_RCVBUFTCP recvbuf error: SO_RCVBUFlenTCP recvbuf SO_RCVBUFexpected lenTCP recvbuf SO_RCVBUFiTCP recvbuf SO_RCVBUF retrievedTCP recvbuf can't set SO_RCVBUFTCP recvbuf old SO_RCVBUFTCP recvbuf new SO_RCVBUFTCP recvbuf SO_RCVBUF unchangedTCP keepalive can't get SO_KEEPALIVETCP keepalive error: SO_KEEPALIVElenTCP keepalive SO_KEEPALIVEexpected lenTCP keepalive SO_KEEPALIVEkeepalive_optTCP keepalive can't clear SO_KEEPALIVETCP keepalive new SO_KEEPALIVETCP keepalive SO_KEEPALIVE unchangedTCP no_delay can't get TCP_NODELAYTCP no_delay error: TCP_NODELAYlenTCP no_delay TCP_NODELAYexpected lenTCP no_delay TCP_NODELAYnodelay_optTCP no_delay can't clear TCP_NODELAYTCP no_delay new TCP_NODELAYTCP no_delay TCP_NODELAY unchangedtcpsrv_open netttcpsrv_open namecopykermittcpsrv_open service requestedtcpkermitCannot find port for service: %s tcpsrv_open can't get servicetcpsrv_open checking previous connectiontcpsrv_open previous tcpsrv_porttcpsrv_open closing previous connectiontcpsrv_open tcpsrfdtcpsrv_open bzero oktcpsrv_open calling socketTCP socket errortcpsrv_open socket errortcpsrv_open calling setsockopttcpsrv_open setsockopt Binding socket to port %d ... tcpsrv_open bind errnotcpsrv_open bind OKListening ... tcpsrv_open listen errnotcpsrv_open listen OK Waiting to Accept a TCP/IP connection on port %d ... tcpsrv_open BSDSELECTtcpsrv_open accept errnotcpsrv_open no_delaytcpsrv_open keepalivetcpsrv_open lingertelnettcptcpsrv_open accept errnotcpsrv_open service%s Reverse DNS Lookup... tcpsrv_open gethostbyaddr != NULL(OK) :%s connected on port %s Failed. (OK) :%d%s connected on port %d tcpsrv_open accept errno%sckgetfqhn():ckgetfqhn() gethostbyname != NULLBCOPYhost->h_addrBCOPY (caddr_t)&r_addr.sin_addrBCOPYhost->h_lengthckgetfqhn() gethostbyaddr != NULLckgetfqhn()netopen nettnetopen namecopynetopen name has colonnetopen namecopy after strippingnetopen p after strippingtcprloginnetopen namecopy found @netopen namecopy usernamenetopen namecopy passwordnetopen x pnetopen x qnetopen found portnetopen portnetopen tempservicenetopen temphosttcpnetopen tempservicenetopen temphostnetopen URL resulttelnetnetopen hostnetopen service requestedtcp%s%dtcpkermittelnetCan't find port for service %s netopen can't get servicenetopen service okkermittelnetnetopen bzero oknetopen inet_addr DNS Lookup... netopen gethostbyname != NULLBCOPYhost->h_addrBCOPY (caddr_t)&r_addr.sin_addrBCOPYhost->h_lengthnetopen gethostbyname == NULL: Not INADDRXnetopen uuCan't get address for %s netopen can't get address%snetopen trying Trying %s... TCP socket errornetopen socket errornetopen binding socket tonetopen bind errnonetopen connect errnoFailedgetsockname Reverse DNS Lookup... netopen gethostbyname != NULL(OK) netopen host->h_name is NULLnetopen host->h_name is empty: %s connected on port %s Failed. (OK) %snetopen servicenetopen namenetclosnetclose setting tn_init = 0nettout caught timeoutnetinc socket is closednettol TCPIPLIB not definednetflui non-TCPIPLIB128.127.50.1%sgetlocalipaddr setting myipaddr to%sgetlocalipaddr setting myipaddr totelnet BREAK ok_%s._%s.%sTelnet support, 7.0.170, 28 Jul 1999EOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBWILLWONTDODONTIACBINARYECHORCPSUPPRESS-GO-AHEADNAMESTATUSTIMING-MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND-ASCIILOGOUTBYTE-MACRODATA-ENTRY-TERMINALSUPDUPSUPDUP-OUTPUTSEND-LOCATIONTERMINAL-TYPEEND-OF-RECORDTACACS-UIDOUTPUT-MARKINGTTYLOC3270-REGIMEX.3-PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTIONNEW-ENVIRONMENTTN3270EXAUTHCHARSETremote-serial-portCOM-PORT-CONTROLsuppress-local-echostart-tlskermitsend-urlpragma-logonsspi-logonpragma-heartbeatibm-sakunknownREFUSEDACCEPTEDREQUESTEDREQUIRED0SYNCHBRKIPAOAYTEORABORTEOFSUSPECELEWRPLNEXTXONXOFFFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOLNULLKERBEROS_V4KERBEROS_V5SPXMINKSRPRSASSLIANA_8IANA_9LOKISSAKEA_SJKEA_SJ_INTEGDSSNTLMCLIENT_TO_SERVER|ONE_WAYSERVER_TO_CLIENT|ONE_WAYCLIENT_TO_SERVER|MUTUALSERVER_TO_CLIENT|MUTUALCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPTSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPTCLIENT_TO_SERVER|ONE_WAY|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|CRED_FWDCLIENT_TO_SERVER|MUTUAL|CRED_FWDSERVER_TO_CLIENT|MUTUAL|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_USING_TELOPT|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGESERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGECLIENT_TO_SERVER|ONE_WAY|ENCRYPT_RESERVEDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_RESERVEDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_RESERVEDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_RESERVEDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_AFTER_EXCHANGE|CRED_FWDCLIENT_TO_SERVER|ONE_WAY|ENCRYPT_RESERVED|CRED_FWDSERVER_TO_CLIENT|ONE_WAY|ENCRYPT_RESERVED|CRED_FWDCLIENT_TO_SERVER|MUTUAL|ENCRYPT_RESERVED|CRED_FWDSERVER_TO_CLIENT|MUTUAL|ENCRYPT_RESERVED|CRED_FWDISSUPPORTREPLYSTARTENDREQUEST-STARTREQUEST-ENDENC-KEYIDDEC-KEYIDANYDES_CFB64DES_OFB64DES3_CFB64DES3_OFB64UNKNOWN-5UNKNOWN-6UNKNOWN-7CAST5_40_CFB64CAST5_40_OFB64CAST128_CFB64CAST128_OFB64SIGWINCH caughttn_outstunanswered WILLtn_outstunanswered DOtn_outstunanswered WONTtn_outstunanswered DONTtn_outstU kermit in progress<tn_wait waiting fortn_waittimeout Negotiations..?Connection closed by peer. tn_wait tn_doop?Telnet Option negotiation error. ?Connection closed by peer. (OK) tn_pushTELNET negotiation loop %s %sSAKUNKNOWNUNKNOWNTELNET SENT %s %sSAKUNKNOWNUNKNOWNUnable to Send TELNET SB - data too longlenTELNET SENT SB %s FOLLOWS IAC SEUNKNOWNTELNET SENT SB %s SEND IAC SEUNKNOWNTELNET SENT SB %s IS %s IAC SEUNKNOWNTELNET SENT SB %s %sINFOUNKNOWNISSEND%02x USERVAR VAR VALUE ESC IAC %c IAC SETELNET SENT SB %s %02x IAC SEUNKNOWNtn_flui tn_doopiks_wait KERMIT_REQ_STARTu_startiks_wait() me_iks_req_startiks_wait KERMIT_REQ_STOPu_startiks_wait() me_iks_req_stoptn_ini ME REFUSE UNKNOWNtn_ini ME ACCEPT UNKNOWNtn_ini ME REQUESTUNKNOWNtn_ini ME REQUIREUNKNOWNtn_ini U REFUSE UNKNOWNtn_ini U ACCEPT UNKNOWNtn_ini U REQUESTUNKNOWNtn_ini U REQUIREUNKNOWNtn_ini ttnprototn_ini tn_inittn_ini skipping telnet negotiationstn_start switching from Kermit to Telnettn_startsstelnettn_ini tt_rows 1tn_ini tt_cols 1tn_ini tt_rows 2tn_ini tt_cols 2tn_ini about to send WILL TTYPE if requestedtn_ini tn_sopt WILL TTYPE failedtn_ini sent WILL TTYPE oktn_ini tn_sopt DO TTYPE failedtn_ini sent DO TTYPE okpre-encryptend of telnet negotiationstn_ini duplextn_ini done, tn_inittn_debugTELNET SENT SB KERMIT SOP %02X IAC SESTARTSTOPREQ-STARTREQ-STOPRESP-STARTRESP-STOPTELNET SENT SB kermit %s IAC SEEntering tn_sb()TELNET Subnegotiation error - used DONT instead of SE!TELNET Subnegotiation error - used DONT instead of SE!tn_sb end of while loopflagTELNET Subnegotiation prematurely brokenoptTELNET Subnegotiation prematurely brokenUNKNOWNSTARTOFFISFB64_IVFB64_IV_OKFB64_IV_BADFB64_CHALLENGEFB64_RESPONSEUNKNOWNUNKNOWNUNKNOWNNTLM_AUTHAUTHSTARTNTLM_CHALLENGEREJECTNTLM_RESPONSEACCEPTNTLM_ACCEPTCHALLENGERESPONSEREJECTNTLM_REJECTRESPONSEFORWARDFORWARDFORWARD_ACCEPTFORWARD_ACCEPTFORWARD_REJECTFORWARD_REJECTEXPPARAMSONSTOPSEND%s %s SUPPORTFOLLOWSSENDRESTART-ANYREQ-STARTINFOREPLYNTLM_AUTHAUTHNTLM_CHALLENGEREJECTNTLM_RESPONSEACCEPTNTLM_ACCEPTCHALLENGERESPONSENTLM_REJECTRESPONSEFORWARDFORWARDFORWARD_ACCEPTFORWARD_ACCEPTFORWARD_REJECTFORWARD_REJECTEXPPARAMSREPLYFB64_IVFB64_IV_OKFB64_IV_BADFB64_CHALLENGEFB64_RESPONSERESTART-XONREQ-STOPNAMESTARTSOPENDREQUEST-STARTREQUEST-ENDENC-KEYIDRESP-STARTDEC-KEYIDRESP-STOPTELNET RCVD SB %s %s %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sUNKNOWN %s%02X " %s%c"" SE IAC DONT IAC SEtn_doop bad callTELNET RCVD UNKNOWN (%d)tn_doop discovered a Telnet commandttnproto = NP_TELNETTELNET RCVD %sSAKUNKNOWN[Yes] TELNET RCVD %s %sSAKUNKNOWNUNKNOWN%cUSERLINES=%dCOLUMNS=%dPeer refuses TELNET DO %s negotiations - terminating connectionUNKNOWN%s tn_doopwhattn_doopservertn_doopautodltn_doopinautodltn_doopcmdadltn_doop arming SIGWINCHPeer refuses TELNET WILL %s negotiations - terminating connectionUNKNOWN%s unknown telnet subnegotiationtelnet option not negotiatedTELNET WILL %s (implied by receipt of SB - protocol error ignored)UNKNOWNTELNET DO %s (implied by receipt of SB - protocol error ignored)UNKNOWNTERMTERM=%sTELNET SB XDISPLOC IStn_doop NAWS SBwidthtn_doop NAWS SBheightLINES=%dCOLUMNS=%dtn_doop NEW-ENV SB IStn_doop NEW-ENV SB INFOTELNET Send-Locationtn_rnenv varnametn_rnenv valueUSERtn_snenv sb[]tn_snenv uidbuftn_snenv localuidbuftn_snenv tn_env_sysUSERJOBACCTPRINTERSYSTEMTYPEDISPLAYTELNET Subnegotiation error - VALUE in SENDTELNET Subnegotiation error - VALUE in SENDTELNET Subnegotiation error - malloc failedTELNET Subnegotiation error - malloc failedUSERJOBACCTPRINTERSYSTEMTYPEDISPLAYUSERUSERJOBJOBACCTACCTPRINTERPRINTERSYSTEMTYPESYSTEMTYPEDISPLAYDISPLAYTELNET Subnegotiation error - VALUE in SENDTELNET Subnegotiation error - VALUE in SENDtn_sttyptn_sttyp no term overrideTERMUNKNOWNTELNET SENT SB %s IS %s IAC SE%s:0.0tn_sxdisplocTELNET SENT SB %s IS %s IAC SETELNET SENT SB %s %s IAC SETELNET SENT SB NAWS %d %d IAC SEzz{{ {{{{ {${({,{0{4{8{<{@{H{P{T{\{`{h{p{t{{{{{{{{{{{{{{|| ||,|4|D|T|d|t||||||||||||}}}}$},}@}T}h}t}|}}}}}8<HT`lx~~~~~~~~~~~~$@\tLpLL|,hH|P# !"$'(+-.03569:RetransmissionRESEND PKT NOT IN WINDOWRESEND kresend pktinfo index retry(resend)resend ttol msecresend ttol returns(resend)errpktProtocol Error:errpkt drainingDraining incoming packets, wait...Drain complete.GET Packet Internal Error 1sopkt NULL listsopktsopkt encstrsopkt overflowGET Packet Too Long for Serversopkt leftoversopkt fieldGET Packet Internal Error 8@ sopkt o->opktitemsopkt datasopkt opktcntGET Packet Internal Error 9sopkt pktnumsopkt spackSend Packet Failuresopkt rcsrinit recursivesrinit regetsrinit retrievesrinit opktsrinit ooptssrinit omodesrinit cmargGET with no filenamesrinit null cmargGET Packet Internal Error 2srinit malloc fail O1Ox%dGET Packet Internal Error 3srinit malloc fail O2GET Packet Internal Error 4srinit malloc fail M1Mx%dGET Packet Internal Error 5srinit malloc fail O2GET Packet Too Long for ServerGET Packet Internal Error 6srinit malloc fail F1GET Packet Internal Error 7srinit malloc fail F2GET Packet Too Long for ServerSend Packet Failurekstartch == LFkstartch = CRkstart SOPkstart EOLkstart EOP chkspktkstart ksbufkstartp - ksbuf >= 94kstartp - ksbuf >= 94B00zstart Zmodem SOPZmodem downloadreceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermitrpack pktnumrpack ksbufautodownload parityautodownload parchkrpack timintrpack rcvtimorpack streamingrpack timint 0 but rcvtimorpack ttinl lenrpack ttinl msecrpack: ttinl failsrpack ^C serverrpack ^C en_finBad packet headerrpack packet length less than 3Bad packet lengthrpack bad sequence numberBad sequence numberrpack echorpack bctlrpack chklenpacket too longrpack block check Bchecked charsblock check (1)should be (1)Checksum errorchecked charsblock check (2)should be (2)Checksum errorchecked charsblock check (3)should be (3)CRC errorbad type B block checkChecksum error(crunched)rpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d- tstats xfsecststats filcnttstats fpxfsecststats fptsecsTransaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate elapsed time (seconds) effective data rate fstats tfcfstats whatfstats epktmsg complete, sizeZZckmkdir 1 fc%s: no name givenmkdirrmdirckmkdir 2+UNIXOROSKckmkdir 3ckmkdir 4ckmkdir rcDirectory %s not implemented in this version of C-Kermitcreationremoval%s %s: %s%s: removedinibufs sinibufs rini_pkts: no memory for s_pktini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmksbuf makebuf returnmkrbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf packetgetsbuf pgetsbuf data == NULLgetrbuf new rbufnumfreesbuf sseqtbl[n]freerbuf no such slotfreerbuf packetfreerbuf rbufnumfreerpkt seqchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...free: %d, winlo: %d sattr flagsattr zsattrsattr init max%ld%ld%dsattr@sattr numsetsattr leftsattr sendingdsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsize23456789:;<=>name@hpx€ˆ˜¤°¸ $(,048<@DL nameunknownrsattrrsattr refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgtattr: no memory for dsbufgattr file typegattr binary refused: typegattr attribute A = textgattr attribute B = binary refused: dategattr encodingI196I190I6/204I6/100gattr xfer charset lookupgattr: xfer charset unknown refused: character setgattr switch tcharsetgattr fcharsetgattr switch fcharsetgattr unk encoding attribute refused: encodinggtattr: no memory for dsbuf refused: bad disposition refused: mail disabled refused: print disabledgattr RESENDgattr: no memory for spbufgattr length refused: length bytes refused: length K%ldgattr fsizegattr RESENDN+gattr RESEND not binary%ldgattr RESEND OKN?gattr returninitattr ofpermsAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopena xflgopena remfileopena remappdopena dispopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text file character-set: xfer character-set: opena charsetCan't open output fileFailure to openError:opena erroropenc zxcmdcanned: cxseen czseenopeni nameopeni sndsrcopeni file numberaccess deniedopeni CD disabledAccess deniedCommand or pipe failureopeni pipesend zxcmdopeni zopeni 1openi zopeni 2Can't open fileopeni failedopeni messageopeno stdouf zopenoopeno: name open cancelledopeno pipesendopeno zxcmdauthorization failureopeno CD disabledopeno failedopeno ok, nameopent zopenockopenx fsizeclsif i_isopenclsif zcloseclsif successclsif xferstatclsif fsizeclsif ffcclsif cxseenclsif czseenclsif discardInterruptedRefused: %sclsif fstatsIncompleteclsof dispclsof cxseenclsof successclsof o_isopenFailure to closeCan't close fileCan't close fileclsof incomplete discarded incomplete: discardedDiscardedclsof fstats 1closf incomplete kept incomplete: keptIncompleteclsof fstats 2ZZllC-Kermit functions, 7.0.175, 1 Aug 1999DisabledLocal onlyRemote onlyEnabledError receiving filerenamereplacebackupappenddiscardaskupdatexπψϐϘϠϤϬSERIOUS ERROR: encstr data == NULLencstrencstr memptr 1encstr spsizencstr memptr 2encstr string too bigencstr getpkt rcputfilputfil zchout write error, setting czseenBDECODEbdecode write error - errnoxpnbyte UTF-8 conversion errorxpnbyte ucxpnbyte impossible combinationDECODEdecode write errnomaxdata spsiz 1maxdata spsiz 2maxdata len 1maxdata len 2SERIOUS ERROR: bgetpkt data == NULLbgetpkt bufmaxbgetpkt timeout sizebgetpkt: input errorbgetpkt empty filebgetpkt timeout sizexgnbyte UCS-2 BOM%04xxgnbyte UCS-2xgnbyte UTF-8 input error%04xxgnbyte UTF8->UTF2xgnbyte zminchar 1xgnbyte thischarxgnbyte xx rcxgnbyte xx ucxgnbyte decoding errorxgnbyte ucs2_to_utf8 errorxgnbyte UTF8 xlacountxgnbyte UCS2 xlacountxgnbyte called with XLA_JAPANxgnbyte switch failureSERIOUS ERROR: getpkt data == NULLgetpkt first rtgetpkt zkanji: input errorgetpkt zkanji: empty string/filegetpkt: empty stringgetpkt funcstrgetpkt xgnbytegetpkt zminchar Agetpkt zminchar Bgetpkt timeout sizegetpkt: input errorgetpkt empty filegetpkt 1st chargetpkt eof crc16getpkt eof ffcgetpkt nleftxgnbyte B xgnbytexgnbyte B zmincharxgnbyte C zminchargetpkt timeout sizegetpkt EOPgetpkt leftovergetpkt osizegetpkt eof/eottinit timinttinit spsiztinit winlotinit getsbufpktinit winloTransaction beginsGlobal file mode:binarytextCollision action:resetc fsizefnlist: no memory for cmargbuffnlist nfilsfnlist cmargfnlist cmarg2stdinCalibrationsinit xpsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamTransaction beginsGlobal file mode:binarytextsinit oksipkt pktnumsipkt ksipkt getsbufxsinit krcvfil rdatapCALIBRATENONAMEAccess deniedrcvfil rcvexceptrcvfil skippingException listrcvfil discard refused: exception listrcvfil cmarg2rcvfil srvcmd 2rcvfil access deniedWrite access deniedrcvfil srvcmd 1Receiving!%srcvfil pipesendrcvfil rcvfilter rcvfile pipesend filterrcvfil pipename?Sorry, receive filter + filename too long, %d max. Name too longrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil permsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2rcvfil discard refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil ofpermsrcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure. path created:rcvfilx: nrcvfilx: ofn1rcvfil fpfsecsreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof successreof closf moving received file toreof MOVE zrenamereof RENAME zrename renaming received file toreof returnssfile xsfile send filter sfile cmarg2sfile binary 1sfile wearealikesfile xfermodesfile tcharsetsfile binary 2sfile sendmodesfile pktnamsfile fnspathsfile fncnvsfile calibratesfile pipesendsfile sndfiltersfile xpathsfile xfncnvFILE%02ldsfile filnam 1sfile pktnam 1sfile pipesend filtersfile pipename?Sorry, send filter + filename too long, %d max. sfile filnam 2sfile pktnam 2sfile error - Recover vs TextRecovery attempted in TEXT mode: %ssfile X packetsfile binarysfile qSending as mode: binary mode: text file character set xfer character settransparent xfer character setSending from:SFILE fpfsecsSFILE fsecssdata entry, firstsdata drainsdata draining, winlosdata sbufnumsdata countdownsdata nxtpktsdata packetsdata cx/zseen, drainsdata spsizsdata binarysdata paritysdata eof, drainsdata pktnumsdata lensdata datasdata ttchkseof can't get s-buffersxeof nxtpkt failssxeof packetseot nxtpktrpar max 1rpar sprmlenrpar max 2rpar 8bq sqrpar 8bq ebqrparspar biggest 1spar rprmlenrpar biggest 2spar packetspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar setting parity to spacespar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar lscapuspar yspar lpcapuspar lp lenspar slow-start spsizspar lp spmaxspar windowspar window after adjustmentspar windowspar no windowsspar sending, redefine spmaxspar biggestspar whatruspar streamokspar clearrqspar urclearspar sysindex xspar sysindex yspar sysindex biggestspar whoareyouspar sysindexspar whatru2 xfermodeRemote system type: proto whoareuD7proto special VMS prefixinggnfile sndsrcgnfile filcntgnfile whatgnfile binary = gnf_binarygnfile pipesendCALIBRATIONTransaction cancelledgnfile czseengnfile filefile EOFgnfile filefile filnamgnfile nfils?Internal error expanding ADD list gnfile addlist filnamgnfile cmlist filnamgnfile ngetpathgnfile getpathgnfile absolute.gnfile wildgnfile nzxpandgnfile znextgnfile donegnfile znextgnfile setting sndsrc backgnfile skipping:not sentSkippedRead access deniedSkipped DisabledDisabledEnabledEnabled`lxClient Command Status Description REMOTE LOGIN required GET %-14s%s Transfer file(s) from server to client. SEND %-14s%s Transfer file(s) from client to server. MAIL %-14s%s Send file(s) as e-mail. REMOTE ASSIGN %-14s%s Assign value to server variable or macro. REMOTE CD %-14s%s Change server's directory. REMOTE COPY %-14s%s Copy a file on the server. REMOTE DELETE %-14s%s Delete a file on the server. REMOTE DIRECTORY %-14s%s List files on the server. REMOTE EXIT %-14s%s Exit from Kermit server program. REMOTE HOST %-14s%s Execute a shell command on the server. REMOTE PRINT %-14s%s Send a file to the server for printing. REMOTE QUERY %-14s%s Get value of server variable or macro. REMOTE MKDIR %-14s%s Create a directory on the server. REMOTE RMDIR %-14s%s Remove a directory on the server. REMOTE RENAME %-14s%s Rename a file on the server. REMOTE SET %-14s%s Set a parameter on the server REMOTE SPACE %-14s%s Inquire about disk space on the server. REMOTE TYPE %-14s%s Display a server file on your screen. REMOTE WHO %-14s%s List who is logged in to the server. FINISH %-14s%s Exit from Kermit server program.Return the server to its command prompt. BYE %-14s%s Log the server out and disconnect.REMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) typenxtdir funcnxtnxtdir funclennxtdir funcbufnxtdir return 1*.~[0-9]*~nxtdir ckmatchnxtdir zgetfsnxtdir zcfdat0000-00-00 00:00:00domydir permsnxtdir linkname%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s -> %10ld %s %s%s%s -> %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiesssnxtdir funclennxtdir return 2snddirsnddir name./*snddir name 1snddir name 2Listing files: %s%s%s*/*snddir directorysnddir nzxpand nxpndDIRECTORY %sDIRECTORYsnddirsinit() %10s: %s%sskipping %10s: %s%sdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sssDeleting "%s"%sREMOTE DELETEDirectory requested: cwdChanged directory toChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremsetremset xfer charset lookupREMOTE SET xfermodeadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new lenwhoarewe xfermodewhoarewe g_xfermodewhoarewe remote sysidL3N3whoarewe wearealikewhoarewe setting fncnvwhoarewe setting binary(\v(dir)) C-Kermit>(\v(dir)) IKSD>set parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1set win 30, set rec pack 4000, set prefix cautiousset win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all_assign _for\v(cmdlevel) { _getargs,define \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:default,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)successtimeoutinterruptedinternal errori/o error 8 @ H T d/usr/local/doc//usr/share/lib//usr/share/doc//usr/local/lib//usr/local/share//usr/local/share/doc//usr/local/share/lib//usr/doc//opt//doc/          ( 0K_INFO_DIRECTORYK_INFO_DIR/%s%sckermit2.txt%s%sckermit2.txtk_info_dir 1%skermit/%sckermit2.txt%skermit/k_info_dir 2%s/%ld75/1200.5cmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for xquietcmdini: no memory for kermrccmdini: no memory for apcbufcmdini: no memory for linecmdini: no memory for tmpbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_xif_while_switx\&@[%d]\&_[%d]\&@[%d]=--+\%0\%0XXX a_dim[0]doinit rcflagdoinit isguest/doinit ini file isrdoinit open ok?%s - %s rdoiksdinit file okdoiksdinit open failedgetncm dest lengthnext cmdgetncm eom%s getncm returns ptr todomac entry maclvldomac loop maclvl 1domac loop maclvl 2domac loop exit maclvlgetnctgetnct malloc failuregetnct fgets EOFgetnct fgets ok%3d. %sgetnct terminatorgetnct bad lineWarning: Last line of %s lacks terminator command filedirectory filegetnct igetnct lp2getnct comment trimmedgetnct command too long?Line too long, maximum length: %d. getnct first chargetnct last chargetnct next-to-last chargetnct bcgetnct continuedgetnct return %2d. File : %s (line %d) _forxFOR_xifXIF_whileWHILE_switxSWITCH %2d. Macro : %s 00. ERROR : Command source unknown %2d. Prompt: (top level) parser tmpdir restoring&parser entry maclvl&parser entry inlevel&parser entry tlevel&parser entry cmdlvl&parser entry m ************************* SEND-class command failed. Packets sent: %d Retransmissions: %d Timeouts: %d Transfer canceled by receiver. Receiver's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: s do does . Did you start a Kermit receiver on the far end? . Try changing the remote Kermit's FLOW-CONTROL setting. . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET PREFIXING ALL. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET PARITY SPACE. . %sive a ROBUST command and try again. As a last resort, gGAlso: . Be sure the source file has read permission. . Be sure the target directory has write permission. (Use SET HINTS OFF to suppress future hints.) ************************* ************************* RECEIVE- or GET-class command failed. Packets received: %d Damaged packets: %d Timeouts: %d Packet length: %d Transfer canceled by sender. Sender's message: "%s" Most recent local error: "%s" HINTS... If the preceding error message%s not explain the failure: s do does . Did you start a Kermit sender on the far end? . Choose a different FLOW-CONTROL setting and try again. . Try smaller packets (SET RECEIVE PACKET-LENGH). . Try a smaller window size (SET WINDOW). . Give me a SET FLOW XON/XOFF command and try again. . Give me a SET FLOW NONE command and try again. . Try it again with SET STREAMING OFF. . Try it again with SET RELIABLE OFF. . Try it again with SET PARITY SPACE. . As a last resort, give a ROBUST command and try again. . Give a ROBUST command and try again. Also: . Be sure the target directory has write permission. . Try telling sender to SET PREFIXING ALL. . Try giving a ROBUST command to the sender. (Use SET HINTS OFF to suppress future hints.) ************************* parse topparser tlevelparser cmd_rowsCommand file terminated by error. Command error: macro terminated. parser macroparser maclvlcmdbuf from macro?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersparser top of while loopCommandtop-level cmkey2top-level cmkey token ?Invalid - "%s" Command stack: docmd returnscmdbufatmbuf?Invalid: %s top-level cmkey failedKermit command error in background execution%sCommand stack: parser preparing to continueparser breaks out of while loopxxout obsizexxout pacingxxout stringfreelocal levelVariable name(s)\fcontents(%s)\fdefinition(%s)dolocal tmpbufdolocal line?Failure to allocate storage for local variables?Failure to allocate storage for local variablesdooutput s?Connection %s %s is not open. toon?OUTPUT initialization error dooutputOUTPUT NULOUTPUT BREAKOUTPUT Long BREAKOUTPUT CMDQdooutput ?OUTPUT execution error herald%s, for%s Copyright (C) 1985, 1999, Trustees of Columbia University in the City of New York. AUTOMATICDefault file-transfer mode is %s Type ? or HELP for help. TEXTtextBINARYbinary>>> %s: "%s" >>> %s: (undef) addmmac lineaddmmac linesaddmmac loop exitaddmmac length?addmmac malloc error: %s addmmac malloc erroraddmmac constructed stringaddmmac length mismatch !addmmac internal error! addmac namaddmac def(null pointer)addmac def?addmac malloc error 2 addmac numeric global maclvladdmac macro arg maclvladdmac globaladdmac arrayaddmac macro error 7: %s addmac array valaddmac macro defaddmac isaaaddmac table sizeaddmac table overflow?Macro table overflow addmac position?addmac malloc error 3: %s ?addmac malloc error 5: %s delmac namdelmac defdelmac def(null pointer)delmac defdelmac def(null pointer)delmac isaadelmac mlookpopclvl cmdlvlpopclvl tlevelpopclvl maclvl_xif_for_swi_whipopclvl mac new maclvlpopclvl mac mrval[maclvl+1][%d] -F: "%s" [%d] -M: "%s" ?Debugging log wasn't open Debug Log Closed?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open Transaction Log Closed?Connection log wasn't open ?Unexpected log designator - %d onoffoffonautomatic(unknown) Key code \%d => String: \{27}[\{%d} String: \{27}[%c String: \{27}\{%d} String: \{27}%c String: Character: \%u%c \%u (self, no translation) \{%d}%c Versions: %s Numeric: %ld Built for: %s Running on: %s %s %s %s Patches: %s (none) %s for%s %s %s for%s %s %s %s %s %s %s %s %s %s %s %s %s Terminal character-set: transparent %s (remote) %s (local) asciilatin1-isolatin2-isocyrillic-isojapanese-euchebrew-isogreek-isolatin9-isotransparent (via %s) Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminal bitsTERM %19s: %-13s %13s: %-15s Type(unknown)Print %19s: %-13s %13s: %-15s EcholocalremoteLocking-shift %19s: %-13s %13s: %-15s Newline-modeCr-displaycrlfnormalonoffunchecked %19s: %-13s %13s: %-15s APCAutodownloadonoff %19s: %-13d %13s: %-15d HeightWidth %19s: %-13s %13s: %-15s DebugSession log(none) CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL %19s: %-13s Suspend Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: %s Set file type: %s Set file patterns: %s Maximum patterns allowed: %d File binary-patterns: File text-patterns: (none) {%s} %s Output pacing: %d (milliseconds) Output special-escapes: %s Input autodownload: %s Input cancellation: %s Input case: %s observeignore Input buffer-length: %d Input echo: %s Input silence: %d (seconds) Input timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Array name?Bad array: %s Array not declared: %s Dimension = %d %3d. %s Declared arrays: \&%c[%d] No arrays declared Press key: ?Error reading key Macro namePattern%s - not found Macros: %d Function: Status: GET %s SEND %s MAIL %s PRINT %s REMOTE ASSIGN %s REMOTE CD/CWD %s REMOTE COPY %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE QUERY %s REMOTE MKDIR %s REMOTE RMDIR %s REMOTE RENAME %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s EXIT %s ENABLE %s Server timeout: %d Server idle-timeout: %d Server keepalive %s Server cd-message %s Server cd-message %s Server display: %s Server login: (none) "%s", "%s", "%s" Server get-path: (none) %d. %s %s SUCCESSFAILUREVariable name or pattern* The following functions are available: \F() HELP FUNCTION gives the calling conventions of the given function. \v(%s) = \{%d} \{%d} %s %s Global variables: \%%%c No variables defined Macro arguments at level %d (\v(argc) = %d): (NULL)(NULL) \%%%d = %s \&_[%d] = %s Top-level arguments (\v(argc) = %d): (NULL)(NULL) \%%%d = %s \&_[%d] = %s Type SHOW DIAL to see DIAL-related items. Type SHOW MODEM to see modem-related items. Command quoting: %s Take echo: %s Take error: %s Macro echo: %s Macro error: %s Quiet: %s Function diagnostics: %s Function error: %s Script echo: %s Command buffer length: %d Atom buffer length: %d File type: %s binarytext See SHOW CHARACTER-SETS for character-set info Terminal echo: %s localremote Transmit EOF: (none) ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: (none) Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: (none) Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d millisecond%s s Transmit Timeout: %d second%s s %s Escape character: Ctrl-%c (ASCII %d, %s): %s DEL, speed: unknown75/1200%ldoffonautounknown, carrier: %s, timeout: %d sec, timeout: none Type SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Unknown-Char-Set: %s KeepDiscard Exit warning %s onalwaysoff Exit on-disconnect: %s Current exit status: %d Printer: %s%s | (default) Command autodownload: %s Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s Command interruption: %s Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Hints: %s Quiet: %s Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Suspend: %s Alarm at %s %s (no alarm set) send-list is empty (none)%s, mode: %s, alias: %s EDITOR editor: %s (none) options: %s (none) file: %s (none) BROWSER browser: %s (none) options: %s (none) url: %s (none) Triggers: (none) Triggers: "%s" Most recent trigger encountered: "%s" (none) Debug log: %s (none) Packet log: %s (none) Session log: %s (none) Transaction log: %s (%s)ftpverbosebrief (separator='%c') Transaction log: (none) Connection log: %s (none) Reliable: %s Clearchannel: %s Streaming: %s Streaming will be done if requested. Streaming will not be requested and will not be done. Streaming will be requested and will be done if the other Kermit agrees. Last transfer: %sstreaming%s, %ld cps. no , clearchannel ftp-client: %s (none) ftp options: %s (none) --nointerrupts --bannerfile=%s (null) --cdfile:%s (null) --cdmessage:%d --helpfile:%d --syslog:%d --wtmplog:%d --wtmpfile=%s (null) --anonymous:%d --permission:%04o --initfile:%s (null) --userfile:%s (null) --root:%s (null) --xferlog=%d --xferfile=%s (null) --timeout=%d IKSD conf=%s CDPATH(none) current directory: %s previous directory: %s (none) cd path: %s cd message: %s server cd-message: %s cd message file: %s (none) Nothing to show... Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s Protection: %s shomac s1shomac s2 %s = (null definition)%c%c%c%c%c%c%cinvalid digit '%c' in number Invalid character '%c' in input ?Divide by zero +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s arraynam sx?Array dimension or subscript missing or not numeric ?Array dimension or subscript not positive or zero pusharray xpusharray zpusharray y?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s parsevar arraynam?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)dodo maclvldodo flagsdodo maclvl too deepMacros nested too deeply do macrododo cmdlvl too deep?TAKE files and DO commands nested too deeply dodo mrvaldodo clearing mrvaldo macro%0[%d] +M: "%s" Dt\flit(litcmdxwordsSHIFT countSHIFT topargcSHIFT count 2SHIFT levelSHIFT macargc[level]SHIFT bufCarriage return for home directory, or name of directory on this computerCDPATHdocd%s prtopt hposprtopt cmd_cols %s %sIFDEBUGTLOGBIGBUFOKINPBUFSIZ=%dINBUFSIZE=%dOBUFSIZE=%dXFRCANPIPESENDCK_SPEEDCK_FASTCK_APCCK_AUTODLCK_MKDIRWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dCKMAXOPEN=%dZ_MAXCHAN=%dOPEN_MAX=%d_POSIX_OPEN_MAX=%dckmaxfiles=%dz_maxchan=%dFOPEN_MAX=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dUIDBUFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMAXWLD=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXDIRENTRENAMECK_TMPDIRCK_PERMSTIMEHSYSTIMEHCK_TTYFDNETCONNTCPSOCKETCK_DNS_SRVSOL_SOCKETTDP_NODELAYNETCMDCK_ENVIRONMENTTNCODETTLEBUFIKS_OPTIONCONGSPDSELECTNOSETBUFPATTERNSCKEXECNOKVERBSAIXRSATTSVSVR3SVR4_POSIX_SOURCE_XOPEN_SOURCE_ALL_SOURCE_AIX_IBMR2_ANSI_C_SOURCECK_ANSICCK_ANSILIBS_SC_JOB_CONTROL_POSIX_JOB_CONTROLSIG_VUSE_MEMCPYUSE_LSTATCK_CURSESCK_WREFRESHCK_PCT_BARCK_RTSCTSHWPARITYCK_TTGWSIZCK_NAWSDCMDBUFCK_RECALLBROWSERCLSOPNCK_TIMERSTTSPDLISTCK_PERMSCKTUNINGSTREAMINGUNPREFIXZEROCKREGEXZXREWINDCKSYSLOGGFTIMERCKFLOAT=%sdoubleinitoptlist noptlistshofea NOPTLISTshofea noptlist%s Major optional features included: Network support (type SHOW NET for further info) Telnet Kermit Option Hardware flow control External XYZMODEM protocol support Latin-1 (West European) character-set translation Latin-2 (East European) character-set translation Cyrillic (Russian, Ukrainian, etc) character-set translation Greek character-set translation Hebrew character-set translation Unicode character-set translation Kanji (Japanese) character-set translation REDIRECT command RESEND command Fullscreen file transfer display Control-character unprefixing Streaming Major optional features not included: No Kerberos(TM) authentication No SRP(TM) (Secure Remote Password) protocol No Secure Sockets Layer (SSL) protocol No Transport Layer Security (TLS) protocol No encryption None Host info: Machine: %s (unknown) Model: %s (unknown) OS: %s (unknown) OS Release: %s (unknown) OS Version: %s (unknown) Compiled %s %s, options: Aug 4 199909:43:46sizeofs: int=%dlong=%dshort=%dchar=%dchar*=%dLONG_MAX=%dfloat=%ddouble=%dCommand package 7.0.114, 16 Jul 1999Command? /%s%s:%s %s%s%s ?Memory allocation failure ?Name too long - %s %s %s%s%s prompt sxprompt sy %spushcmd: savbuf:fatal error: unable to allocate command buffers&cmpushcmpush: no memory for cmp&cmpop&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zp 1cmnum zp 2cmnum 2nd chknum okcmnum xxesc 2 okcmnum exp eval okOutput filecmofi cmfld returnscmofi 1.5cmofi 2?Name too long cmofi 3?Wildcards not allowed - %s cmofi 4cmofi 5: is directory/dev/ttycmofi 6: failure?Write permission denied - %s cmofi 7: okcmifi2 path?Default name too long cmifi gtwordcmifi switch xCommand or field too long Expanded name too long cmifi tilde_expand?cmifi: malloc error cmifi svcmifi itsadir...cmifi y itsadircmifi *xp pre-zxpandcmifi y nzxpandcmifi y atmbufcmifi diractive catch-all zxpandcmifi sv wild?Wildcard matches more than one directory ./cmifip add path?No %s match - %s directoriesfiles?Too many %s match - %s directoriesfilescmifi sv not wildcmifi nfiles?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s Default name too long %cExpanded name too long .. .%ccmifi nzxpandcmifi filbuf?No %s match - %s directoriesfiles%c?Too many %s match - %s directoriesfilescmifi partialcmifi partial k%scmifi partial cmdbuf?Partial name too long cmifi partial atmbuf%ccmifi unique%c%s?Directory name too long cmifi directory atmbuf%s ?Completed name too long ?Not a directory - %s Directory name Input file specification %s?Expanded name too long cmifi ? *xp, cccmifi ? wildcmifi matchdot: %s %s%s?No %s match - %s directoriesfiles?Too many %s match - %s directoriesfiles, one of the following: %s%scmfld xdef 1cmfld xdef 2?Default too long cmfld atmbuf 1cmfld: gtwordcmfld xCommand or field too long cmfld 1?Default too long cmfld 2cmfld zzstringValue too long cmfld 3?Default too long cmfld returns%s ?Default too long %c Please complete this field %s %s%scmtxt, cmflgscmtxt: fresh startcmtxt:?Timed out cmtxt gtwordcmtxt x?Timed out Command or field too long cmtxt calling (*f)cmtxt (*f) returns%s %c%c%s cmtxt: addbuf Text string %s %s%s?Unexpected return code from gtword() - %d ?Keyword table missing cmkey: pmsgcmkey: cmflgs?Default too long cmkey table lengthcmkey cmflgscmkey zzcmkey cccmkey gtword xcCommand or field too long ?Default too long cmkey atxbuf after *fEvaluated keyword too long %c?Not a switch - %s %c?Ambiguous - %s cmkey token:%c?No keywords match - %s cmkey Esc cc%s ?Default too long cmkey: defaultcmkey Esc pmsg%cEvaluated keyword too long cmkey lookup ycmkey lookup zcmkey partial zcmkey partial ncmkey partial jcmkey partial kcmkey partial len%s%c%c%c?No keywords match - "%s" cmkey flgs%c?No keywords match - %s %s:%s cmkey: addbuf?Evaluated keyword too long %c No keywords match One of the following: %s, one of the following: or the name of a macro ("do ?" for a list) or the token %c or one of the tokens: %s %s%s %d - Unexpected return code from gtword cmkey gtword zzaprilaugustdecemberfebruaryjanuaryjulyjunemarchmaynovemberoctoberseptemberdaysmonthsweekswksyearsyrs______$000000cmcvtdatecmcvtdate nowcmcvtdate date too long+-TtYycmcvtdate NEWcmcvtdate offset ncmcvtdate unit startcmcvtdate time pointercmcvtdate unitcmcvtdate lookup failscmcvtdate offset units 00:00:00cmcvtdate days 00:00:00cmcvtdate weeks%04d%02d%s 00:00:00cmcvtdate months%04d%s 00:00:00cmcvtdate yearstoday 00:00:00cmcvtdate todaytomorrow 00:00:00cmcvtdate tomorrowyesterday 00:00:00cmcvtdate yesterday 00:00:00cmcvtdate yyyymmddcmcvtdate yyyymmdd hh:mm:sscmcvtdate yyyymmdd ???cmcvtdate date bad timesepcmcvtdate null ztimecmcvtdate emtpy ztimecmcvtdate fail Acmcvtdate fail Bcmcvtdate fail C%02dcmcvtdate fail Dcmcvtdate fail E%02dcmcvtdate dotime scmcvtdate dotime pcmcvtdate fail K%s%s%02d000000cmcvtdate timesep:cmcvtdate fail Fcmcvtdate fail Fcmcvtdate fail Fcmcvtdate fail Fcmcvtdate time icmcvtdate time fld[0]cmcvtdate time fld[1]cmcvtdate time fld[2]cmcvtdate fail Gcmcvtdate fail Hcmcvtdate fail Icmcvtdate fail Jcmcvtdate yearcmcvtdate monthcmcvtdate xcmcvtdate hhcmcvtdate mmcmcvtdate ss%s%s%02d %02d:%02d:%02dcmcvtdate hourcmcvtdate minutecmcvtdate secondcmcvtdate resultDate and/or timecmdate cmfld rccmdate 1cmdate 2?Evaluated date too long Invalid date or time - "%s" commandOops, command recall error cmcfm: cmflgscmcfm: atmbufCommand or field too long ?Not confirmed - %s %c?Not confirmed - %s Press the Return or Enter key to confirm the command %s%scmfdb in->fcodecmfdb cmnumcmfdb cmoficmfdb cmifi2 xcmfdb cmifi2 ncmfdb cmfldcmfdb cmtxtcmfdb cmkeycmfdb cmcfmcmfdb - unexpected function code?cmfdb - unexpected function code: %d cmfdb xcmfdb cmflgscmfdb crflagcmfdb qmflagcmfdb esflagcmfdb out->nresultcmfdb cmdbuf & crflagcmfdb codecmfdb failure x?Not valid in this position: "%s" ungword cmflgsunungw atmbufgtword brkchargtword brkgtword ungetting from pp?Saved word too long gtword returning atmbufgtword cmdbufgtword bpgtword ppgtword timelimitgtword cgtword echofgtword IACcgtword skipping CRgtword CR to LFgtword LFgtword skiping LFgtword NUL to LFgtword NULgtwordgtword c < 0exitinggtword EOFgtword chargtword echof 2%c?Field too long error 1 gtword too long #1%c?Field too long error 1 gtword too long #1erasinggtword iscontdgtword too long #2?Field too long error 2 gtwordcrflag is set%cgtword too long #3?Too long #3 gtword too long #4?Too long #4 %c%c%c %s%c%c%c %s%s%c%c %s%s%cgtword quote 0gtword quote 1gtword quote 3gtword quote%c?Command too long, maximum length: %d. cmdgetc()pushc%c %c%c%c%c%c O/after/ask/before/dotfiles/except/heading/l/larger-than/list/log/noask/nodotfiles/noheading/nol/nolist/nolog/not-after/not-before/not-since/quiet/simulate/since/smaller-than/verbose/l/list/log/nol/nolist/nolog/quiet/verbose/as-name/binary/calibrate/command/delete/except/filenames/filter/image/move-to/pathnames/quiet/recover/recursive/rename-to/textmmmm mmmmmmmnnn n n, /as-name/binary/calibrate/command/except/filenames/filter/image/move-to/pathnames/protocol/quiet/recursive/rename-to/textnoo o o$o,o8o@oHoTo`olot oo cdctsdsrri=:=::=!read!writeappendreadwrite!!=&&()<<====>>=||andasktimeoutabsolutealarmavailablebackgroundc-kermitcommandcountdefineddirectoryemulationequalerrorexistfailurefalseflagfloatforegroundk-95lgtlltlocalmatchms-kermitnewernotnumericokopenorquietreadableremote-onlystarted-from-dialersuccesstapitruewildwriteable!read-file!write-fileappend-fileconnectioncx-logdebug-logerrorpacket-logread-filescreensession-logtransaction-logwrite-filecryptoencryptionk4k5kerberos4kerberos5krb4krb5ntlmsrpsslVariable name?Variable name required ?Read file not open ?Oops, no READ buffer! read zsinlread addmacPrompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).?Timed out, assuming "No" Please respond Yes or No getc/getk addmac?Timed out Please respond.ASK cmtxt ?Timed out ask addmacVariable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required ?Name too long: "%s" Text to be ignoreddodef parsevar xoperator=Definition of variablexxdef var namexxdef var def?Argument vector array is read-only Definition of array elementxxdef array refxxdef array defText to be ignoredoperator=Definition of macroxxdef macro namexxdef macro defcalling addmac?%s failed ASSIGNDEFINEdncvtError - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sdncvt matchpxx%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sError - No international dialing prefix defined %s%s%s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK rOpening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. Type HELP DIAL for further information. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippeddodial diallccPlease SET HOST first, and then SET MODEM TYPE Sorry, you must SET MODEM TYPE first Sorry, you must SET %s or SET HOST first LINE/dev/null Sorry, you must SET SPEED first timeout (seconds)0Number to dial or entry from dial directoryNumber to dial?Lookup what? %s ?No DIAL command given yet?You must specify a number to dialdodial Lookup: "%s" - not found%s - dialing as given dodial Lookup: fatal error - dialing skipped %s => %s ?Bad phone number Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... Lookup: "%s" - not found %s %d network entr%s found for "%s"%s Lookup:yies:.%3d. %-12s => %-9s %s %s WARNING - No modem signals detected. Is your modem is turned on? If not, use Ctrl-C to interrupt dialing, turn on your modem, then %s.ANSWER againREDIALWARNING - SET FLOW RTS/CTS is in effect but modem's CTS signal is off. Disabling flow control temporarily %s... while waiting for callduring dialing Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number TESTING... Number: "%s" => "%s" Number: "%s" Will redial in %d second%s- press any key to redial immediately. s Ctrl-C to cancel... %c%cdotype zchki failure?Not a regular file: "%s" dotype zopeni failure?Can't open file: "%s" dotype cmd_rowsdotype cmd_cols%s%s%s %s: %d line%s s%s: %d match%s es%s /after/all/array/ascending/backup/before/brief/descending/directories/dotfiles/englishdate/except/files/heading/isodate/larger-than/message/nobackup/nodotfiles/noheading/nomessage/nopage/norecursive/nosort/not-after/not-before/not-since/noxfermode/page/recursive/reverse/since/smaller-than/sort/xfermode/verbose   " (8DT\dp| !#!   , 8 @P Xdp$datenamesize4<DDIRECTORY/DIRECTORIES/ALL/FILES/ALL/VERBOSE/BRIEF/PAGE/NOPAGE/ENGLISHDATE/ISODATE/DOTFILES/NODOTFILES/BACKUP/NOBACKUP/HEADING/NOHEADING/RECURSIVE/NORECURSIVE/XFERMODE/NOXFERMODE/NOSORT /SORT:NAME/SORT:SIZE/SORT:DATE/REVERSE/ASCENDING/NOMESSAGE/MESSAGE:{%s}(no options set)Switch?This switch does not take an argument ?This switch requires an argument Sort keynameMessage to append to each line?This option can not be set File specification; or switchFile specification*domydir cmfdb?This switch does not take an argument ?This switch requires an argument File specification*File specification*File specification*Sort keynameMessage to append to each lineFile size in bytes0?Array name required Array name (a single letter will do)?Array name required ?Array name required ?Bad array name - "%s" ?Bad array name - "%s" File-time?Date-time required Pattern?Pattern required ?Sorry, not implemented yet - "%s" "%s" - not found or not accessible domydir cmifi2domydir directory 1domydir directory 2domydir zxrewind?Array declaration failure ?Empty directory - "%s" ?%s %s match - "%s" NoToo manydirectoriesfiles* Warning: Failure to allocate memory for sorting. * Will proceed without sorting... domydir sort malloc Directory of %s Files: %d domydir zgetfsdomydir itsadirdomydir arraydomydir zcfdat0000-00-00 00:00:00xxx%2d-%s-%4d %02d:%02d:%02dziperm perms%10s%-10s %s %s%-10s %s %s%10s%10ld %s %s%10ld %s %s -> (T) (B) %s?Memory allocation error - try /NOSORT %s %s %ld director%s, %ld file%s, %ld byte%syiesss (%0.2fGB) (%0.2fMB) Arguments for lsDirectory and/or file specificationCK_DIR%s %sDIR?Sorry, not valid for guests ?Sorry, not valid for guests ?Sorry, DISABLE ENABLE can not be undone DELETE/ASK/NOASK/DOTFILES/NODOTFILES/LIST/NOLIST/HEADING/NOHEADING(no options set)Switch?This switch does not take an argument ?This switch requires an argument ?This option can not be set File specification; or switchFile(s) to delete?Does not match switch or filename: "%s" ?This switch does not take an argument ?This switch requires an argument File-time?Date-time required Pattern?Pattern required File size in bytes0?Not implemented yet - "%s" ?A file specification is required ?Sorry, DELETE unavailable to guests dodel tmpbufDeleting %s...%s (SIMULATION) %s (SKIPPED) Delete %s? %s (SELECTED) %s (OK) %s (FAILED) %s (FAILED: directory) %s (FAILED: not regular file) %d file%s %sdeleted, %d byte%s %sfreed%s swould be swould be (maybe)?Can't delete: %s ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _switx SWITCH SWITCH 2series of cases?Unbalanced brackets SWITCH 3_switx_switx_switx?SWITCH macro definition gone! SWITCH commandVariable name?Variable name required _forx initial valuedofor fx%dfinal valuedofor fy%dincrement1dofor fz%dCommand to execute?Unbalanced brackets _forx_forx_forx?FOR macro definition gone! FOR command?Incomplete FOR command Before requesting technical support from Columbia U., please consult: . The book "Using C-Kermit" (type HELP for more info). . The %sckermit2.txt and %sckcbwr.txt files. . The %sckubwr.txt and %sckuins.txt files. . Your own organization's support staff, if any. . The comp.protocols.kermit.* newsgroups if you have Netnews access. . Our FAQ, http://www.columbia.edu/kermit/faq.html, if you have Web access. If you still need help or have a bug to report after consulting these sources, send e-mail to: kermit-support@columbia.edu Or contact us by post: Kermit, Columbia University, 612 W 115 Street, New York NY 10025, USA Or by fax at +1 (212) 663-8202. Telephone support is available too: +1 (900) 555-5595, USA only, $2.50 per minute +1 (212) 854-5126, from anywhere, $25.00 USD per call, MC/Visa Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. tod2sectod2sec t2seconds to wait, or time of day hh:mm:ss1seconds to pause, or time of day hh:mm:ss1milliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. Filename or switch ?Multiple files not allowed - please specify a single file. destination name and/or directory.?Name for destination file required docopy linedocopy p?Wildcards not allowed ?Sorry, replacement of existing files is disabled %s => %s ?Not a regular file - "%s" ?Not found or not accessible - "%s" ?Permission denied ?Source and destination are the same file ?Input/Output error ?Error opening output file - "%s" ?Can't copy %s to %s (OK) Filename or switch ?Multiple files not allowed - please specify a single file. New name?New name for file required dorename linedorename p%s => %s ?Can't rename %s to %s (OK) ?Can't return from level %d RETURN parse_xif_for_swi_whiRETURN poppingRETURN maclvl 2<<< %s: "%s" <<< %s: (null) RETURN maclvl 3RETURN copymode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled ?Read file already open System command to read from?Command name required ?Can't allocate read buffer ?Write to pipe disabled ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedthis commandxget cxRECEIVEGETREGETRETRIEVECRECEIVECGETMGETxget rcvcmdxget konly?Sorry, %s works only with Kermit protocol Optional name/template to store incoming files under, or switchRemote filename, or switchOutput filename or CommandFile(s) to GETRemote filenamexget cmfdb?This switch does not take an argument ?This switch requires an argument xget switch?Sorry, system command access is disabled ?Sorry, no GET /COMMAND when RECEIVE FILTER selected Command, or switchPattern?Pattern required ?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending%s ?Destination required?New name required?Sorry, as-name not allowed with MGET Name to store it underxget /filter getvalFilter program to receive through?Filter must contain a replacement variable for filename. onconvertedFile-transfer protocolxget /proto?Sorry, this command works only with Kermit protocol ?Unexpected switch value - %d xget cmresult fcode?Unexpected function code: %d xget stringxget confirmedxget calling cmtxtLocal command to pipe intoName or directory for incoming filexget cmofixget asnamexget cmargxget cmarg2?A remote file specification is required ?Command required ?Sorry, system command access is disabled ?Sorry, no GET /COMMAND while RECEIVE FILTER selected xget /COMMAND pipesend?A Kermit Server is unavailable to process this command Sorry, you must specify a name when receiving a file with XMODEM protocol xget protocolxget cmarg2doxget /BINARY xfermodedoxget /TEXT xfermodedoxget /IMAGE xfermodexget binaryxget omode?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME xget rcv_renamexget displayxsend fncnvxsend fnrpathxget sstatexget strlen(cmarg2)RECEIVE arg disk or dir?Can't get current directory ?Can't access %s xget fspecxget cmarg2dogta _GETARGS maclvldogta _PUTARGS maclvlgoto cxgoto cmdlvlgoto maclvlgoto tlevelgoto before conversiongoto after conversion?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro goto in macromacro GOTO labelmacro target label:defaultgoto failed at cmdlvl_xif_for_swi_whi?Label '%s' not found goto found macro label:defaultgoto failed at cmdlvl?Label '%s' not found ?Stack problem in GOTO %s ]()Number, numeric-valued variable, Boolean expression, or keywordboolval switchif trueif trueif successif failureMacro or variable nameif defined zzstringif defined zzstring tif defined finalif countDirectory nameFile?File or directory name required if exist 1if directory 1if directory 2first word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long IF EQ resultfirst number or variable name?Quantity required xxifgt cmfldxxifgt exp1countversionargcsecond number or variable name?Quantity required xxifgt exp2countversionargcxxifft ifcxxifft zvariable name or constant?Quantity required xxifnu quantityxxifnu chknumFirst fileSecond file?Failure to get file date xxifnewer d1xxifnewer d2xxifnewerIF ALARM ck_alarmIF ALARM alrm_dateIF ALARM alrm_timeIF ALARM date zIF ALARM time zIF ALARM final zfile or logString or variable?String required xxifma stringPattern?Pattern required xxifma patternFile or directory name?File or directory name required if quietFile specificationWordNumber?Boolean expression too longboolexp parensboolexp pcountboolexp boolvaldoif cxdoif boolexpdoif conditiondoif: pushing command command to be ignoredObject commanddoif THEN part 1doif THEN part 2elsedoif ELSE line 1{ %s }doif ELSE line 2doif ELSE line 3IF condition_xif_xif_xif?XIF macro gone! { \flit(if ( not ) goto _..bot) } WHILE cmdObject commandWHILE body_while_while_while?WHILE macro definition gone! WHILE dodo?Can't allocate storage for WHILE commanddotake filerdotake faildotake cmdlvldotake tleveldotake stack overflow?TAKE files and/or DO commands nested too deeply [%d] +F: "%s" 0123456789ABCDEFSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_lineapcactiveargcargsauthstateauthtypeblockcheckbrowserbrowsoptsbrowsurlcharsetcmdbufsizecmdfilecmdlevelcmdsourcecolsconnectioncountcpscpucrc16cx_timed$acd$ccd$ipd$lcd$lcpd$lpd$pxd$pxxdatedaydialcountdialnumberdialresultdialstatusdialsuffixdialtypedirectorydm_lpdm_spdm_pddm_tddm_wadm_wddm_rcdownloadeditoreditfileeditoptserrnoerrstringescapeevaluateexitstatusf_countf_errorf_maxfileerrorfilemaxfilenamefilenumberfilespecfsizeftypeheraldhomehosthwparityinputincharincountinidirinstatusintimeinwaitipaddresslinelocallockdirlockpidmaclevelmacrominputmodelmodemm_aa_offm_aa_onm_dc_offm_dc_onm_dialm_ec_offm_ec_onm_fc_hwm_fc_nom_fc_swm_hupm_initm_namem_pulsem_sig_cdm_sig_ctsm_sig_dsrm_sig_dtrm_sig_rim_sig_rtsm_tonenamendatendaynewlinentimeosnameosreleaseosversionpacketlenparitypasswordpexitstatpidplatformprinterprogrampromptprotocolp_8bitp_ctlp_rptqueryreturnrowssendlistserialsetlinemsgspeedstartupstatussysidsystemterminaltesttextdirtfsizetftimetimetmpdirtriggerttyfdty_lnty_lcty_lmurluseridversionwindowxferstatusxfermsgxfer_badpacketxfer_timeoutxfer_retransmitxprogramxversion_eof_errmsg_getblock_getchar_getline_handle_line_pos_putblock_putchar_putline_statusaaconvertabsolutearraylookb64decodeb64encodebasenamebreakcacapcapitalizecapscharacterchecksumcodecommandcontentscrc16cvtdatedatedaydayofyeardefinitiondialconvertdimensiondirectoriesdirnamedoydoy2dateerrstringevaluateexecutefileshexifyindexipaddressjdateleftlengthliteralloplowerlpadltrimmaximumminimimmjdmjd2datemodulusn2hexn2octaln2timendaynextfilentimepathnamepermissionsrandomrawcommandrdirectoriesrfilesreprepeatreplacereverserightrindexrpadrsearchsearchsizespansplitstripnstripxsubstringtablelooktimetod2secstrimunhexifyupperverifywordappendnew\v(home){%s}prescan cmdbuf prescan: no memory for kermrc.kermrc=+prescan *yargv+--prescan argExtended argument errorinvalid argument bundlingmissing usernameusername too longdebug.logmissing name in -yprescan kermrcdoconect justone 1 Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. doconect flow Enter Client/Server Mode... Use: REMOTE LOGIN to log in to the server if necessary. SEND and GET for file transfer. REMOTE commands for file management. FINISH to terminate Client/Server mode. BYE to terminate and close connection. REMOTE HELP for additional information. doconect justone 2doconect apcactivedoconect successdoconect justone 3_apc_commandsdoconect about to execute APC_apc_commands_apc_commandsdoconect APC in progressdoconect apcactive after domacdoconect quit APC loop: apcactivedoconect xferstatdoconect quit APC loop: xferstatdoconect justone 4doconect justone 5nonenone?Can't start command: %s ?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... ?Can't transmit character Connection closed. Session Limit exceeded - closing connection. transmit bufCan't send buffer Connection closed. Session Limit exceeded - closing connection. Connection closed. Session Limit exceeded - closing connection. ?Can't open input file %s ?Can't open output file %s %s (%s) => %s (%s) ^C... File output error via %s, language: %s ^C... File output error %s?Anonymous log creation not allowed Name of debugging log filedebug.logName of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.logCX.LOGCX.LOGCX.LOGName of connection log file ?Unknown log designator - %d ?Sorry, %s is a directory name newappendDispositionpktopnpktopn ppktopn pipepktopn seslogtraopntraopn tlogfmttraopn ptraopn pipetraopn tralogTransaction Log:sesopnsesopn psesopn pipesesopn seslogdebopn pdebopn pipedebopn deblogDebug Log uname machineuname model uname sysnameuname releaseuname versiondiaopn logdiaopn fcdiaopn disp 1diaopn disp 2diaopn pdiaopn pipediaopn dialogtextbinaryunknown Transfer Bell: %s Transfer Interruption: %s Transfer Cancellation: %s Transfer Character-set: Transparent %s Transfer CRC-calculation: %s Transfer Display: %s none%s serial%s fullscreen%s crt%s brief Transfer Locking-shift: forced%senableddisabled,%s%s not used Transfer Mode: %s automaticmanual Transfer Pipes: %s Transfer Protocol: %s Transfer Slow-start: %s Connection type: %s Current flow-control: %s Defaults by connection type: shoflow cxtypeshoflow flowshoflow x %-14s: %s %-14s: (%d) Communications Parameters: Host: %s%s (reliable) %s: %s%s, speed: Line (reliable) (closed)unknown75/1200134.5%ld Mode: , mode: localremote, modem: %s, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Meridian Technologies' SuperLAT, sub-process, Named Pipes, telnet protocol (SECURE) Parity: %s%shardware , stop-bits: (default), stop-bits: %d (8%c%d) (7%c%d) (8N%d) D, duplex: %s, halffullshoparp flowflow: %s, handshake: %d none offonautounknown Carrier-watch: %s, timeout: %d sec, timeout: none, close-on-disconnect: %s Lockfile: %s Secondary lockfile: %s Terminal bytesize: %d, escape character: %d (^%c) %20s %12s %12s %12s %12s Telnet OptionMe (client)U (client)Me (server)U (server)%20s UNKNOWN%12s %12s UNKNOWNUNKNOWN%12s %12s UNKNOWNUNKNOWN%20s %12s %12s %12s %12s WILLWONTWILLWONT%20s %12s %12s %12s %12s WILLWONTWILLWONTSET TELNET parameters: echo: %s NVT newline-mode: localremote%s off (cr-nul)%s on (cr-lf)%s raw (cr)%s (lf) kermit: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %sstartedstopped u, n/a me, %s;startedstopped me, n/a; BINARY newline-mode: %s off (cr-nul)%s on (cr-lf)%s raw (cr)%s (lf) binary-mode: u, accepted; u, refused; u, requested; u, required; me, accepted; me, refused; me, requested; me, required; u, %s; me, %s BINARYNVTBINARYNVT bug binary-transfer-mode: %s bug binary-me-means-u-too: %s bug binary-u-means-me-too: %s bug sb-implies-will-do: %s terminal-type: %s TERMnone (%s will be used) none environment: %s location: %s (none) Network directory: %s (none) Network directories: %2d. %s Supported networks: TCP/IP [%s] TCP/IP Active network connection: Host: %s [%s] Host: none, via: tcp/ip SunLink X.25 Stratus VOS X.25 IBM AIX X.25 HP-UX X.25 DECnet LAT DECnet CTERM DECnet Named Pipes NetBIOS SuperLAT sub-process Reverse DNS lookup: %s DNS Service Records lookup: %s Keepalive: %s Linger: %son, off %d x 10 milliseconds no timeout Nodelay: %s Send buffer: (default size) Send buffer: %d bytes Receive buffer: (default size) Receive buffer: %d bytes TELNET protocol Echoing is currently %s localremote Raw TCP socket (none) \\%c\{%d} Dial status: %d = Unknown error = (none) = %s Dial directory: %s (none) Dial directories: %2d. %s Dial method: auto defaultpulse tone Dial sort: %s onoff Dial hangup: %s Dial display: %s on offonoff Dial retries: %-6d Dial interval: %d Dial retries: (auto) Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s (none) Dial confirmation: %s Dial convert-directory: %s on offonaskoff Dial ignore-dialtone: %son off Dial pacing: %d Dial prefix: %s (none) Dial suffix: %s (none) Dial country-code: %-12s(none)Dial connect: %sonautooff %squietverbose Dial area-code: %-12s(none)Dial restrict: international long-distance local none ? Dial lc-area-codes: (none)%s Dial lc-prefix: %s (none) Dial lc-suffix: %s (none) Dial ld-prefix: %s (none) Dial ld-suffix: %s (none) Dial force-long-distance %s Dial intl-prefix: %s (none) Dial intl-suffix: %s (none) Dial toll-free-area-code: (none)%s Dial pulse-countries: (none)%s Dial tone-countries: (none)%s Dial toll-free-prefix: %s (none) Dial pbx-exchange: (none)%s Dial pbx-inside-prefix: %s (none) Dial pbx-outside-prefix: %s (none) Dial macro: %s (none)offabsoluterelativeautounknown Transfer mode: %s automaticmanual File type: %s File patterns: %s (SHOW PATTERNS for list) literalconverted(unknown) File names: %s Send pathnames: %s Receive pathnames: %s Match dot files: %s yesno Wildcard-expansion: %s shellkermit File collision: %s unknown File destination: %s nowhereprinterscreendiskkeep File incomplete: %s File bytesize: %d File character-set: %s File end-of-line: %s cr%s lf%s crlf%d File download-directory: %s (none) Send move-to: %s (none) Send rename-to: %s (none) Receive move-to: %s (none) Receive rename-to: %s (none) Initialization file: %s (none) Kermit doc files: %s Disk output buffer: %d (writes are %s, %s) bufferedunbufferedblockingnonblocking Longest filename: %d Longest pathname: %d Last file sent: %s (none) Last file received: %s (none) Also see: SHOW PROTOCOL, SHOW XFER, SHOW PATTERNS, SHOW STREAMING, SHOW CHARACTER-SETS Protocol: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Cancellation: %s %d %d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Pause: %11d%9d Attributes: %s Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' Packet Length:%11d %8d Repeat Prefix: '%c' Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced%senableddisabled,%s%s not used Auto-upload command (binary): %s (none) Auto-upload command (text): %s (none) Auto-server command: %s (none) Packet timeouts: dynamic %d:%d Packet timeouts: fixed%-31sSend backup: %s Transfer mode: %sautomatic manual Transfer slow-start: %s, crc: %s Transfer pipes: %s on off Transfer character-set: transparent %s Send filter: %s (none) Receive filter: %s (none) Also see: SHOW FILE, SHOW XFER, SHOW PATTERNS, SHOW STREAMING, SHOW CHARACTER-SETS Executed by external commands: SEND command (binary): %s (none) SEND command (text): %s (none) RECEIVE command (binary): %s (none) RECEIVE command (text): %s (none) Autoreceive command (binary): %s (none) Autoreceive command (text): %s (none) Language-specific translation rules: %s none Unknown File Character-Set: %s (%s), 7-bit8-bitmultibyte Transfer Character-Set: Transparent: %s (%s)NoneByteJapaneseUnicode Translation type: %s SEND character-set-selection: %s RECEIVE character-set-selection: %s (Use SHOW ASSOCIATIONS to list automatic character-set selections.) For incoming files: Transfer Character-Set File Character-Set (none)(none) %-25s%s For outbound files: File Character-Set Transfer Character-Set (none)(none) %-25s%s Show what? (Type "show ?" for a list of possiblities.) dostat xferstat No file transfers yet. status : %s FAILURE (interrupted)FAILURESUCCESS crc-16 of file(s) : %ld crc-16 of file(s) : (disabled) reason : %s remote system type : %s files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) control characters : %ld prefixed, %ld unprefixed 8th bit prefixing : yes [%c] no locking shifts : %s yesno window slots used : (streaming) window slots used : %d of %d packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %s (%0.3f sec) transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps (%d%%) effective data rate : %ld cps peak data rate : %ld cps Use STATISTICS /VERBOSE for greater detail. ?Connection %s %s is not open. toondoinput waiting?INPUT initialization error doinput anychardoinput timodoinput echodoinput burstdoinput string %2d_apc_commandsdoinput about to execute APC_apc_commands_apc_commandsdoinput APC in progressinput ttinc(rt) returnsConnection closed. Session Limit exceeded - closing connection. input interrupted from keyboarddoinputabsorbinginput coninc(rt) returns Internet Kermit Service in SERVER mode. Please use REMOTE commands. doinput burstdoinput charcompare chardoinput (y<=-1&&burst>0)burstFatal error - disconnected. input interrupted from keyboarddoinput burstdoinput gtimerburstdoinput timodoinput (burst > 0)burstdoreinput?malloc error 6 doreinp charcompare char;Zx0N<[y1O0-1-1%04d%03d %s%04d%03djzdate len0-1-1jzdate yearjzdate day-1jzdate leapdayjzdate mjzdate d%04d%02d%02d %s%04d%02d%02djzdate jzdbuf%04d%02d%02dfnevalfnevalfneval fndepthfneval argfneval argnflitfneval calling zzstringfneval zzstringfneval zzstringfneval zzstring fails, argfneval argfneval arg post evalfneval evaluated arg fexec pushed too deep ?\fexec() too deeply nested 0%d0%d0%s*1%d%d%d0%d1SUNDAY frepeat nSUNDAY frepeat kSUNDAY frepeat FNVALL%s%ld000%d00 %lu%u00%lx%lo0%lx%dfsplit bp[0]0SPLIT Afsplit bp[1]1SPLIT Bfsplit abuf 1SPLIT CSPLIT Cfsplit abuf 2SPLIT Dfsplit abuf 3fsplit argnfsplit bp[2]fsplit bp[3]fsplit declaringSPLIT Efsplit declared okSPLIT F\&%c[%d]SPLIT Gfsplit do-loop done%dfsplit declaring for realSPLIT Hfsplit declared OKfsplit array xfsplit copy 1..n OKfsplit makestr 0 OKfsplit free OKSPLIT X%d%ld%ld%d%s0%02d:%02d:%02d%s-1%d%d-2-1%dINTERNAL_ERRORARG_TOO_LONGARG_OUT_OF_RANGEaaconvert argn%s<*>aaconvert matchesaaconvert firstaaconvert array 1aaconvert array 2aaconvert oddballaaconvert ERRORaaconvert%daaconvert return%s%d%ld%ld%d%d%dfnendfneval failed?%s ckdate dbufckdate nowbufckdate bad month%02dckdate nowbufckdate nowbuf????%ldnvlook y%d%d%d./unknownUNIX%ld%d%ld%ld%dunknown%ld%dC-Kermit\v(return)%ld%ldrs6000%d%ld10promptmacrofileunknown%dnoneevenmarkoddspaceunknown%d%ldtextbinaryimagelabeledmacbinaryunknown 2480%dTERM%sunknown%dremoteserialtcp/ip_telnettcp/ipsub-processunknown%snone%dTMPDIRTEMPTMP/tmp/%d%d%d%d0%d%d%s%d%ld%dC-KermitEDITORBROWSER.0%d%d%s%s|(default)%d%ld%drejectedNULL%d%d%ld 8%c%d 7%c%d 8N%d%d%d%d%d%d%d%d%d%d%d%d%d%ld?%s ?definition is circular or too deep zzstring failzzstring fail 2zzstring entryzzstring empty argzzstring fail 3zzstring overflow 1zzstring overflow 2xxstring %n vpzzstring fail 6zzstring arraynamzzstring fail 7zzstring chkarrayzzstring a_ptr[vbi]zzstring a_ptr[vbi][d]zzstring ap[d]zzstring fail 8zzstring fail 9zzstring fail 10zzstring function namezzstring function r3zzstring fail 11zzstring function argzzstring fail 12zzstring overflow 3zzstring vnamezzstring overflow 4zzstring overflow 5zzstring overflow 6zzstring ok%s [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -j host network host name[:port] -i binary transfer (-T = text) -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -d log debug info to debug.log -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory If no action command is included, or -S is, enter interactive dialog. Type HELP OPTIONS at the prompt for further info. ,8t<tL,h,t"%s" - %s%s Usage: cmdlin mynamecmdlin telnet hostcmdlin nnetdircmdlin lunet nhcountcmdlin lunet nh_p[0]cmdlin lunet nh_p2[0]cmdlin lunet nh_px[0][0]tcp/ipcmdlin lunet substitution:cmdlin telnet host2:can't open host connectioncan't open host connection+cmdlin cfilef set to 0cmdlin xargv--cmdlin args 1cmdlin doargcmdlin args 2invalid command-line option, type "%s -h" for helpcmdlin whatcmdlin actioncmdlin stdoufcmdlin fatal 1No actions or connections allowed with -ANo actions or connections allowed with -Acmdlin fatal 2-l or -j or -X required-l or -j or -X requiredcmdlin fatal 3-a without -s, -r, or -g-a without -s, -r, or -gcmdlin fatal 4can't change to '-a' directorycan't change to '-a' directorycmdlin fatal 5write access to -a file deniedwrite access to -a file deniedcmdlin fatal 6unredirected -k can only be used in local modeunredirected -k can only be used in local modecmdlin returns actioncmdlin returns actionanonymousbannerfilecdfilecdmessagecdmsghelphelpfileinitfilenointerruptspermissionspermsrootsyslogtimeoutuserfilewtmpfilewtmplogxferfilexferlog0123456789falsenooffokontrueyes48<@DHLPTX \dhlpt|--anonymous:{on,off} [IKSD only]Whether to allow anonymous IKSD logins--bannerfile:File to display upon startup or IKSD login--cdfile:File to display when server changes directory--cdmessage:{on,off}Whether to display CD message file--helpPrint this help text about extended options--helpfile:File containing custom info for HELP command--xferfile: [IKSD only]Name of ftpd-like logfile.--xferlog:{on,off} [IKSD only]Whether to keep an ftpd-like logfile.--initfile: [IKSD only]Initialization file for anonymous users.--permissions: [IKSD only]Permissions for files uploaded by anonymous users.--root: [IKSD only]File-system root for anonymous users.--syslog: [IKSD only]Syslog recording level, 0-6.--userfile: [IKSD only]Forbidden user file.--wtmpfile: [IKSD only]Name of wtmp logfile.--wtmplog:{on,off} [IKSD only]Whether to keep a wtmp logfile.--timeout: [IKSD only]How long to wait for login before closing the connection.--nointerruptsDisable keyboard interrupts.100% transparent CONNECT mode for "in-the-middle" operationConnection is 8-bit cleanC-Kermit is to be started as an Internet serviceC-Kermit is running in Batch (no controlling terminal)Interactive-mode Commands to be executedCommands separated by commas, list in doublequotesDelay before starting to sendNumber of secondsExit automatically when connection closesMake a TCP connectionNumeric file descriptor of open TCP connectionGET from server, send to standard outputRemote file specificationSuppress program startup Herald and greetingConnection is relIable, streaming is allowed'Be like Telnet'IP hostname/address optionally followed by socketRecursive directory descent for files in -s optionMy user name (for use with Telnet, Rlogin, etc)Username stringBe a server for One command onlyQuick (FAST) Kermit protocol settingsRemote-only (makes IF REMOTE true)Stay (enter command parser after action options)Transfer files in Text modeDisable automatic filetype switchingSkip initialization fileAs-name for file(s) in -s, -r, or -gAs-name stringSpeed for serial deviceNumeric Bits per secondCONNECT before transferring filesCreate debug.log fileReceive packet lengthLength in bytesSend Finish command to serverGET file(s)Remote file specificationPrint brief Help (usage) textTransfer files in bInary modeMake a TCP connectionTCP host name/address and optional socket numberRECEIVE file(s) to standard outputMake connection on serial communications deviceDevice name stringModem type for use with -l deviceModem type string as in SET MODEM TYPE commandCONNECT after transferring filesParityOne of the following: even, odd, mark, none, spaceQuiet (suppress most messages)RECEIVE file(s)SEND file(s)One or more file specificationsXON Turnaround character for half-duplex connectionsWindow sizeNumber, 1 to 32Incoming files Write over existing filesBe a Kermit SERVERAlternative initialization fileFile specificationForce foreground behaviordebug.log%s %s doarg entrydoarg argExtended option errorExtended option errorNo commands given for -CNo commands given for -Cinvalid argument bundlinginvalid argument bundlingmissing delay valuemissing delay valuebad delay valuebad delay valueconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -sinvalid argument bundling after -sdoarg pipesend-.No files for -sNo files for -s-s: too many -'s-s: too many -'sinvalid mixture of filenames and '-' in -sinvalid mixture of filenames and '-' in -sdoarg s nfilsdoarg s zsending from terminal not allowedsending from terminal not alloweddoarg s stdinfdoargconflicting actionsconflicting actionsinvalid argument bundling after -ginvalid argument bundling after -gmissing filename for -gmissing filename for -ginvalid argument bundling after -ainvalid argument bundling after -amissing name in -amissing name in -adoarg ainvalid argument bundling after -yinvalid argument bundling after -ymissing filename in -ymissing filename in -yinvalid argument bundling after -l or -jinvalid argument bundling after -l or -jcommunication line device name missingcommunication line device name missing/dev/tty0can't open devicecan't open devicedoarg speed:?Fatal network directory lookup error - %s ::telnet%d entr%s found for "%s"%s yies:.%3d. %s %-12s => %s :Error - network type "%s" not supported can't open host connectioncan't open host connectioninvalid argument bundlinginvalid argument bundlingmissing bpsmissing bpsunsupported transmission rateunsupported transmission rateinvalid argument bundling after -minvalid argument bundling after -mmodem type missingmodem type missingunknown modem typeunknown modem typeinvalid argument bundling after -einvalid argument bundling after -emissing lengthmissing lengthUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing or bad window sizemissing or bad window sizeUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing paritymissing parityinvalid parityinvalid parityinvalid argument bundlinginvalid argument bundlingmissing usernamemissing usernameinvalid argument bundling after -Finvalid argument bundling after -Fnetwork file descriptor missingnetwork file descriptor missinginvalid command-line option, type "kermit -h" for help/connect/server3D3P3X/command/connect/network-type/password/server/userid3 33 3 33/password/userid4 4 4(/default/no-telnet-init/none/raw-socket/telnet4X4d4t4| 44binary-patternsbytesizecharacter-setcollisiondestinationdisplaydownload-directoryend-of-lineeolincompletenamesoutputpatternstext-patternstypewarning44 45 55$5,5@5L5P5\5d5l5x55absolutenoneoffonrelativeabsoluteautononeoffonrelativeasciibinarytextasciibinarytext666blockingbufferednonblockingunbuffered7 77$70globalkermitsystemuser7tG7|K7S7Gdynamicfixed77echoeoffilllinefeedlocking-shiftpauseprompttimeoutappendbackupdiscardno-supersedeoverwriterenameupdatecollisionincompletenamesrecord-lengthtype8| 8888crcrlflfconvertedliteralstandardapcautodownloadbytesizecharacter-setcr-displaydebugechoescape-characterheightlocal-character-setlocking-shiftnewline-modeprintremote-character-settriggertypeunicodewidth9$9(989D9T 9`9h9p 99$99949%9099&9:crlfnormaloffonunchecked::;audiblenoneoffonfixedundefinedthermometerno-thermometer;`;lbriefcrtfullscreennoneoffonquietserial;;;;;;;;packet-lengthtimeoutbackupcharacter-set-selectioncontrol-prefixdouble-characterend-of-packetfilterignore-charactermove-tonegotiation-string-max-lengthpacket-lengthpad-characterpaddingpathnamespausequoterename-tostart-of-packettimeoutattributesblock-checkfileincompletereceiveretryservertransferwindowxferallcharacter-setdatedispositionencodinglengthoffonprotectionpermissionssystem-idtypeautodownloadbuffer-lengthcancellationcasedefault-timeoutechosilencetimeout-actionproceedquitignoreobservedisabledenabledoffononautooffonautosetnum ?Value required %s?Not a number: %s ?Sorry, %d is the maximum Control character, numeric ASCII value, or in ^X notation, or preceded by a backslash and entered literally ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d /case/key/numeric/range/reverse@@$@,@8@@Array name or switchArray name?This switch does not take arguments Column for comparison (1-based)1onlow:high element1?Not numeric: %s ?Unexpected function code: %d ?Array name required Second array to sort according to %sXXX 1XXX 2XXX 3?Bad array name: %s ?Array not declared: %s ?range %d:%d exceeds array dimension %d ?Bad range: %d:%d ?Bad array name: %s ?Array not declared: %s ?Array %s smaller than %s XXX xpXXX xc/after/ask/before/delete/dotfiles/except/heading/keep/larger-than/list/log/noask/nodelete/nodotfiles/noheading/nol/nolist/nolog/nopage/not-after/not-before/not-since/page/quiet/since/simulate/smaller-than/verboseB B BBBBBBB CCC C C,C8CDCLCTC\CdCpC| CCC CC CbkupnumPURGE/ASK/NOASK/DOTFILES/NODOTFILES%s:%d/KEEP/LIST/NOLIST/HEADING/NOHEADING/PAGE/NOPAGE(no options set)Switch?This switch does not take an argument ?This switch requires an argument How many backup files to keep1?Please specify a number between 0 and %d ?This option can not be set Filename or switch?This switch does not take an argument ?This switch requires an argument How many backup files to keep1?Please specify a number between 0 and %d File-time?Date-time required File size in bytes0Pattern?Pattern required ?Not implemented yet - "%s" %s.~[1-9]*~*.~[1-9]*~?File deletion by guests not permitted. Purging %s, keeping %d...%s (SIMULATION) %s (SKIPPED) Delete %s? %s (%s) OKSELECTED %s (FAILED) Matches = %d: Not enough to purge. %s (SKIPPED) dopurge group %s (%s) DELETEDSELECTEDERROR %s (KEPT) %s.~*~ (KEPT) Files purged: %d%s (not really)file transfer display stylethermometerRemote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 character-set in which local text files are encodedasciicrlflocal text-file line terminatorhow to handle filenamesconverted301file record length312type of file transfertext300Filename collision actionbackup?This command not valid for guests 302auto310120Name of local directory, or carriage returndownload dir?Wildcards not allowed in directory name download zfnqfpoutput file writing methodoutput buffer size32768?Bad size - %d MEMORY ALLOCATION ERROR - FATAL Pattern?unexpected file parameter Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. bytesize for terminal connection8 ?The choices are 7 and 8 remote terminal character-setlocal character-set?UTF8 may not be used as a local character set. local character-set?UTF8 may not be used as a local character set. remote terminal character-setwhich side echos during CONNECTremoteenablednormalapplication program command executionnumber of columns on your screen8024number of rows on your screenString to trigger automatic return to command modeWhether Kermit should ring the terminal bell (beep)onConfirm with carriage returnParameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character 13Sorry, the legal values are 0-31 Maximum number of characters in a packet90?Sorry, this command does not apply to %s protocol. Use SET SEND PACKET-LENGTH for XYZMODEM Sorry, 10 is the minimum 401 Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start character1How many padding characters for inbound packets00Packet timeout interval402Packet timeout interval?Out of range - %d dynamicMinimum timeout to allow1?Out of range - %d Maximum timeout to allow0autooffMilliseconds to pause between packets0?Internal error - malloc failure Character to doubleCharacter to ignoreSET S/R DOUBLE/IGNORE atmbufnonenonnon?Please specify a number or the word NONE ?Please enter a character code in range 0-255 Filter program for sending files - use \v(filename) to substitute filenameFilter program for receiving files - use \v(filename) to substitute filename?Filter must contain a replacement variable for filename. Max length for protocol init string-1automaticon?Please use SET FILE COLLISION to choose the desired action Directory to move file(s) to after successful transferTemplate to rename file(s) to after successful transferCharacters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill character0Numeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmission0Seconds to wait for each character to echo1 Press the X or E key to cancel. > filename, | command, or type carriage return to confirm the commandremcfm localremcfm sremcfm cmd?"%s" has no effect in remote mode ?Not confirmed ?%s missing FilenameCommand?Access denied - %s remcfm remfileremcfm remappdremcfm rempiperemcfm remdest?"%s" has no effect in remote mode Hint: try again with an output redirector. ?"%s" has no effect in remote mode Hint: try again with an output redirector. ?%s missing FilenameCommand?Access denied - %s remtxt remfileremtxt remappdremtxt rempiperemtxt remdestremtxt command?No connectionUser ID?Internal error: malloc Password?Internal error: malloc Account?Internal error: malloc REMOTE LOGIN savedUsername: ?Canceled ?Internal error: malloc Password: ?Internal error: malloc ?Parameter name required Remote directory nameXZCWD: passwordName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specification?Not available - %s Command for remote systemCommand for remote Kermit?Remote Kermit command required ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage returnRemote function invocationRemote variable name or functionQRemote variable nameAssignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to rename?Name of remote file required New name of remote file?Name of remote file required Name of remote directory to createName of remote directory to delete?Name required ?Not implemented - %s ?File specification required rfilopFile Attribute packetsSorry, command not available 13210143101421014110135101331013910134101451014710?Not available Positive numberSeconds of inactivity before INPUT failsNumber of bytes in INPUT bufferK_NET_DIRECTORYrOpening %s... Warning: %d matches found, %d max ?memory allocation error - lunet:3 Ambiguous - "%s" different names in network directory clsconnx localclsconnx hupok says no Closing connection setline fcsetline zzMaking connections is disabled?Sorry, making connections is disabled setline cxAccess to external commands is disabled?Sorry, access to external commands is disabled Hostname, ip-address, or switchHost or switchCommand, or switchHostHostsetlin cmfdb?This switch does not take arguments ?This switch requires an argument PasswordInternal error?Sorry, too long - max = %d UseridInternal error?Sorry, too long - max = %d Rest of command SUNDAY 2setlin service 0setlin host s 2setlin host s 1TCP service name or numberkermitTCP service name or numbertelnetTCP service name or number/rlogin/k4login/k5login/ek4login/ek5login/telnet/defaultSwitchHostname or address required?%s setlin mynet 1setlin nnetdirsetlin host s 3Network directory lookup error?Fatal network directory lookup error - %s setlin lunet nhcountsetlin host s 5Device name, or switchsetlin cmfdbsetlin CMTXTsetlin CMKEYsetlin bad cmfdb resultInternal error?Internal parsing error setlin confirmed mdmtypTimed out - no carrier?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Access to lock deniedSorry, write access to UUCP lockfile directory denied. ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Access to device deniedSorry, access to device denied: %s ************************* HINT (Use SET HINTS OFF to suppress future hints): Please read the installation instructions file, %sckuins.txt, or the UNIX appendix of the manual, "Using C-Kermit". ************************* Device is in use or unavailableSorry, device is in use: %s Device open failedsetlin serial errnoSorry, can't open connection: %sSorry, can't open connection: %s Sorry, can't open connection: %s setlin mynet 3setlin nhcount%d entr%s found for "%s"%s yies:.%3d. %-12s => %-9s %s %s setlin loop isetlin mynet 4Network type not supportedError - network type "%s" not supported setlin service 1setlin service 2setlin service 3setlin service 4:setlin service 5:telnetsetlin service 9:setlin net line[] before ttopensetlin net mdmtyp before ttopensetlin net ttnprotoNetwork connection failureset host line, errnoRLOGIN failure************************* Hint: The RLOGIN port is privileged in UNIX. (Use SET HINTS OFF to suppress future hints.) ************************* Can't connect to %s Can't open connection to %s setlin oksetlin networksetlin localsetlin mynetsetlin reliablerwr+aarwr+aaoo ooooo o$o(o,o0o4o8o<o@oDNo errorEnd of fileFile not openChannel out of rangeParameter out of rangeToo many files openOperation conflicts with OPEN modeOPEN mode not supportedIllegal combination of OPEN modesAccess deniedFile not foundBuffer overflowCurrent line number unknownOperation fails - reason unknownError number out of rangez_openz_open nfopnargsz_open fopen argsz_open z_maxchan 1z_open ckmaxfilesz_open z_maxchan 2z_open z_maxchan 3z_open errorz_outz_out lengthz_out flagsz_out nz_out fwrite z_in channelz_in buflenz_in lengthz_in flagsz_in blockz_in block errnoz_in block ferrorz_in block feofz_in line byte loopz_in iz_seekz_line posz_line rewindz_line rewindingz_line readz_line premature EOFz_line resultz_getlineclosecountflushlistopenreadrewindseekstatuswrite/append/binary/read/writeslsts|sallseoflastss/absolute/byte/character/line/relativestt tt /bytes/characters/lines/list/nolist/quiettltttttt/block/byte/character/line/sizet ttuu/block/byte/character/line/lpad/rpad/size/stringuX u`uhutu|uuu Operation?File operation required Variable or switchVariable?Variable name and file name required ?This switch does not take an argument ?Variable name required ?Syntax error in variable name Name of new fileName of existing fileFilename?Filename required ?Wildcards not allowed here ?Write access denied - "%s" ?OPEN failed - %s: %s Channel number?Channel number required ?REWIND failed - Channel %d: %s Channel number; or keyword?Channel number or ALL required ?CLOSE failed - Channel %d: %s FILE CLOSE ALL?CLOSE failed - Channel %d: %s Channel or switchChannel?Channel number required ?This switch does not take an argument ?This switch requires an argument Bytes?Number required Numeric ASCII character value32FILE READ rsize 2FILE READ/WRITE channelText?Buffer overflow ?Channel %d WRITE error: %s Variable nameFILE READ cmfldFILE READ vnambuf?Syntax error in variable name FILE READ variableFILE READ errorFILE READ errno?READ error: %s FILE READ data%s Channel or switchChannel?Channel number required ?This switch does not take an argument FILE SEEK/COUNT channel?COUNT error: %s %ld %s%s bytelinesChannel number; or keyword?Channel number or EOF required FILE SEEK atmbufFILE SEEK relativeFILE SEEK rsize?Relative SEEK failed: %s FILE SEEK /CHAR z?SEEK /BYTE failed - Channel %d: %s FILE SEEK /LINE pos?Relative SEEK failed: %s FILE SEEK /LINE z?SEEK /LINE failed - Channel %d: %s System open file limit: %4d Maximum for FILE OPEN: %4d Files currently open: %4d %2d. %sRWAB (%s) [EOF] %ld Channel number?Channel number required ?FLUSH failed - Channel %d: %s Channel number?Channel number required Channel %d:%s%s Channel %d:%sNot open (name unknown)Channel %d:%sOpen File: %s Modes: /READ /WRITE /APPEND /BINARY /COMMAND [EOF] Size: %ld At byte: %ld At line: %ld ; C-Kermit SAVE KEYMAP file: ; Clear previous keyboard mappings set key clearset key \%d \{%d}%cset key \%d \{%d}; EndName of Kermit command filekeymap.ksc?Sorry, %s is a directory name DispositionnewNot implemented - %s ckxlogin useridckxlogin savedUsername: ckxlogin TELOPT_SB(TELOPT_KERMIT).kermit.me_startckxlogin flush user xckxlogin user tn_doopckxlogin user TELOPT_SB(TELOPT_KERMIT).kermit.me_startYour username, or "ftp", or "anonymous" Login cancelled ?Internal error: malloc ckxlogin zvuserckxlogin flush user xckxlogin pass tn_doopckxlogin pass TELOPT_SB(TELOPT_KERMIT).kermit.me_startanonymousftpEnter e-mail address as Password: Enter %s's Password: Enter Password: Login cancelled ?Internal error: malloc ckxlogin zvpassckxlogin restoredpasswordpromptuseridallcautiousminimalnoneprefixedunprefixednewold04diagnosticserrorP\pacingspecial-escapes1234blank-free-2countsprefixautomaticoffonautomaticoffonquietverboseoffonsessiontimestampfullhalf/direct-serial/modem/remote/tcpipautomatickeepnonerts/ctsxon/xoffbellcodecresclfnonexoffxonasciibinarydebugtextcinternationallocallong-distancenone (8askoffonptxcapabilitiescarrier-watchcommandcompressiondata-compressiondial-commanderror-correctionescape-characterflow-controlhangup-methodkermit-spoofmaximum-speednamespeakerspeed-matchingtypevolumehighlowmediumat-commandscompressiondcecerror-correctionhardware-flowhwfcitukermit-spoofkssbsoftware-flowspeed-bufferingswfctbtelebitv25bis-commandsarea-codecompressionconfirmationconnectconvert-directorycountry-codedial-commanddirectorydisplayescape-charactererror-correctionflow-controlforce-long-distancehangupignore-dialtoneintervalininit-stringintl-prefixintl-suffixkermit-spooflc-area-codeslc-prefixlc-suffixld-prefixld-suffixlocal-area-codelocal-prefixlocal-suffixmmacromemethodmnp-enablemodem-hanguppacingpbx-exchangepbx-inside-prefixpbx-outside-prefixprefixpulse-countriesrestrictretriessortspeed-matchingstringsuffixtesttimeouttf-area-codetf-prefixtoll-free-area-codetoll-free-prefixtone-countriesmodem-commandrs232-signalv24-signalautoanswercompressiondial-mode-promptdial-mode-stringerror-correctionhangup-commandhardware-flowignore-dialtoneinit-stringno-flow-controlpredial-initpulsesoftware-flowspeakertonevolume8 DP d x autononerts/ctsxon/xoffautodefaultpulsetonekermitshell/match-dot-files/no-match-dot-filesbriefftpverboseX`devenhardwaremarknoneoddspaceevenoddoffonmessagepathfileoffonon-disconnectstatuswarningalwaysoffonlocaloffonremotediscardkeepautodiscardkeepdiscardkeepautoechoerroroffonechoerrorechoautodownloadbytesizeheightinterruptionmore-promptingquotingrecall-buffer-sizeretrywidth( 8DL \ lt cd-messagedisplayget-pathidle-timeoutkeepalivelogintimeout(8DLcancellationbellcancellationcharacter-setcrc-calculationdisplayinterruptionlocking-shiftmodepipesprotocolslow-start (0 8DP character-setmodeautomaticmanualforcedoffonacceptedrefusedreqrequrequerequesrequestrequesterequestedrequired@LTX`hpx binary-me-means-u-toobinary-u-means-me-tooinfinite-loop-checksb-implies-will-do0H\acctdisplayjoboffonprintersystemtypeuseruservarcb binary-modenvtoffonrawP\`dhcrcr-lfcr-nullfoffonrawbinary-modebugechoenvironmentkermitlocationnawsnewline-modeprompt-for-useridremote-echoterminal-typetransfer-modewait-for-negotiationsxdisplay-locationxfer-modeauthenticationbinary-modeechoencryptionibm-sakkermitlflownawsnew-environmentpragma-heartbeatpragma-logonpragma-sspisaksend-locationsgastart-tlssuppress-go-aheadsterminal-typettypexdisplay-location/client/servercharacter-setscyrillicdebugdialdynamic-memoryforwardfullscreen-displaygreekhebrewhelpif-commandjob-controlkanjikermitkerberoslatin1latin2networkpipespushredirectrts/ctsscript-commandserver-modeshow-commandsrpssl/tlstransmitxyzmodemcalibratedisknowhereprinterscreen\v(home)Names of one or more directory files, separated by spacesDirectory name?Wildcards not allowed ?Not a directory - %s parsdir s?Internal error - malloc parsdir pp[dd] 1parsdir myindexparsdir pp[dd] 2?Too many directories - %d max username"%s" - too long, %d max password"%s" - too long, %d max account"%s" - too long, %d max autoCarrier wait timeout, seconds0nookquityes $(0 Please respond Yes or No%s or Quitpush push%s available not CHECK: push not available pipes pipes%s available not CHECK: pipes not available dochk %s%s available not CHECK: %s not available dologend dialogdologend cxlogbuf[0]dologend ckxloggingdologend cxlogbuf 1dologend t2dologend hhmmssE=dologend cxlogbuf 2dologend cx_prevdologend diaopndologend zsoutldologend zclosedologend ckxloggingT=DIALdologend ckxsyslogdologend ckindexT=DIALdologend syslogCONNECTION No record. No connection. dologshow localdologshow cx_activedologshow ttchkdologshow cx_prevActiveClosedUnknown Status: %s Opened: %s User: %s PID: %s Type: %s To: %s From: %s Device: %s Origin: %s %s Elapsed time: %s Elapsed time: %s (unknown) Encrypted: %s YesNo Log: %s (none) %s %s T=SERIAL H=%s D=%s LOGLINE BUFFER OVERFLOWdologlineNETXXX dolognetTCP %s %s T=%s N=%s H=%s LOGNET BUFFER OVERFLOWdolognet cxlogbufdialstrinitmdm mdmtypinitmdm usermdminitmdm pWARNING: modem info for "%s" not filled in yet This space available (use SET MODEM NAME)Modem parameter?No keywords match: "%s" how to hang up modemmodem-commandcapability of modemsetmodem autoflowsetmodem flow 1setmodem flow 2?value required modem typenonebased on existing modem typeunknownDescriptive name for modemmediumUnexpected SET MODEM parameter Modem initialization stringTelephone number prefixDialing command for modem, include "%s" to stand for phone number, for example, "set dial dial-command ATDT%s\13"?Dial-command must contain "%cs" for phone number. Seconds to wait for call completion0Kermit/modem timeout differential10ASCII value of character to escape back to modem43onModem's command to %sable %sendiserror-correctionautoanswercompressionModem's hangup commandModem's command to enable hardware flow controlModem's initialization stringModem's command to disable local flow controlTelephone number prefix for dialingModem's command to enable local software flow controlCommand to configure modem for tone dialingCommand to configure modem for pulse dialingCommand to enter dial modeModem response upon entering dial modeonCommand to turn modem speaker onCommand to turn modem speaker offmediumCommand for low modem speaker volumeCommand for medium modem speaker volumeCommand for high modem speaker volumeCommand to tell modem to ignore dialtoneCommand to send to modem just prior to dialing?Unexpected SET DIAL STRING parameter autodefaultNumber of times to try dialing a number1Seconds to wait between redial attempts30Area code you are calling from?Sorry, area code must be numeric (please omit the parentheses) (no slashes, please) askCountry code you are calling from?Sorry, country code must be numeric (please omit the plus sign) 11011800888877866100033International dialing prefixInternational dialing suffixLong-distance dialing prefixLong-distance dialing suffixLocal dialing prefixLocal dialing suffixInternal-call prefix of PBX you are calling from\v(d$px)\v(d$pxx)\v(d$p)Outside-line prefix of PBX you are calling from Telephone number suffix for dialingToll-free area code(s) in the country you are calling fromExchange(s) of PBX you are calling fromAnother toll-free area codeAnother PBX exchange Long-distance prefix for toll-free dialingautoverbosenoneArea code to which calls from your area are localMilliseconds to pause between each character sent to dialerName of macro to execute just prior to dialingCountry code where Pulse dialing is requiredCountry code where Tone dialing is availableAnother country codeXXX set ndialpuccXXX set ndialtoccXXX set dialpucc[i]XXX set dialtocc[i]?Unexpected SET DIAL parameter %s Modem carrier-watch: off on auto unknown Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s onoff Modem compression: %s onoff Modem speed-matching: %sonoff (interface speed %s) changesis locked Modem flow-control: none xon/xoff rts/cts auto Modem hangup-method: %s modem-commandrs232-signal Modem speaker: %s Modem volume: %s lowhighmedium Modem kermit-spoof: %s onoff Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): show dialini %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: dialdcon(null)dialdcon %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Speaker on: %c Speaker off: %c Volume low: %c Volume medium: %c Volume high: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: %c Ignore-dialtone: %c Predial-init: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. setalarm xx%ld - illegal value, must be 0 or positive SET ALARM date (1)SET ALARM time (1)Internal time conversion error, sorry. %05ldSET ALARM date (2)SET ALARM time (2)numeric key code, or the word CLEAR,SET KEYclear Press key to be defined: ?Error reading key ?key code must be between 0 and %d Sorry, %d is the CONNECT-mode escape character Enter new definition: key definition, or Ctrl-C to cancel this command, or Enter to restore default definition?Key definition too long 127E17E27M17M27O17O27S17S28E18E28N18N28O18O2   $( , 0 47E17E27M17M27O17O27S17S28N18E18E28N28O18O2  $deletedirectorypurgetype`ht|&gkermitotherxxmodemxmodem-crcyymodemymodem-gzmodem{%s}?Sorry - maximum length is %d kermit?Sorry, REDIRECT capability required for external protocols. Optional command to send to host prior to uploading in binary modeOptional command to send to host prior to uploading in text modeOptional command to send to host to start Kermit serverExternal command to SEND in BINARY mode with this protocolExternal command to SEND in TEXT mode with this protocolExternal command to RECEIVE in BINARY mode with this protocolExternal command to RECEIVE in TEXT mode with this protocoldisk|lprPrinter or file name?Directory names not allowed ?Memory allocation failure printername?Access denied - %s ...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. auto310120tcp/ip?No keywords match: "%s" ?Sorry, access to external commands is disabled ?Network type not supported TCP optionnodelaypreferred IP Address for TCP connectionsonoffononLinger timeout in 10th of a millisecond0Send buffer size, bytes8192Receive buffer size, bytes8192?Warning: receive buffers larger than 52248 bytes may not be understood by all hosts. Performance may suffer. SET HOST fail mdmtypSET HOST OK mdmtypsetlin flow 1setlin returnssetlin flow 2setlin localnone?internal error, sorry XXX quiet SETXXX cmdlvl SETSend buffer size?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small Receive buffer size?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small 3%d400/client, /server orXYTELOP cmfdb?This switch does not take arguments XYTELOP switch?Unexpected value - %d desired server stateUNKNOWNdesired client stateUNKNOWNdesired server statedesired client stateUNKNOWNdesired server statedesired client stateUNKNOWNparameter for TELNET negotiationsinitial TELNET echoing statelocalterminal type for TELNET connectionsnvtrawononrefusedDOacceptWILLacceptmeacceptuacceptbinary-me-means-u-toooffmeacceptuacceptvalue of telnet environment variableSorry, too long ?Not yet implemented Location stringonPrompt string%% fields are not used in this command. Positive number0?A positive number, please XYCOUN: zbytesize for command characters, 7 or 87 ?The choices are 7 and 8 maximum number of commands in recall buffer10Command screen width, characters80Command screen height, rows24set debug yset debug xset debug ydebug.logNumber of seconds before starting to send5fullEXIT status codeFlow control type, one of the following: keep none rts/cts xon/xoff or connection type?No keywords or switches match: "%s" set flowset flow /blah 1Flow control typenoneset flow /blah 2set flowset flow autoflownoneASCII value?Character must be in ASCII control range noneeven{%s}Program's command promptMaximum retries per packet10403Number of seconds, or 0 for no idle timeout0Interval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs 404Name of file42010echotype of filetextTransmission rate for %s in bits per second?value required ?Sorry, you must SET LINE first ?Speed cannot be set for network connections ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, 134.5 bps %s, %ld bps character-setASCII code for cancellation character3Cancel character must be in ASCII control range How many required to cause cancellation2Number must be 2 or greater transparent405on?Sorry, Kermit protocol only automatic41001Sorry, access to pipes is disabled discardwho expands wildcardskermitwhether to match filenames that start with "."/no-match-dot-filesShell expansion is disabled Window size for Kermit protocol, 1 to 321Window size for ZMODEM protocol, 0 to 655350Window size for current protocol?SET WINDOW does not apply to %s protocol 406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterpacingMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listSET CONTROL atmbufallala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE or RTS/CTS to transmit these characters unprefixed. TELNET IAC = 255, CR = 13, not affected. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. Sorry, not on a TELNET connection. repeat-count compression parameter(not implemented yet, nothing happens) ASCII value?Illegal value for prefix character Seconds from now, or time of day as hh:mm:ss0?Number, expression, or time of day required ?Alarm time is in the past. Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. control-character prefixing optionvalue for login scriptuseridtextSorry, too long discardName of temporary directoryPATHEDITORName of preferred editorFull path of preferred editor?A single file please editor command-line optionsPATHName of preferred browserName of preferred ftp clientftpFull path of preferred browserFull path of preferred ftp client?A single file please browser command-line optionsftp client command-line optionsautomaticautomaticverbosefield separator,?A single character, please. ?A non-alphanumeric character, please. automaticdiagnosticscancellationName of fileCD PATH stringStop bits for serial deviceSerial device character size, parity, and stop bits8N1for commandTime limit for ASK command, seconds0Not implemented - %s hupok localhupok xhupok xitwarnhupok networkhupok haveline* A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. OK to close? OK to exit? hupok getyesno control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d SET SEND DOUBLE characters: %d (none) SET RECEIVE IGNORE characters: %d (none) >>>User Interface 7.0.213, 25 Jul 1999binary-patternssend-listtext-patternsL\hxfile-character-settransfer-character-setxfer-character-set/off/on/binary/command/text  !#.:<@aboutaddanswerapcarrayasciiasgaskaskqassassertassignassociatebackbeepbinarybugbrowsebyeccatcdcgetcheckclearcloseclscommentconnectcocopcopycopyrightcpcqcreceivecsendcwddatedcldeclaredecrementdefinedeletedialdirectorydisabledoee-packetechoediteightbitelseenableendevaluateexexecexitextended-optionsffailfclosefcountfflushfifilefinishflistfopenfoforforwardfotfreadfrewindfseekfstatusftpfunctionfwriteggegetgetcgetokgotohhanguphelpiifiksdinincrementinputintintrintrointroductionkermitllineoutlolocalloglogoutlookuplsmailmanualmdminputmgetmkdirmmovemoremovempausemputmsmsendmsleepmvnewsnolocalnopushoopenoptionsoutputpausepdialpingpipepopprintpsendpupurgepushputpwdqqueryquitrrdrasgrassignrcdrcopyrcwdrdeleterdirectoryreadreceiveredrediredialredirectredoregetreinputremremoremoteremoverenamereplayresreseresendresetretretrievereturnrexitrhelprhostrkermitrloginrmrmdirrmkdirrobustrpwdrqueryrrrrenamerrmdirrsetrspacertyperunrwhossavescscrscreenscriptsendserversetshshiftshowsleepsortspspaspacespawnstastatstatisticsstatusstopsucceedsupportsuspendswitchtaketeltelnetteloptterminaltexttracetranslatetransmittypeundefineversionwaitwherewhilewhowildcardswrwriwritwritewrite-linewritelnxechoxifxlatexmitz^_asg_assign_decrement_define_evaluate_forward_getargs_increment_putargsnookyeskeymapalarmask-timerattributesbbabackgroundbatchbaudbellblock-checkbrowserbufferscarrier-watchcasecdclclecleaclearclear-channelclearchannelclose-on-disconnectcmdcommandconconsolecontrol-charactercountddedebugdefaultdelaydestinationdidiadialdisconnectduplexeditorescape-characterevaluateexitf-ack-bugfileflflagftp-clientflow-controlfunctionhandshakehintshostiinincompleteinputkeyllanguagelinelocal-echologinmacromodemnetworkoutputoptionspauseparityportprprinterprefixingpromptprotocolqq8flagquietreceivereliablerepeatretry-limitscriptsendserserialserversession-logsleepspeedstartup-filestop-bitsstreamingsuspendtaketcpteltelnettelopttemp-directoryterminaltransaction-logtransfertransmitunknown-char-setwaitwildcard-expansionwindow-sizexferxmitclearcleolmove-todirectorytypecommandtcp/ipaddressdns-service-recordskeepalivelingernaglenodelayreverse-dns-lookuprecvbufsendbufasasgassigncdcopycwddeletedirectoryexithelphostkermitllologloginlogoutmkdirprintpwdqueryrenamermdirsetspacetypewhoconnectionscxdebuggingpacketssessiontransactionsappend-filedebug-logerrorfilepacket-logscreensession-logsys$outputttrtratrantranstransatransactransacttransactitransactiotransactiontransaction-logtransactionsalarmapcbinary-patternsbothdevicedevice-and-inputdevice-bufferdial-statusinput-buffersend-listscreentext-patterns| @ append-fileconnectioncx-logdebug-logpacket-logread-filesession-logttrtratrantranstransatransactransacttransactitransactiotransactiontransaction-logtransactionswrite-filealarmargargumentsargsarraysassociationsattributesbrowsercdcharacter-setscmdcomcommcommunicationscommandcontrol-prefixingconnectioncxcountddefaultdialdouble/ignoreeditorescapeexitextended-optionsfeaturesfileflow-controlftpfunctionsglobalsignore/doubleinputkkeylanguageslogsmacrosmodemnetworkoptionsoutputparameterspatternsprinterprefixingprotocolscriptssend-listserverstackstatusstreamingteltelnetteloptterminaltrtratrantranstransfertransmittriggervariablesversionsxferxmitbothremotelocal$allasasgassignbyecdcopycwddeletedirectoryenableexitfinishgethostmailmkdirqueryprintrenameretrievermdirsendsetspacetypewhoPTX\dhltx     /after/as-name/b/before/binary/c/calibrate/command/delete/dotfiles/except/filter/filenames/image/larger-than/listfile/mail/move-to/nobackup/nodotfiles/not-after/not-before/pathnames/print/protocol/quiet/recover/recursive/rename-to/since/smaller-than/starting-at/su/sub/subject/subdirectories/textT\hlt|    $0<DPXd p|       %/after/before/binary/delete/except/filenames/image/larger-than/list/mail/move-to/not-after/not-before/pathnames/print/protocol/quiet/recover/rename-to/since/smaller-than/starting-at/subject/text (4<HT \ l | /quietly/trigger/brief/verbose/count/head/match/more/nopage/page/prefix/tail/width$,4<DLT\allassignmentscommand-level TYPE /PAGE/NOPAGE(no options set)/WIDTH:%dSwitch?This switch does not take an argument Column at which to truncate?Sorry, this option can not be set abortaoaytbreakcanceleceleofeorgaipdmarkdodontnopsaksbsesuspwillwont $(,4<binaryechokermitlflownawsnew-environmentpragma-heartbeatpragma-logonpragma-sspisaksend-locationsgattypexdisplay-locationDLT/\!dl'|#nawsIP host name or number?Sorry, FTP command disabled %s %sIP host name or number?Sorry, PING command disabled ping %smakelist smakelist elementmakelist last elementxsend entry fncnvFilename, or switchFile(s) to sendCommandxsend cmfdb?This switch does not take arguments ?This switch requires an argument xsend switch?Sorry, system command access is disabled ?Sorry, no SEND /COMMAND or CSEND when SEND FILTER selected Command, or switchPattern?Pattern required ?Pattern too long - 256 max device and/or directory for source file after sendingnew name for source file after sending%s ?Destination required?New name requiredSize in bytes0File date-time?Date-time required ?Sorry, sending files as mail is disabled e-mail address?address required ?Sorry, sending files for printing is disabled Print optionsxsend /as-name getvalName to send under?name required 0-based position0File-transfer protocol?name of protocol required xsend /filter getvalFilter program to send through?Filter must contain a replacement variable for filename. absoluteconvertedxsend /filenamesnumber of Kbytes to send1024Name of file containing list of filenames?Filename required ?Wildcards not allowed ?Unexpected switch value - %d xsend cmresult fcode?Sorry, %s works only with Kermit protocol CSENDSEND /COMMAND?Sorry, no /RECOVER or /START if SEND FILTER selected ?%s - "%s" No files matchFile not found?Unexpected function code: %d xsend stringxsend confirmedxsend protocoldoxsend /BINARY xfermodedoxsend /TEXT xfermodexsend binarySEND /COMMAND before strippingSEND /COMMAND after stripping?Sorry, a command to send from is required ?Sorry, /DELETE conflicts with /MOVE or /RENAME ?Sorry, /MOVE-TO not available to guests ?Can't create "%s" ?Sorry, /RENAME-TO not available to guests ?New name required for /RENAME ?/RENAME for file group must contain variables such as \v(filename) ?Sorry, /BINARY required ?Sorry, wildcards not permitted with /START ?Sorry, this command needs 32-bit integers ?Sorry, SEND /START works only with Kermit protocol Sorry, /RECOVER is possible only with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON Sorry, you can only send one file at a time with XMODEM protocol xsend msendNames of files to send, separated by spaces?MSEND list too long xsend msend doxsend filespec buffer overflowe-mail address (optional)e-mail address (required)printer options (optional) Optional as-name template containing replacement variables like \v(filename)Optional name to send it withdoxsend cmarg2Sorry, /MAIL and /PRINT are conflicting options /MAIL/PRINTxsendSorry, %s available only with Kermit protocol /MAIL/PRINTxsend print/mail wilddoxsend mail address or printer options?E-mail address required ?%s too long E-mail addressPrint option stringxsend mailingxsend address:xsend printingxsend optionsCALIBRATIONdoxsend cmarg2 calibratexsend can't open?Failure to open %s xsend opened?Filename required but not given ?Read access denied - "%s" doxsend line=sxsend /COMMAND pipesend?Invalid switch combination doxsend cmarg2 wild?As-name for file group must contain variables such as \v(filename) xsend cmarg2 before strippingxsend filenamexsend as-namexsend pv[SND_STA].ival?/STARTING-AT may not be used with multiple files. xsend /STARTINGxsend /DELETExsend fncnvxsend fnspathxsend fncnvxsend display?A Kermit Server is unavailable to process this command. ?Start a RECEIVE command to complement this command. ?File deletion not allowed for guests. doxsend sndsrcSwitchdoxconn cmfdb?No switches match - "%s" ?This switch does not take arguments ?This switch requires an argument doxconn switchString (enclose in braces if it contains spaces)?String required ?Unexpected switch value - %d doxconn cmresult.fcode?Unexpected function code: %d doxconn doconect returnsdoxconn ttchk returnsdoxconn doconect triggerval?Unexpected function code: %d Pattern?Too many patterns - %d is the maximum ?Sorry, REMOVE SEND-LIST not implemented yet. ?Sorry, ADD SEND-LIST does not work with external protocols File specification to add?A file specification is required WARNING - \v(filespec) buffer overflow type of file transfer As-name template containing replacement variables such as \v(filename)Name to send it with?As-name for file group must contain variables such as \v(filename) Sorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list nodeclearcopydcldeclaredestroyresizesetshowsort           Array name?Array name required ?Segment notation not allowed in array declarations ?Memory allocation error Initial value for \&%c[%d]=Carriage return to confirm?Declare failed &%c[%d]Array initialization error: %s %s DCL rcArray name?Array name required New size?New size required ?Bad array reference - "%s" ?Array not declared - "%s" ?New size required ?Array segments not allowed for this operation ?Sorry, \&@[] is read-only Name of source array?Bad array reference - "%s" ?Array not declared - "%s" XXX lo1XXX hi1XXX c1Name of destination array?Bad array reference - "%s" XXX lo2XXX hi2XXX c2?Sorry, \&@[] is read-only XXX lo1XXX hi1XXX c1XXX lo2XXX hi2XXX c2XXX ijXXX >>Array name?Array name required ?Bad array reference - "%s" ?Partial arrays can not be destroyed ?Sorry, \&@[] is read-only ?Failed - destroy "\&%c[]" Array name?Array name required Value?Bad array reference - "%s" ?Array %s is not declared ?Sorry, \&@[] is read-only docmd entry, cx docmd XXGTAdocmd cxdocmd XXGTA maclvldocmd dogta returnsdocmd dogta maclvlSorry, BYE only works with Kermit protocol ?A Kermit Server is unavailable to process this command %citem to cleardevice-and-inputExecuting CLEAR APCText of comment line?Sorry, COPY is disabled ?Sorry, changing directories is disabled "CONNECTION", or log or file to closeconnection?You must say which file or log ?Connection was not open Variable name?Variable name required Integer arithmetic expression%s ?Sorry, DEFINE/ASSIGN disabled dodial returns?Sorry, DELETE is disabled ?Sorry, DIRECTORY is disabled Server function to enableServer function to disable?Name of server function required modeboth?Please specify remote, local, or both optional return value ?No macros defined macro?Macro name required optional argumentsbraced list of commands ..tmp:%03dText to be echoedApplication Program Command text%s %s%c_%s%c\%c_%s%c\Text to be outputOUTPUT 1OUTPUT 2OUTPUT 3OUTPUT sizeOUTPUT 4?Sorry, printing is disabled File to print?A file specification is required ?Wildcards not allowed Local print command options, or carriage return%s exit status codeOptional EXIT message%s Sorry, E-PACKET only works with Kermit protocol Sorry, FINISH only works with Kermit protocol ?A Kermit Server is unavailable to process this command ?Sorry, reception of files is disabled C-Kermit commandhelpHELP command xtop-level cmkey token ?Invalid - %s The ckermit2.txt file can be found in %s. Type "man kermit" at the shell prompt to view the Kermit man page. label?Label name required seconds to wait for input, or time of day hh:mm:ss?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. List of input stringsMINPUT cmfld returns?Memory allocation failure MINPUT cmcfmMINPUT end parse xMINPUTMaterial to be input?Memory allocation failure xxrei line?INPUT timed out ?MINPUT timed out ?REINPUT failed label?Label name required What to log?Type of log required ?Nothing happens expect-send expect-send ...?Sorry, CRECEIVE works only with Kermit protocol Sorry, REMOTE commands only work with Kermit protocol Remote Kermit server command?You must specify a command for the remote server ?Sorry, renaming of files is disabled ?Sorry, sending files is disabled Add to which list?Remove from which list?File to partially send?A file specification is required PSEND line?Sorry, wildcards not permitted in this command ?Sorry, this command needs 32-bit integers starting position (byte number)Name to send it with?Sorry, sending files is disabled ?Sorry, no PSEND while SEND FILTER selected Sorry, PSEND works only with Kermit protocol PSEND filenamePSEND as-nameSorry, you can only send one file at a time with XMODEM protocol Sorry, SERVER only works with Kermit protocol optionkeymap?You must specify an option to save ?More fields required Parameter?You must specify a parameter to set ?More fields required ?Sorry, host command access is disabled Command to overlay C-Kermit?Command required ArgumentSystem command to executeRUN zshcmd codeEXEC cmdEXEC argEXEC failsLocal command to run, with its standard input/output redirected to %s ?REDIRECT disabled ?SET LINE or SET HOST required first parameters?Sorry, SPACE command disabled Confirm for current disk, or specify a disk device or directory?Sorry, SPACE command disabled %s %sCarriage return, or option/briefexit status code0Message to print%s END maclvl 1_xif_for_whi_swiEND poppingEND maclvl 2%dEND maclvl 3XXX mrval[maclvl]XXX mrval[maclvl+1]?Sorry, IKSD can not be suspended ?Sorry, access to system is disabled ?Take files nested too deeply \v(home)C-Kermit command file?A file name is required ?Wildcards not allowed in command file name take file?Can't execute a directory - "%s" Optional arguments%0take arg 0take argstake args?Sorry, RLOGIN is not configured in this copy of C-Kermit. Filename, or switchFile to transmitCommand?This switch does not take an argument ?This switch requires an argument ?Sorry, system command access is disabled Command, or switch?Only a single file may be transmitted ?Sorry, a command to send from is required ?Sorry, TYPE command disabled Filename or switchdotype cmfdbdotype cmresult.fcodedotype cmresult.nresult?This switch does not take an argument Number of lines10Column at which to truncate?This switch requires an argument pattern?This switch requires an argument prefix for each line?Too long - 63 max Filename?Name of an existing file required ?A single file please dotypeFile to translate?Name of an existing file ?A single file please from character-setto character-setoutput file/dev/tty?Directory name not allowed %s, for%s Numeric: %ld THIS IS A TEST VERSION, NOT FOR PRODUCTION USE. Patches: %s ?Sorry, WHO command disabled user name?Sorry, WHO command disabled CK_WHO%s %sto file or log?Write to what? textWRITELN ERRORWRITE ERROR%s%s WRITELN SCREENWRITE SCREEN%s%s ?Write error ?File or log not open ?Sorry, directory creation is disabled Name for new directory?Directory name required ?Sorry, directory removal is disabled Name of directory to be removedTELNET commandTELNET optionff%02x%02x XXTELOPTELNET optionTELNET SENT %sSAKUNKNOWNff%02x kermit command-line arguments, -h for helpkermit KERMIT sstateKERMIT sstatedate and/or time, or carriage return for current%s EDITOR?Editor not defined - use SET EDITOR to define File to editCan't create "%s" ?A single file please ?Sorry, editing not allowed %s%s %s%s %s?Sorry, browsing not allowed BROWSER?Browser not defined - use SET BROWSER to define URL%s%s %s%s %s File most recently... Sent: %s (none) Stored as: %s Received: %s (none) Stored as: %s If the full path is not shown, then the file is probably in your current directory or your download directory (if any - SHOW FILE to find out). pattern, or first few characters of a previous command*?Sorry, command recall can't be used now. %s%c?Sorry - "%s" not found %s SUCCESSFAILUREtransfer character-set namewith file character-setfile character-set namewith transfer character-setNumber of arguments to shift1Carriage return to confirm the command, or manual topickermitman %sMANUAL?Sorry, access to system commands is disabled. fastcautiousrobustscreen actionRow (1-based)Column (1-based)1?Row and Column must be 1 or greater screen calling ck_cls()Array operation?Sorry, not implemented yet - "%s" Trace object; Or switchTrace objectallallTRACE %s ONOFF  (8@T\dlx  ,:895h i4j@kLl`6Tm|n7op]TqV8Yp<=H>@<ACxLK\NxEPQIFH][@Sp]^ _ahc$ds8fTwyDz|,}$`W,ptvHDial Command, 7.0.122, 24 Jul 1999DIAL succeededModem type not specifiedCommunication device not specifiedCommunication device can't be openedSpeed not specifiedPre-DIAL hangup failedInternal errorDevice input/output errorDIAL TIMEOUT expiredInterrupted by userModem not readyPartial dial OKDial directory lookup errorModem command errorFailure to initialize modemPhone busyNo carrierNo dialtoneIncoming callNo answerDisconnectedAnswered by voiceAccess denied / forbidden callBlacklistedDelayedFax connectionTAPI reported failure - reason unknown131323584446494@4D4H4L4P4T4XUnknownTrailBlazerTrailBlazer-PlusT1000T1500T1600T2000T2500T3000QblazerWorldBlazer555(5 555556666 66666 6(6064686<6@6D6H6L6PAny CCITT / ITU-T V.25bis conformant modem,:VALCRN%s CIC DIC 677#7 7$7,707478L+7@7H7L7P7T7X7\7`7d7l7t7x7|777777 ` Hayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 8D8L8P8T8X8\8`8d8h8l8p8t8x8|8888888888888Unknown%s 9H9L9P9d9h9p9x9|99999999999999999999AT&T ISN Network DIAL%s :d:::::::::::::::::::::::::::AT&T switched-network modems,+at%s ;;;;;;;;;;;;;;;;;;;;;;<<<< <<AT&T Digital Terminal Data Module%s <<<(< <<<<<L+<<<==== ====$=(=,=0=4=8=<=@=D Digitel DT-22 CCITT dialer,:HUP VALCRN%s HUP CIC DIC =>> #>>> >$>(>,L+>4><>@>D>H>L>P>T>X>`>h>l>p>x>>>>> Hayes Smartmodem 1200 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ?4?\?d#?l?p????L+??????????@@@@@@ @(@0@8} Hayes Ultra/Optima/Accura 96/144/288ATP ATT ,ATQ0X4N1Y0S37=0S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 @@@#@@AA AAL+AA$A,A4A<APAXAdApAxAAAAAAAAA} Hayes AccuraATP ATT ,ATQ0X4N1Y0S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 BPBB#BBBBBBL+BBBBBCCC C,C4C<C@CDCLCTC\CdClCt} Practical Peripherals V.22bis or higher with V.42 and V.42bisATP ATT ,ATQ0X4N1Y0S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0S36=0S48=128 ATS46=2 ATS46=0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 D D4D<#DDDHD\D`DdDhL+DpDxDDDDDDDDDDDDDDDDD} AT&T / Paradyne DataPort V.32 or higherATP ATT ,ATQ0E1X6&Q0S78=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N7 AT\N0 AT%C1 AT%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 EEE#EEEEEEL+EEEFFFF F(F0F8F@FHFPFXF`FhFpFxF} Microcom DeskPorte FAST 28.8ATP ATT ,ATQ0X4F0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\H0\Q0 AT\N3 AT\N0 AT%C3 AT%C0 ATS0=1 ATS0=0 AT-J0 AT-J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 GG4G<#GDGHGdGhGlGpL+GxGGGGGGGGGGGGGGGHH H} Zoom Telephonics V.32bisATP ATT ,ATQ0E1N1W1X4S82=128S95=47 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=138 ATS46=136 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 HHH#HHHHHIL+IIII I(I0I8I@IHIPIXI\I`IhIpIxIII} ZyXEL U-Series V.32bis or higherATP ATT ,ATQ0E1&N0X5&Y1 OK ATD%s ATQ0H0 AT&H3 AT&H4 AT&H0 AT&K3 AT&K0 AT&K4 AT&K3 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 J(JdJl#JtJxJJJJL+JJJJJJJJKKKK K(K0K8K@KHKPKX} Zoltrix V.32bis and V.34 modems with Rockwell ACI chipsetATP ATT ,ATQ0E1F0W1X4Y0\K5S82=128S95=41 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT\N3 AT\N1 ATS46=138%C3 ATS46=136%C0 ATS0=1 ATS0=0 AT\N0 AT&Q0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 KLL#L$L(L8L<L@LDL+LLLTL\LdLlLtL|LLLLLLLLLLLL} Motorola FasTalk II or LifestyleATP ATT ,ATQ0E1X4\K5\V1 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\Q0 AT\N6 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 AT\J0 AT\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 MtMM#MMMMMML+MMMMMN NN N,N4N<N@NDNLNTN\NdNlNt} BOCA 14.4 FaxmodemATP ATT ,ATQ0E1F1N1W1\K5S37=11S82=128S95=47X4 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT\N3S36=7S48=7 AT\N1 ATS46=138 ATS46=136 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 O O(O0#O8O<OTOXOhOlL+OtO|OOOOOOOOOOOOOOPPP} Intel High-Speed FaxmodemATP ATT ,ATQ0E1Y0X4\K1\V2S25=50 OK ATB1+FCLASS=0 OK ATD%s ATQ0H0 AT\G1\Q3 AT\G1\Q1\X0 AT\G0 AT\J0\N3"H3 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 PPP#PPPPQQL+Q QQ,QDQ\QdQpQxQQQQQQQQQQQ} Multitech MT1432 or MT2834 SeriesATP ATT ,ATQ0E1X4&E8&Q0%E1#P0 OK ATD%s ATQ0H0 AT&E4&E7&E8&E11&E13 AT&E5&E6&E8&E11&E13 AT&E3&E7&E8&E10&E12 AT&E1 AT#L0&E0 AT&E15 AT&E14 ATS0=1 ATS0=0 AT$BA0 AT$BA1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 RhRR#RRRRRRL+RRRRRRSSS$S,S4S8S<SDSLSTS\SdSl} SupraFAXModem 144 or 288ATP ATT ,ATQ0E1N1W0X4Y0\K5S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5\N3S48=7 AT&Q0\N1 AT%C1S46=138 AT%C0S46=136 ATS0=1 ATS0=0 ATM1 ATM ATL ATL2 ATL3 ATX3 TT$T,#T4T8TPTTTXT\L+TdTlTtTTTTTTTTTTTTTTTT} MaxTech XM288EA or GVC FAXModemATP ATT ,ATQ0E1X4Y0&L0&M0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N6 AT\N0 AT\N6%C1 AT\N6%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 UUU<UU2UUUUUUUUUVVVV VVVVV V$V(V,V0V4KIBM/Siemens/Rolm CBX Data Communications Module MODIFY?CALL %s VVV#WWWW W$W(L+W0W8WHWXWhWtW|WWWWWWWWWWWW} US Robotics Courier or SportsterATP ATT ,ATQ0X4&A3&N0&Y3S14=0 OK ATD%s ATQ0H0 AT&H1&R2&I0 AT&H2&R1&I2 AT&H0&R1&I0 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 XlXX#XXXXXXL+XXXXXYY YYY$Y,Y4Y<YDYLYTY\YdYl} US Robotics / Megahertz CC/XJ-CC1560 X2ATP ATT ,ATQ0X4&A3&B2&N0 OK ATD%s ATQ0H0 AT&H1&I0 AT&H2&I2 AT&H0&I0 AT&M4 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 AT&B1 AT&B0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 ZZ4Z<<ZDZHdZhZlZpZtPL+Z|ZZZZZZZZZ[[[ [[[$[,[4[<K Telebit TrailBlazer, T1000, T1500, T2000, T2500ATP ATT ,AAAAATQ0X1&S1S12=50S50=0S54=3 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3S69=0 ATS58=0S68=0 ATS66=1S95=2 ATS95=0 ATS110=1S96=1 ATS110=0S96=0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 [\\<\\d\@\D\H\LPL+\T\\\l\|\\\\\\\\\\\\\\] Telebit T1600, T3000, QBlazer, WorldBlazer, etc.ATP ATT ,AAAAATQ0X2S12=50S50=0S61=0S63=0 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3 ATS58=0S68=0 ATS180=3 ATS180=0 ATS190=1 ATS190=0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 ]]]]]]]]]]]]]]]]]]]]]]]]^^^(dummy)%s ^^^#^^^^^_L+____,_4_@_L_T_\_d_l_p_t_|_____} Generic Rockwell V.32 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5\N0 AT&Q0\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 `<`\`d#`l`p````L+```````a aa$a,a0a4a<aDaLaTa\ad} Generic Rockwell V.32bis modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 abb #b(b,bPbTbXb\L+bdblbtbbbbbbbbbbbccccc } Generic Rockwell V.34 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 ccc#ccddd dL+dd d(d,d4d<dDdPd\dddldpdtd|ddddd= IBM Mwave AdapterATP ATT ,ATQ0X4Y0&M0&Q0&N1&S0\K3\T0%E2S28=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q0 AT\N7 AT\N0 AT%C1"H3 AT%C0"H0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 e<e\ed#elepeeeeL+eeeeeeeffffff f(f0f8f@fHfP} Gateway 2000 Telepath II 28.8ATP ATT ,ATQ0X4&N0&Y1#CLS=0S13=0S15=0S19=0 OK ATD%s ATQ0H0 AT&H1&R2 AT&H2&I2S22=17S23=19 AT&H0&I0&R1 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 fgg#ggg8g<g@gDL+gLgTg\gpgxgggggggggggghh} Cardinal MVP288X SeriesATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 hhhhhhhhhhhhhhiiii iiiii i$i(i,i0Cermetek Info-Mate 212 ABbPpTt XYR D '%s' iiiiiiiiiiijjjj jjjjj j$j(j,j0j4j8j<Digital DF03-AC=%sjjjjjjjjkkkk kkkkk k$k(k,k0k4k8k<k@kDkHDigital DF-100=%s#kkkkklllllll l$l(l,l0l4l8l<l@lDlHlLlPlTlXl\Digital DF-200=W d %s lm m mmmm m$m(m0m4m8m<m@mDmHmLmPmTmXm\m`mdmhmlmpmtmxGeneralDataComm 212A/ED% $D :T%s nn n$2n(n,,n0n4n8n<n@nDnHnLnPnTnXn\n`ndnhnlnpntnxn|nnnPenril modem >k :%s o o4o8#o<o@2oDoHoLoPLoToXo\o`odoholopotoxo|oooooooRacal Vadic VA4492EKk *D ?%s p0p8p<p@pD,pHpLpPpdphplppptpxp|pppppppppppppVen-Tel% $K Number to call: %s qHqhql#qpqtqxqqqqqqqqqqqqqqqqqqqqq `Concord Condor CDS 220 2400b, CDS >rprr#rrdrrrrrrrrrrss sssss s$s(s,s0s4 Microcom MNP modems in SX command modeDP DT ,!@SE0;S1P4;SBRK5 !D%s SF13 SF11 SF10 BAOFF;SMAUT BAON;SMDIR COMP1 COMP0 AASA2SA0sss#tttttt L+t(t0t8tDtLtTt\tdtlttt|tttttttt} ELSA MicroLink 14.4, 28.8, 33.6 or 56KATP ATT ,ATQ0X4\K5 OK ATD%s ATQ0H AT\Q3 AT\Q1\X0 AT\Q0 AT\N3 AT\N0 AT%C3 AT%C0 ATS0=1 ATS0=0 \J0ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 uLuhup#uxu|uuuuL+uuuuuuuuuvv vvvv$v,v4v<vD} ELSA MicroLink 56K V.250ATP ATT ,ATQ0X4 OK ATD%s ATQ0H0 AT+IFC=2,2 AT+IFC=1,1 AT+IFC=0,0 AT+ES=3,0 AT+ES=1,0 AT+DS=3,0,2048,32 AT+DS=0,0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 vww#www$w(w,w0L+w8w@wLwXwdw|wwwwwwwwwwwww} Any ITU-T V.25ter/V.250 conformant modemATP ATT ,ATQ0X4 OK ATD%s ATQ0H0 AT+IFC=2,2 AT+IFC=1,1 AT+IFC=0,0 AT+ES=3,0,2;+EB=1,0,30 AT+ES=0 AT+DS=3,0 AT+DS=0,0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 xxx#xxxxxxL+xxxxxxxxxyyy yyy y(y0y8y@= Generic high-speed AT command setATP ATT ,AT&F OK ATD%s ATQ0H ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 yyz#z zz z$z(z,L+z4z<zDzLzTz`zlztz|zzzzzzzzzz} Megahertz X-Jack XJ3144 / CC6144ATP ATT ,ATQ0X4N1\K5 OK ATD%s ATQ0H AT&K3 AT&K4 AT&K0 AT\N3&Q5 AT\N1&Q0 AT%C3 AT%C0 ATS0=1 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 {\{p{x#{{{{{{L+{{{{{{{{{{{{{||||| |(} QuickComm Spirit IIATP ATT ,AT&F OK ATD%s ATQ0H AT*F3 AT*F2 AT*F0 AT*E6 AT*E0 AT*E9 AT*E0 ATS0=2 ATS0=0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 |||#||||}}L+} }}}$},}4}<}D}L}T}\}d}l}t}|}}}}} Motorola MontanaATP ATT ,ATQ0E1X4\K5\V1 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\Q0 AT\N4 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 AT\J0 AT\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 ~4~L~T#~\~`~l~p~t~xL+~~~~~~~~~~~~~~~~} Compaq Data+Fax ModemATP ATT ,ATQ0E1X4 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\Q0 AT\N3 AT\N0 AT%C1AT&C0ATS0=1 ATS0=0 AT\N3AT\N1ATM1 ATM0 ATL0 ATL2 ATL3 ATX3 #L+(08@HPX`hpx} Fujitsu Fax/Modem AdapterATP ATT ,ATQ0E1X4\K5\N3 OK ATD%s ATQ0H0 AT&K3\Q3 AT&K4\Q1 AT&K0\Q0 AT\N3 AT\N0 AT%C1AT%C0ATS0=1 ATS0=0 AT\J0 AT\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 0DL#TXhlptL+| } Megahertz AT&T V.34ATP ATT ,ATQ0X4N1\K5 OK ATD%s ATQ0H AT&K3 AT&K4 AT&K0 AT\N3 AT\N0 AT%C1"H3 AT%C0"H0 ATS0=1 ATS0=0 AT\J0 AT\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 #L+ 0<L\dlpt|} Diamond SupraSonic 288V+ATP ATT ,ATQ0E1N1W0X4Y0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K AT&Q5\N3S48=7 AT&Q0\N1 AT%C3S46=138 AT%C0S46=136 ATS0=1 ATS0=0 ATM1 ATM ATL ATL2 ATL3 ATX3 <PX#`dtx|L+ } Best Data Fax ModemATP ATT ,ATQ0E1N1W0X4Y0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K AT&Q6\N3 AT&Q0\N1 AT%C3 AT%C0 ATS0=1 ATS0=0 AT\N3 AT\N0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 #L+ $(,4<@DHLPTX\%% AT&T Secure Data STU III Model 1900,ATQ0E1X4 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 # $048<L+DLPTX\`dhpx|%= AT&T Secure Data STU III Model 1910,ATQ0E1X4 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 0T\#dhx|L+  (} AT&T KeepinTouch V.32bis Card ModemATP ATT ,ATQ0E1X4\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N3-J1 AT\N1 AT%C3"H3 AT%C0"H0 ATS0=1 ATS0=0 ATN0\J0 ATN1\J1 ATM1 ATM0 ATX3 # L+ $(,048<DLPTX\`dhlK Rolm 244PC or 600 Series with AT Command Set,ATQ0 OK ATDT%s ATQ0H0 ATS0=1 ATS0=0 ,4#<@LPTXL+`hpx} Atlas / Newcom 33600ixfC Data/Fax ModemATP ATT ,ATZ0&FQ0V1 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT"H3 AT"H0 AT%C1 AT%C0 ATS0=1 ATS0=0 ATN0\J0 ATN1\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 #L+ 08@HT`hpx} Motorola Codex 326X SeriesATP ATT ,ATZQ0E1V1X4Y0*DE22*MM0&C1&M0 OK ATD%s ATQ0H0 AT*MF1*FL3 AT*MF1*FL1 AT*MF0*FL0 AT*EC0*SM3*SC0 AT*SM0 AT*DC1 AT*DC0 AT*AA5S0=1 AT*AA5S0=0 AT*SC1 AT*SC0 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3*BD2 <PX#`dtx|L+} Multitech MT5634ZPXATP ATT ,ATQ0E1X4&Q0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT\N3 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 AT\J0 AT\J1 ATM1 ATM0 ATL1 ATL2 ATL3 ATX3 3com-usr-megahertz-56katlas-newcom-33600ifxCatt-1900-stu-iiiatt-1910-stu-iiiatt-7300att-dataportatt-dtdmatt-isnatt-keepintouchatt-switched-netatt7300attdtdmattisnattmodembestdatabocaccitt-v25biscardinalcermetekcompaqconcordcourierdataportdf03-acdf100-seriesdf200-seriesdigitel-dt22directfujitsugateway-telepathgdc-212a/edgegengendatacommgeneric-high-speedhhahayhayehayeshayes-1200hayes-2400hayes-high-speedhayes-accurahayes-optimahayes-ultrahst-courierintelitu-t-v250itu-t-v25ter/v250itu-t-v25bismaxtechmegahertz-att-v34megahertz-xjackmegahertz-xjack-33.6megahertz-xjack-56kmimicmicrmicromicrocmicrocomicrocommicrocom-at-modemicrocom-sx-modemicrolinkmicrolink-v250motorola-codexmotorola-fastalkmotorola-lifestylemotorola-montanamt5634zpxmultitechmwavenoneold-telebitpenrilppiracalvadicrockwell-v32rockwell-v32bisrockwell-v34rolmrolm-244pcrolm-600-seriesrolm-dcmspirit-iisportstersupsuprsuprasuprafaxmodemsuprasonicteteltelebittelepathunknownuser-definedusrusr-212ausr-courierusr-megahertz-56kusr-sportsterusr-xj1560-x2usroboticsv25bisventelzoltrixzoomzyxel+%s(%s)Unknown %s %s T=DIAL H=%s D=%s N=%s O=%s dologdial cxlogbufLOGDIAL BUFFER OVERFLOWdialtime caught SIGALRMdialint caught SIGINTddinc entry nddincttslow%s dial waitfor gotdidweget indreset resetting alarm and signal handlersdreset alarm and signal handlers reset WARNING - speed change to %ld failed. Speed changed to %ld. ,/PT@W;K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_DIAL_METHODK_TF_AREACODE111011800888877866358199610119990000K_AREACODEK_PBX_OCPK_PBX_ICPK_PBX_XCHckudial dialfail%s Failure: DIALANSWERdial display is on%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. dialtimeoutInterrupted. dialinterrupteddialfail()lbuf "%c" Call not completed. Call did not come in. dialError initializing modem. dialmodem initunknown dialunknownDIAL command + phone number too long! dial atdt xnum 1dial atdt satd%c%sckdialckdial dialhup failedSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... ATQ0 No response from modem, retrying%s... againckdial ATQ0 mdmstatckdial flocmd No response from modem, retrying%s... again No response from modem, retrying%s... againckdial wake_str mdmstatckdial default, wake stringckdial no wake_strckdial default, waiting for wake_promptckdial no wake_promptckdial got wake promptckudia xx_okckudia calling xx_ok for ECckudia xx_okWARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - Trouble enabling compression APM1;KMC%d APM0 ATS111=0 ATS111=%d S112=%d ATM1L%d%cATM0%cWARNING - I don't know how to enable autoanswer for this modem. ckdial ANSWER waitctATS2=%dS7=%d ATS7=%d%cckdial S7 mdmstatdialing Dialing: %s... ckdial waitct dial awaiting response, mymdmtypckdial modem responseVALWARNING - no carrier CNXINVINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callBusyNot connectedNot ConnectedNo dial toneNo Dial ToneNo answerNo AnswerAnsweredConnectedANSWEREDBUSYDISCONNECTNO ANSWERWRONG ADDRESSANSWEREDBUSYCHECK OPTIONSDISCONNECTEDDENIEDAU 1 dial df03 gotANERAttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:)ON LINENO CONNECTOKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDABANDONDEDNOT AVAILABLELACKS PERMISSIONNOT A DATALINEINVALID DATA LINE NUMBERINVALID GROUP NAMEBUSYDOES NOT ANSWERONLINE!Online!BUSYBusyDEAD PHONEINITIATINGBUSYCALL FAILEDNO CONNECTBUSYNO DIALTONECOMMAND ERRORIN USECONNECTPROGRAM ERROR - No response handler for modem type %d ckdial alarm offdial partialdial succeededWARNING: Carrier seems to have dropped... %sall complete: %s. Partial cC %sall complete: "%s". Partial cC %sall complete. Partial cClongjmp returns to dial routineSorry, DIAL memory buffer can't be allocated ckdial numberckdial redialInvalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. dial numberDIAL lbuf malloc ok%sDIAL rbuf malloc ok%sDIAL fbuf malloc okSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... RetT Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) ************************* HINT: interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. (Use SET HINTS OFF to suppress future hints.) ************************* %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). ckdialckdial timeout$0<VALgetok rbuf init okgetok ddincgetok:OK ERROR at atMDMECHO-t AT ATMDMECHO-Tgetok returnslongjmp returned to getok()getok timeoutgetok entry nGETOK rbuf malloc okabout to alrm_execute dook()HT`returning from alrm_execute dook()RESPONSE mdmechoSPONGERESPONSE-ARESPONSE-Cdial hayesnv lbufdial hayesnv gotdial hayesnv numericdial hayesnv suffix Local phone is ringing! No Carrier. Modem Command Error. Dial Locked. No Dialtone. Busy. Dial Locked. No Answer. Ringing... Answered by voice. Wait... CONNECT 1200/75 - Not supported by C-Kermit Ringing... Dialing... No Prompttone. RELIABLE LAPM COMPRESSED CONNECT Can't change speed to %ld Speed changed to %ld CONNECT FAST/KERMFAST/KERM RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXWAIT - CONNECTINGWAIT-CONNECTINGDELAYEDBLACKLISTEDDIAL LOCKEDRINGRING1RING2RING3ERRORCARRIERDATADIGITAL LINEDATECALLID DATETIMECALLID TIMENAMECALLID NAMENMBRCALLID NMBRMESGCALLID MESGdialhup mdmhup Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped mdmhup dialmhumdmhup localmdmhup ttchkmdmhup networkmdmhup mymdmtypmdmhup mdmtypmdmhup no MDMINFmdmhup hup_strmdmhup escbufmdmhup esc_timemdmhup pause 1 OKmdmhup net ttslow okmdmhup pause 1 OKmdmhup ttslow okmdmhup calling response functionmdmhup hangup responsemdmhup no ok_fn      0 @P`h0p1o=4?L:`;t<90(508@LTdt6. 11 1      $4DP\dCpC(722=  4H/TBd@t4A!-  * +,,4>@>P\3ht"x"""8'''. ) ==(4<D#L$T%\ ,   @,@48@)6P\hx)  /2,8<HT`p.,- ,-4 3!,"@#T \5l*x%$7&'&'6     ZZ0<DLTt|ԌԔ ԜԤԬԴԼ   ( 0 8Character Set Translation 7.0.032, 31 Jul 1999TRANSPARENTtransparentASCIIasciiISO 8859-1 Latin-1I6/100latin1-isoISO 8859-2 Latin-2I6/101latin2-isoISO 8859-5 Latin/CyrillicI6/144cyrillic-isoJapanese EUCI14/87/13japanese-eucISO 8859-8 Latin/HebrewI6/138hebrew-isoISO 8859-7 Latin/GreekI6/126greek-isoISO 8859-15 Latin-9I6/203latin9-isoISO 10646 / Unicode UCS-2I162ucs2ISO 10646 / Unicode UTF-8I190utf8asciicyrillic-isoelot928-greekgreek-isohebrew-isojapanese-eucllalatlatilatinlatin1-isolatin2-isolatin9-isotransparentucs2utf8US ASCIIasciiBritish/UK ISO-646britishDutch ISO-646dutchFinnish ISO-646finnishFrench ISO-646frenchCanadian-French NRCcanadian-frenchGerman ISO-646germanHungarian ISO-646hungarianItalian ISO-646italianNorwegian/Danish ISO-646norwegian/danishPortuguese ISO-646portugueseSpanish ISO-646spanishSwedish ISO-646swedishSwiss NRCswissISO 8859-1 Latin-1latin1-isoISO 8859-2 Latin-2latin2-isoDEC Multinationaldec-multinationalNeXT Multinationalnext-multinationalPC Code Page 437cp437PC Code Page 850cp850PC Code Page 852cp852Apple Macintosh Latinmacintosh-latinData General Internationaldg-internationalHewlett Packard Roman8hp-roman8ISO 8859-5 Latin/Cyrilliccyrillic-isoCP866 Cyrilliccp866Short KOIshort-koiOld KOI-8 Cyrillickoi8-cyrillicJapanese JIS7jis7-kanjiJapanese Shift JISshift-jis-kanjiJapanese EUCjapanese-eucJapanese DEC Kanjidec-kanjiHebrew-7 DEChebrew-7ISO 8859-8 Latin/Hebrewhebrew-isoCP862 Hebrewcp862-hebrewELOT 927 Greekelot927-greekISO 8859-7 Latin/Greekgreek-isoCP869 Greekcp869-greekISO 8859-15 Latin-9latin9-isoPC Code Page 858cp858PC Code Page 855cp855-cyrillicWindows Code Page 1251cp1251-cyrillicBulgarian PC Code Pagebulgaria-pcWindows Code Page 1250cp1250Polish Mazovia PC Code Pagemazovia-pcISO 10646 / Unicode UCS-2ucs2ISO 10646 / Unicode UTF-8utf8apple-quickdrawasciibritishbulgaria-pccanadian-frenchcp1250cp1251-cyrilliccp1252cp437cp850cp852cp855-cyrilliccp858cp862-hebrewcp866-cyrilliccp869-greekcyrillic-isodanishdec-kanjidec-multinationaldg-internationaldutchelot927-greekelot928-greekfinnishfrenchfr-canadiangermangreek-isohehebhebrhebrehebrewhebrew-7hebrew-isohp-roman8hungarianitalianjapanese-eucjis7-kanjikoi8-cyrillicllalatlatilatinlatin1-isolatin2-isolatin9-isomacintosh-latinmazovia-pcnext-multinationalnorwegianportugueseshift-jis-kanjishort-koispanishswedishswissucs2utf8apple-quickdrawasciibritishbulgaria-pccanadian-frenchcp1250cp1251-cyrilliccp1252cp437cp850cp852cp855-cyrilliccp858cp862-hebrewcp866-cyrilliccp869-greekcyrillic-isodanishdec-multinationaldg-internationaldutchelot927-greekelot928-greekfinnishfrenchfr-canadiangermangreek-isohehebhebrhebrehebrewhebrew-7hebrew-isohp-roman8hungarianitaliankoi8-cyrillicllalatlatilatinlatin1-isolatin2-isolatin9-isomacintosh-latinmazovia-pcnext-multinationalnorwegianportugueseshort-koispanishswedishswisstransparentASCII (American English)DanishDutchFinnishFrenchGermanGreekHebrewHungarianIcelandicItalianJapaneseNorwegianPortugueseRussianSpanishSwedishSwissasciidanishdutchenglishfinnishfrenchgermangreekhebrewhungarianicelandicitalianjapanesenorwegiannoneportugueserussianspanishswedishukrainiansetxlatype fcssetxlatype tcssetxlatype bad tcssetxlatype bad fcssetxlatype transparent because TCS==Transparentsetxlatype transparent because TCS==FCSsetxlatype Unicode tcssetxlatype Unicode fcssetxlatype Japanese tcssetxlatype Japanese fcssetxlatype Byte tcssetxlatype Byte fcssetxlatype xlatype $! ( 4@H T `l t | ԄZ$, 4< DThx  }}}}$,<DLTX d lt|~dl, 6\6h6p6t6x999666 ' (4@LXhx !#.;:<@^{TX*\`.d`hl?t|xq؀_؄،sؔ7ؘ5؜6ؤ7بذ7ظktQ&\B*$,04<HLP\dhpGtG|;وِ٘(٠٬ ٴ2ٸ ټO <@0h  , 08@HP T\ dltHxH|iڄڈڐژڠڨuڬڸ   gV/+- 9 [$[,[4[D~LPX\}dhpox|ۄیvېdۘ۠vۨm۰۸l]PPP]^{D $r,Z4<0@HfPT\dh3lpx܀܄w܈ܐܘܜܤܬܴESSS`n8 $,&4e8e@eHPCT`Chpx݈݀yݐݔwݜݤݬݴݼ))) (, 08 @HP!T!X!`h"l"t"ހވ1ސޘQޠNިް$޸W޼Wxs,%&z?>$,I4'8DAHALATA\ahapxJ|,߄%ߌNߐߔXߜXߤ߰Y߸TUTrustees of Columbia University in the City of New York. Type INTRO for a brief introduction to C-Kermit. Type VERSION for version and copyright information. Type HELP followed by a command name for help about a specific command. Type MANUAL to access the C-Kermit manual page. Type NEWS for news about new features. Type SUPPORT to learn how to get technical support. Press ? (question mark) at the prompt, or anywhere within a command, for a menu (context-sensitive help, menu on demand). Type HELP OPTIONS for help with command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support.More info at the Kermit Project website, http://www.columbia.edu/kermit/. D,xH0Welcome to C-Kermit 7.0.195 Beta.This is a TEST version, not for production use. Major new features (not necessarily available on all platforms) include: . Configurability as an Internet Kermit Service Daemon. . Fast Kermit protocol settings are now the default (HELP FAST). . File-transfer selection and other option switches (HELP SEND, HELP GET). . File-transfer pipes and filters. . New streaming Kermit protocol for reliable connections. . More-flexible wildcards for filename matching (HELP WILDCARD). . Numerous modem and dialing improvements. . More/higher serial speeds on most platforms (SET SPEED ?). . New data-bits/parity/stop-bits options (HELP SET SERIAL). . File-permission preservation in UNIX and VMS. . Improvements in CD and other directory-related commands. . Greek character sets. . New Euro-compliant and other character sets. . Automatic character-set switching (HELP ASSOCIATE). . New script programming features, functions, and variables. . New selection of transaction-log formats (HELP SET TRANSACTION-LOG). . New MANUAL command to access online documentation (HELP MANUAL). . Performance improvements. . Bug fixes. These new features are documented in the ckermit2.txt file, to be used asa supplement to the manual, "Using C-Kermit", second edition (1997). If the release date shown by the VERSION command is long past, be sure tocheck with the Kermit Project to see if there have been updates.Welcome to UNIX C-Kermit communications software for: . Error-free and efficient file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing . TCP/IP network connections While typing commands, you may use the following special characters: . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. . CTRL-W: Delete the most recent word typed. . CTRL-U: Delete the current line. . CTRL-R: Redisplay the current line. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-N: Command recall - go forward in command recall buffer. . ? (question mark) Display a menu for the current command field. . ESC (or TAB) Attempt to complete the current field. . \ (backslash) include the following character literally or introduce a backslash code, variable, or function. Command words other than filenames can be abbreviated in most contexts. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request general help HELP command request help about the given command TAKE execute commands from a file TYPE display a file on your screen Commands for file transfer: SEND send files RECEIVE receive files GET get files from a Kermit server RESEND recover an interrupted send REGET recover an interrupted get from a server SERVER be a Kermit server File-transfer speed selection: FAST use fast settings -- THIS IS THE DEFAULT CAUTIOUS use slower, more cautious settings ROBUST use extremely slow and cautious settings File-transfer performance fine tuning: SET RECEIVE PACKET-LENGTH Kermit packet size SET WINDOW number of sliding window slots SET PREFIXING amount of control-character prefixing Important settings: SET PARITY communications parity SET FLOW communications flow control, such as RTS/CTS SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET DIAL DIRECTORY specify dialing directory file (optional) SET DIAL COUNTRY-CODE country you are dialing from (*) SET DIAL AREA-CODE area-code you are dialing from (*) LOOKUP lookup entries in your dialing directory (*) SET MODEM TYPE select modem type SET LINE select serial communication device SET SPEED select communication speed DIAL dial the phone number CONNECT begin terminal connectionFurther info: HELP DIAL, HELP SET MODEM, HELP SET LINE, HELP SET DIAL(*) (For use with optional dialing directory) To make a network connection: SET NETWORK DIRECTORY Specify a network services directory (optional) LOOKUP Lookup entries in your network directory SET NETWORK TYPE Select network type (if more than one available) SET HOST Make a network connection but stay in command mode CONNECT Begin terminal connection TELNET Select a TCP/IP host and CONNECT to it To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: The Kermit Project E-mail: kermit-orders@columbia.edu Columbia University Web: http://www.columbia.edu/kermit/ 612 West 115th Street Voice: +1 (212) 854-3703 New York NY 10025-7799 Fax: +1 (212) 663-8202 USASyntax: SCREEN { CLEAR, CLEOL, MOVE row column } Performs screen-formatting actions. Correct operation of these commands depends on proper terminal setup on both ends of the connection -- mainly that the host terminal type is set to agree with the kind of terminal or the emulation you are viewing C-Kermit through. SCREEN CLEAR Moves the cursor to home position and clears the entire screen. Synonyms: CLS, CLEAR SCREEN. SCREEN CLEOL Clears from the current cursor position to the end of the line. SCREEN MOVE row column Moves the cursor to the indicated row and column. The row and column numbers are 1-based so on a 24x80 screen, the home position is 1 1 and the lower right corner is 24 80. If a row or column number is given that too large for what Kermit or the operating system thinks is your screen size, the appropriate number is substituted. Also see: SHOW VARIABLE TERMINAL, SHOW VARIABLE COLS, SHOW VAR ROWS, SHOW COMMAND. 8  !!!!\!|!!!!!"8""##L#P#\#Syntax: INPUT { number-of-seconds, time-of-day } [ text ]Example: INPUT 5 Login: or INPUT 23:59:59 RING Waits up to the given number of seconds, or until the given time of day for the given text to arrive on the connection. If no text is given, INPUT waits for any character. For use in script programs with IF FAILURE and IF SUCCESS. Also see MINPUT, REINPUT, SET INPUT. See HELP PAUSE for details on time-of-day format.$$D$x$% %\%%Syntax: OUTPUT text Sends the text out the communications connection, as if you had typed it during CONNECT mode. The text may contain backslash codes, variables, etc, plus the following special codes: \N - Send a NUL (ASCII 0) character (you can't use \0 for this). \B - Send a BREAK signal. \L - Send a Long BREAK signal. Also see SET OUTPUT.%&&T&&&''8'\'`'xSET PARITY NONE Chooses 8 data bits and no parity. SET PARITY { EVEN, ODD, MARK, SPACE } Chooses 7 data bits plus the indicated kind of parity. Forces 8th-bit prefixing during file transfer. SET PARITY HARDWARE { EVEN, ODD } Chooses 8 data bits plus the indicated kind of parity. Also see SET TERMINAL BYTESIZE, SET SERIAL, and SET STOP-BITS.''''( (H(|(((()$Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt or followed by ? to see other options. You may also enter the escape character as ^X (circumflex followed by aletter or one of: @, ^, _, [, \, or ], to indicate a control character;for example, SET ESC ^_ sets your escape character to Ctrl-Underscore.)X)t)**D*H**+ SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character, normally 0. SET OUTPUT SPECIAL-ESCAPES { ON, OFF } Whether to process the special OUTPUT-only escapes \B, \L, and \N. Normally ON (they are processed).+H+d++++,0,TSyntax: SET INPUT parameter value SET INPUT AUTODOWNLOAD { ON, OFF } Controls whether autodownloads are allowed during INPUT command execution. SET INPUT BUFFER-LENGTH number-of-bytes Removes the old INPUT buffer and creates a new one with the given length. SET INPUT CANCELLATION { ON, OFF }Whether an INPUT in progress can be can interrupted from the keyboard. SET INPUT CASE { IGNORE, OBSERVE } Tells whether alphabetic case is to be significant in string comparisons. This setting is local to the current macro or command file, and is inherited by subordinate macros and take files. SET INPUT ECHO { ON, OFF } Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUT command times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT } Tells whether to proceed or quit from a script program if an INPUT command fails. PROCEED (default) allows use of IF SUCCESS / IF FAILURE commands. This setting is local to the current macro or command file, and is inherited by subordinate macros and take files.,x,,,---@----..$.p.../ /X/\/x///0 0p0118SET FUNCTION DIAGNOSTICS { ON, OFF } Whether to issue diagnostic messages for illegal function calls and references to nonexistent built-in variables. ON by default. SET FUNCTION ERROR { ON, OFF } Whether an illegal function call or reference to a nonexistent built-in variable should cause a command to fail. OFF by default.112 2`2d223 Syntax: SET PROTOCOL { KERMIT, XMODEM, YMODEM, ZMODEM } [ s1 s2 s3 s4 s5 s6 ] Selects protocol to use for transferring files. s1 and s2 are commands to output prior to SENDing with this protocol, to automatically start the RECEIVE process on the other end in binary or text mode, respectively. If the protocol is KERMIT, s3 is the command to start a Kermit server on the remote computer, and there are no s4-s6 commands. Otherwise, s3 and s4 are commands used on this computer for sending files with this protocol in binary or text mode, respectively; s5 and s6 are the commands for receiving files with this protocol. Use "%s" in any of these strings to represent the filename(s). Use { braces } if any command contains spaces. Examples: set proto kermit {kermit -YQir} {kermit -YQTr} {kermit -YQx} set proto ymodem rb {rb -a} {sb %s} {sb -a %s} rb rb External protocols require REDIRECT and external file transfer programs thatuse redirectable standard input/output.303344h455P556(6@6D66677@7Syntax: BYE Shut down and log out a remote Kermit serverSyntax: DIRECTORY [ switches ] [ filespec ] Lists files. The filespec may be a filename, possibly containing wildcard characters, or a directory name. If no filespec is given, all files in the current directory are listed. If a directory name is given, all the files in it are listed. Optional switches: /BRIEF List filenames only. /VERBOSE + Also list permissions, size, and date. /FILES Show files but not directories. /DIRECTORIES Show directories but not files. /ALL + Show both files and directories. /ARRAY:&a Store file list in specified array (e.g. \%a[]). /PAGE Pause after each screenful. /NOPAGE Don't pause after each screenful. /DOTFILES Include files whose names start with dot (period). /NODOTFILES + Don't include files whose names start with dot. /BACKUP + Include backup files (names end with .~n~). /NOBACKUP Don't include backup files. /HEADING Include heading and summary. /NOHEADING + Don't include heading or summary. /XFERMODE Show pattern-based transfer mode (T=Text, B=Binary). /MESSAGE:text Add brief message to each listing line. /NOMESSAGE + Don't add message to each listing line. /NOXFERMODE + Don't show pattern-based transfer mode /ISODATE + In verbose listings, show date in ISO 8061 format. /ENGLISHDATE In verbose listings, show date in "English" format. /RECURSIVE Descend through subdirectories. /NORECURSIVE + Don't descend through subdirectories. /SORT:key Sort by key, NAME, DATE, or SIZE; default key is NAME. /NOSORT + Don't sort. /ASCENDING + If sorting, sort in ascending order. /REVERSE If sorting, sort in reverse order. Factory defaults are marked with +. Default for paging depends on SETCOMMAND MORE-PROMPTING. Use SET OPTIONS DIRECTORY [ switches ] to changedefaults; use SHOW OPTIONS to display customized defaults.778H88999<9x99::X::;;H;;;<>`>>>>?<??Syntax: DELETE [ switches... ] filespec Deletes a file or files on the computer where C-Kermit is running. The filespec may denote a single file or can include wildcard characters to match multiple files. RM is a synonym for DELETE. Switches include: /AFTER:date-time Specifies that only those files modified after the given date-time are to be deleted. HELP DATE for info about date-time formats. /BEFORE:date-time Specifies that only those files modified before the given date-time are to be deleted. /NOT-AFTER:date-time Specifies that only those files modified at or before the given date-time are to be deleted. /NOT-BEFORE:date-time Specifies that only those files modified at or after the given date-time are to be deleted. /LARGER-THAN:number Specifies that only those files longer than the given number of bytes are to be deleted. /SMALLER-THAN:number Specifies that only those files smaller than the given number of bytes are to be sent. /EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename or may contain wildcards, are not to be deleted. To specify multiple patterns (up to 8), use outer braces around the group and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...} /DOTFILES Include (delete) files whose names begin with ".". /NODOTFILES Skip (don't delete) files whose names begin with ".". /LIST List each file and tell whether it was deleted. Synonyms: /LOG, /VERBOSE. /NOLIST Don't list files while deleting. Synonyms: /NOLOG, /QUIET. /HEADING Print heading and summary information. /NOHEADING Don't print heading and summary information. /PAGE If listing, pause after each screenful. /NOPAGE Don't pause after each screenful. /ASK Interactively ask permission to delete each file. /NOASK Delete files without asking permission. /SIMULATE Preview files selected for deletion without actually deleting them. Implies /LIST. Use SET OPTIONS DELETE to make selected switches effective for every DELETEcommand unless you override them; use SHOW OPTIONS to see selections currentlyin effect. Also see HELP PURGE, HELP WILDCARD.@\@@AAdAhA|ABB B BhBBBBCCCChCCCCCCDDdDtDxDDEEhEEEEEFFFFLFPFXFFFFFGG0G4G@GpGtG|GGGGGGHHH$HPHTH`HHHI I\IASSOCIATE FILE-CHARACTER-SET Tells C-Kermit that whenever the given file-character set is selected, and SEND CHARACTER-SET (q.v.) is AUTOMATIC, the given transfer character-set is selected automatically. ASSOCIATE XFER-CHARACTER-SET Tells C-Kermit that whenever the given transfer-character set is selected, either by command or by an announcer attached to an incoming text file, and SEND CHARACTER-SET is AUTOMATIC, the specified file character-set is to be selected automatically. Synonym: ASSOCIATE TRANSFER-CHARACTER-SET. Use SHOW ASSOCIATIONS to list the current character-set associations, andSHOW CHARACTER-SETS to list the current settings.JKKXKKKLL`LLMDMHMMA "wildcard" is notation used in a filename to match multiple files.For example, in "send *.txt" the asterisk is a wildcard. Kermit commandsthat accept filenames also accepts wildcards, except commands that areallowed to operate on only one file, such as TRANSMIT or COPY.This version of Kermit accepts the following wildcards: * Matches any sequence of zero or more characters. For example, "ck*.c" matches all files whose names start with "ck" and end with ".c" including "ck.c". ? Matches any single character. For example, "ck?.c" matches all files whose names are exactly 5 characters long and start with "ck" and end with ".c". When typing commands at the prompt, you must precede any question mark to be used for matching by a backslash (\) to override the normal function of question mark, which is providing menus and file lists. [abc] Square brackets enclosing a list of characters matches any character in the list. Example: ckuusr.[ch] matches ckuusr.c and ckuusr.h. [a-z] Square brackets enclosing a range of characters matches any character in the range; a hyphen (-) separates the low and high elements of the range. For example, [a-z] matches any character from a to z. [acdm-z] Lists and ranges may be combined. This example matches a, c, d, or any letter from m through z. {string1,string2,...} Braces enclose a list of strings to be matched. For example: ck{ufio,vcon,cmai}.c matches ckufio.c, ckvcon.c, or ckcmai.c. The strings may themselves contain *, ?, [abc], [a-z], or other lists of strings. To force a special pattern character to be taken literally, precede it witha backslash, e.g. [a\-z] matches a, hyphen, and z rather than a through z. The same wildcard syntax can be used for patterns in the IF MATCH command,in SWITCH case labels, the \fsearch(), \frsearch(), and \farraylook()functions, and in file patterns (see HELP IF, HELP SWITCH, HELP FUNC,HELP SET FILE).NNLNNO OXO\OOPPPLPPQ(QxQ|QQRRR RlRRRSSLShSlSSTT\T`TTTUHUUUFAST, CAUTIOUS, and ROBUST are predefined macros that set severalfile-transfer parameters at once to achieve the desired file-transfer goal.FAST chooses a large packet size, a large window size, and a fair amount ofcontrol-character unprefixing at the risk of possible failure on someconnections. FAST is the default tuning in C-Kermit 7.0 and later. In caseFAST file transfers fail for you on a particular connection, try CAUTIOUS.If that fails too, try ROBUST. You can also change the definitions of eachmacro with the DEFINE command. To see the current definitions, type"show macro fast", "show macro cautious", or "show macro robust".VVW$WpWXXTXXY,Syntax: PURGE [ switches ] [ filespec ] Deletes backup files; that is, files whose names end in ".~n~", where n is a number. PURGE by itself deletes all backup files in the current directory. Switches: /AFTER:date-time Specifies that only those files modified after the given date-time are to be purged. HELP DATE for info about date-time formats. /BEFORE:date-time Specifies that only those files modified before the given date-time are to be purged. /NOT-AFTER:date-time Specifies that only those files modified at or before the given date-time are to be purged. /NOT-BEFORE:date-time Specifies that only those files modified at or after the given date-time are to be purged. /LARGER-THAN:number Specifies that only those files longer than the given number of bytes are to be purged. /SMALLER-THAN:number Specifies that only those files smaller than the given number of bytes are to be sent. /EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename or may contain wildcards, are not to be purged. To specify multiple patterns (up to 8), use outer braces around the group and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...} /DOTFILES Include (purge) files whose names begin with ".". /NODOTFILES Skip (don't purge) files whose names begin with ".". /KEEP:n Retain the 'n' most recent (highest-numbered) backup files for each file. By default, none are kept. If /KEEP is given without a number, 1 is used. /LIST Display each file as it is processed and say whether it is purged or kept. Synonyms: /LOG, /VERBOSE. /NOLIST The PURGE command should operate silently (default). Synonyms: /NOLOG, /QUIET. /HEADING Print heading and summary information. /NOHEADING Don't print heading and summary information. /PAGE When /LIST is in effect, pause at the end of each screenful, even if COMMAND MORE-PROMPTING is OFF. /NOPAGE Don't pause, even if COMMAND MORE-PROMPTING is ON. /ASK Interactively ask permission to delete each backup file. /NOASK Purge backup files without asking permission. /SIMULATE Inhibits the actual deletion of files; use to preview which files would actually be deleted. Implies /LIST. Use SET OPTIONS PURGE [ switches ] to change defaults; use SHOW OPTIONS todisplay customized defaults. Also see HELP DELETE, HELP WILDCARD.YXYYZZ,Z0ZDZZZZ[0[D[H[`[[[[\(\<\@\T\\\\]],]0]@]]^ ^H^L^t^x^^^^___ _X___`` `$`,`d```````aaaPataxaaaabbb b<b@bLbbbccTSyntax: CLOSE [ item ] Close the indicated item. The default item is CONNECTION, which is the current SET LINE or SET HOST connection. The other items are: CX-LOG (connection log, opened with LOG CX) SESSION-LOG (opened with LOG SESSION) TRANSACTION-LOG (opened with LOG TRANSACTIONS) PACKET-LOG (opened with LOG PACKETS) DEBUG-LOG (opened with LOG DEBUG) READ-FILE (opened with OPEN READ) WRITE-FILE (opened with OPEN WRITE or OPEN APPEND) Type HELP LOG and HELP OPEN for further info.ddeeDeHeeeffDfpfffSyntax: MINPUT n [ string1 [ string2 [ ... ] ] ]Example: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RING For use in script programs. Waits up to n seconds for any one of the strings to arrive on the communication device. If no strings are given, the command waits for any character at all to arrive. Strings are separated by spaces; use { braces } for grouping. If any of the strings is encountered within the timeout interval, the command succeeds and the \v(minput) variable is set to the number of the string that was matched: 1, 2, 3, etc. If none of the strings arrives, the command times out, fails, and \v(minput) is set to 0. Also see: INPUT, REINPUT, SET INPUT.ggPggh$hlhiiPiiiiSyntax: CONNECT (or C, or CQ) [ switches ] Connect to a remote computer via the serial communications device given in the most recent SET LINE command, or to the network host named in the most recent SET HOST command. Type the escape character followed by C to get back to the C-Kermit prompt, or followed by ? for a list of CONNECT-mode escape commands. Include the /QUIETLY switch to suppress the informational message thattells you how to escape back, etc. CQ is a synonym for CONNECT /QUIETLY. Other switches include: /TRIGGER:string One or more strings to look for that will cause automatic return to command mode. To specify one string, just put it right after the colon, e.g. "/TRIGGER:Goodbye". If the string contains any spaces, you must enclose it in braces, e.g. "/TRIGGER:{READY TO SEND...}". To specify more than one trigger, use the following format: /TRIGGER:{{string1}{string2}...{stringn}} Upon return from CONNECT mode, the variable \v(trigger) is set to the trigger string, if any, that was actually encountered. This value, like all other CONNECT switches applies only to the CONNECT command with which it is given, and overrides (temporarily) any global SET TERMINAL TRIGGER string that might be in effect.j$jPjjk<kkkkl4l8lPlTldllm<mmmmmn@nno$oHSyntax: MGET [ switches... ] remote-filespec [ remote-filespec ... ] Just like GET (q.v.) except allows a list of remote file specifications,separated by spaces.opppPphSyntax: GET [ switches... ] remote-filespec [ as-name ] Tells the other Kermit, which must be in (or support autoswitching into) server mode, to send the named file or files. If the remote-filespec or the as-name contain spaces, they must be enclosed in braces. Optional switches include: /AS-NAME:text Specifies "text" as the name to store the incoming file under. You can also specify the as-name as the second filename on the GET command line. /BINARY Performs this transfer in binary mode without affecting the global transfer mode. /COMMAND Receives the file into the standard input of a command, rather than saving it on disk. The /AS-NAME or the second "filename" on the GET command line is interpreted as the name of a command. /DELETE Asks the other Kermit to delete the file (or each file in the group) after it has been transferred successfully. /EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename, or may contain "*" and/or "?" metacharacters, are to be refused. To specify multiple patterns (up to 8), use outer braces around the group, and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...} /FILENAMES:{CONVERTED,LITERAL} Overrides the global SET FILE NAMES setting for this transfer only. /FILTER:command Causes the incoming file to passed through the given command (standard input/output filter) before being written to disk. /MOVE-TO:directory-name Specifies that each file that arrives should be moved to the specified directory after, and only if, it has been received successfully. /PATHNAMES:{OFF,ABSOLUTE,RELATIVE,AUTO} Overrides the global SET RECEIVE PATHNAMES setting for this transfer. /QUIET When sending in local mode, this suppresses the file-transfer display. /RECOVER Used to recover from a previously interrupted transfer; GET /RECOVER is equivalent REGET. Works only in binary mode. /RECURSIVE Tells the server to descend through the directory tree when locating the files to be sent. /RENAME-TO:string Specifies that each file that arrives should be renamed as specified after, and only if, it has been received successfully. The string should normally contain variables like \v(filename) or \v(filenum). /TEXT Performs this transfer in text mode without affecting the global transfer mode. Also see HELP MGET, HELP SEND, HELP RECEIVE, HELP SERVER, HELP REMOTE.ppqqPqqqqrrLr`rdrlrrrrs(stsssst(t,t<ttuuXu\uuuuuvvPvvvvw4w8w`wwwxxxxXxxxxxyyy\yyyyz8zLzPzSyntax: LOG (or L) filename [ { NEW, APPEND } ] Record information in a log file: CX Connections made with SET LINE, SET PORT, SET HOST, DIAL, TELNET, etc. The default filename is CX.LOG in your home directory and APPEND is the default mode for opening. DEBUG Debugging information, to help track down bugs in the C-Kermit program. The default log name is debug.log in current directory. PACKETS Kermit packets, to help with protocol problems. The default filename is packet.log in current directory. SESSION Records your CONNECT session (default: session.log in current directory). TRANSACTIONS Names and statistics about files transferred (default: transact.log in current directory; see HELP SET TRANSACTION-LOG for transaction-log format options.) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created (except APPEND isthe default for the connection log). Use CLOSE to stop logging. Note: The filename can also be a pipe, e.g.: log transactions |lpr log debug {| grep "^TELNET" > debug.log} Braces are required if the pipeline or filename contains spaces.{{{||| |X||||}}T}X}`}}}}~(~,~<~~~~8 LPSyntax: SCRIPT text A limited and cryptic "login assistant", carried over from old C-Kermit releases for comptability, but not recommended for use. Instead, please use the full script programming language described in chapters 17-19 of "Using C-Kermit". Login to a remote system using the text provided. The login script is intended to operate similarly to UNIX uucp "L.sys" entries. A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and 'send' is the names, numbers, etc, to return. The send may also be the keyword EOT to send Control-D, or BREAK (or \\b) to send a break signal. Letters in send may be prefixed by ~ to send special characters: ~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don't append a return, and ~o[o[o]] for octal of a character. As with some UUCP systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect, e.g. ~0 or two adjacent dashes, causes a short delay. If you expect that a sequence might not arrive, as with uucp, conditional sequences may be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.(< 48lHL$(t$(LPSyntax: TYPE [ switches... ] file Displays a file on the screen. Pauses automatically at end of each screenful if COMMAND MORE-PROMPTING is ON. Optional switches: /PAGE Pause at the end of each screenful even if COMMAND MORE-PROMPTING OFF. Synonym: /MORE /NOPAGE Don't pause at the end of each screen even if COMMAND MORE-PROMPTING ON. /HEAD:n Only type the first 'n' lines of the file. /TAIL:n Only type the last 'n' lines of the file. /MATCH:pattern Only type lines that match the given pattern. HELP WILDCARDS for info info about patterns. /HEAD and /TAIL apply after /MATCH. /PREFIX:string Print the given string at the beginning of each line. /WIDTH:number Truncate each line at the given column number before printing. /COUNT Count lines (and matches) and print the count(s) but not the lines. You can use SET OPTIONS TYPE to set the defaults for /PAGE or /NOPAGE and/WIDTH. Use SHOW OPTIONS to see current TYPE options.80<dHT(Syntax: CLEAR [ item-name ] Clears the named item. If no item is named, DEVICE-AND-INPUT is assumed. ALARM Clears any pending alarm (see SET ALARM). APC-STATUS Clears Application Program Command status. BINARY-PATTERNS Clears the file binary-patterns list. DEVICE Clears the current port or network input buffer. DEVICE-AND-INPUT Clears both the device and the INPUT buffer. DIAL-STATUS Clears the \v(dialstatus) variable. INPUT Clears the INPUT command buffer and the \v(input) variable. SEND-LIST Clears the current SEND list (see ADD). TEXT-PATTERNS Clears the file text-patterns list.DD|@Syntax: DATE [ date-time ] Prints the current date and time in standard format: yyyymmdd_hh:mm:ss. If a date-time is given, converts it to standard format. Various date-time formats are acceptable. The rules for the date-time are: . The date, if given, must precede the time. . The year must be four digits. . If the year comes first, the second field is the month. . The day, month, and year may be separated by spaces, /, -, or underscore. . The date and time may be separated by spaces or underscore. . The month may be numeric (1 = January) or spelled out or abbreviated in English. . The time may be in 24-hour format or 12-hour format. . If the hour is 12 or less, AM is assumed unless AM or PM is included. . If the date is omitted but a time is given, the current date is assumed. . If the time is given but date omitted, 00:00:00 is assumed. . If both the date and time are omitted, the current date and time are assumed. The following shortcuts can also be used: TODAY Today's date, optionally followed by a time; 00:00:00 if no time given. YESTERDAY Yesterday's date, optionally followed by a time (default 00:00:00). TOMORROW Tomorrows's date, optionally followed by a time (default 00:00:00). + A date in the future relative to the current date; may be DAYS WEEKS, MONTHS, or YEARS. Optionally followed by a time (default 00:00:00). Examples: +3days, +7weeks. - A date in the past relative to the current date, optionally followed by a time (default 00:00:00). Examples: -1year, -37months. All the formats shown above are acceptable as arguments to date-time switchessuch as /AFTER: or /BEFORE, and to functions such as \fcvtdate() that takedate-time strings as arguments.|4ptT,xTdhDHTXx| pSyntax: SEND (or S) [ switches...] [ filespec [ as-name ] ] Sends the file or files specified by filespec. If the filespec is omitted the SEND-LIST is used (HELP ADD for more info). The filespec may contain wildcard characters. An 'as-name' may be given to specify the name(s) the files(s) are sent under; if the as-name is omitted, each file is sent under its own name. Also see HELP MSEND, HELP WILDCARD. Optional switches include: /AS-NAME: Specifies as the name to send the file under instead of its real name. This is equivalent to giving an as-name after the filespec. /BINARY Performs this transfer in binary mode without affecting the global transfer mode. /TEXT Performs this transfer in text mode without affecting the global transfer mode. /NOBACKUP Skip (don't send) Kermit or EMACS backup files (files with names that end with .~n~, where n is a number). /DOTFILES Include (send) files whose names begin with ".". /NODOTFILES Don't send files whose names begin with ".". /COMMAND Sends the output from a command, rather than the contents of a file. The first "filename" on the SEND command line is interpreted as the name of a command; the second (if any) is the as-name. /FILENAMES:{CONVERTED,LITERAL} Overrides the global SET FILE NAMES setting for this transfer only. /PATHNAMES:{OFF,ABSOLUTE,RELATIVE} Overrides the global SET SEND PATHNAMES setting for this transfer. /FILTER:command Specifies a command (standard input/output filter) to pass the file through before sending it. /DELETE Deletes the file (or each file in the group) after it has been sent successfully (applies only to real files). /QUIET When sending in local mode, this suppresses the file-transfer display. /RECOVER Used to recover from a previously interrupted transfer; SEND /RECOVER is equivalent RESEND (use in binary mode only). /RECURSIVE Tells C-Kermit to look not only in the given or current directory for files that match the filespec, but also in all its subdirectories, and all their subdirectories, etc. /RENAME-TO:name Tells C-Kermit to rename each source file that is sent successfully to the given name (usually you should include \v(filename) in the new name, which is replaced by the original filename. /MOVE-TO:directory Tells C-Kermit to move each source file that is sent successfully to the given directory. /STARTING:number Starts sending the file from the given byte position. SEND /STARTING:n filename is equivalent to PSEND filename n. /SUBJECT:text Specifies the subject of an email message, to be used with /MAIL. If the text contains spaces, it must be enclosed in braces. /MAIL:address Sends the file as e-mail to the given address; use with /SUBJECT:. /PRINT:options Sends the file to be printed, with optional options for the printer. /PROTOCOL:name Uses the given protocol to send the file (Kermit, Zmodem, etc) for this transfer without changing global protocol. /AFTER:date-time Specifies that only those files modified after the given date-time are to be sent. HELP DATE for info about date-time formats. /BEFORE:date-time Specifies that only those files modified before the given date-time are to be sent. /NOT-AFTER:date-time Specifies that only those files modified at or before the given date-time are to be sent. /NOT-BEFORE:date-time Specifies that only those files modified at or after the given date-time are to be sent. /LARGER-THAN:number Specifies that only those files longer than the given number of bytes are to be sent. /SMALLER-THAN:number Specifies that only those files smaller than the given number of bytes are to be sent. /EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename, or may contain "*" and/or "?" metacharacters, are not to be sent. To specify multiple patterns (up to 8), use outer braces around the group, and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...} /LISTFILE:filename Specifies the name of a file that contains the list of names of files that are to be sent. The filenames should be listed one name per line in this file (but a name can contain wildcards). Also see HELP RECEIVE, HELP GET, HELP SERVER, HELP REMOTE.d8X\l Thlt$LP\(t< T4hlx 04D $l(t dhx X $pdtxP$(PTh04pSyntax: RECEIVE (or R) [ switches... ] [ as-name ] Wait for a file to arrive from the other Kermit, which must be given a SEND command. If the optional as-name is given, the incoming file or files are stored under that name, otherwise it will be stored under the name it arrives with. If the filespec denotes a directory, the incoming file or files will be placed in that directory. Optional switches include: /AS-NAME:text Specifies "text" as the name to store the incoming file under. You can also specify the as-name as a filename on the command line. /BINARY Skips text-mode conversions unless the incoming file arrives with binary attribute /COMMAND Receives the file into the standard input of a command, rather than saving it on disk. The /AS-NAME or the "filename" on the RECEIVE command line is interpreted as the name of a command. /EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename, or may contain "*" and/or "?" metacharacters, are to be refused. To specify multiple patterns (up to 8), use outer braces around the group, and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...} /FILENAMES:{CONVERTED,LITERAL} Overrides the global SET FILE NAMES setting for this transfer only. /FILTER:command Causes the incoming file to passed through the given command (standard input/output filter) before being written to disk. /MOVE-TO:directory-name Specifies that each file that arrives should be moved to the specified directory after, and only if, it has been received successfully. /PATHNAMES:{OFF,ABSOLUTE,RELATIVE,AUTO} Overrides the global SET RECEIVE PATHNAMES setting for this transfer. /PROTOCOL:name Use the given protocol to receive the incoming file(s). /QUIET When sending in local mode, this suppresses the file-transfer display. /RECURSIVE Equivalent to /PATHNAMES:RELATIVE. /RENAME-TO:string Specifies that each file that arrives should be renamed as specified after, and only if, it has been received successfully. The string should normally contain variables like \v(filename) or \v(filenum). /TEXT Forces text-mode conversions unless the incoming file has the binary attribute Also see HELP SEND, HELP GET, HELP SERVER, HELP REMOTE.p8$(8|(,8`04\`(`d| 8(,8`dx LPXSyntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.$Syntax: REGET filespec Ask a server to RESEND a file to C-Kermit.pSyntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position.Syntax: MSEND [ switches... ] filespec [ filespec [ ... ] ] Sends the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. Alternative names cannot be given. Switches include /BINARY /DELETE /MAIL /PROTOCOL /QUIET /RECOVER /TEXT; see HELP SEND for descriptions.$pTADD SEND-LIST filespec [ [ ] ] Adds the specified file or files to the current SEND list. Use SHOW SEND-LIST and CLEAR SEND-LIST to display and clear the list; use SEND by itself to send the files from it. ADD BINARY-PATTERNS [ [ ... ] ] Adds the pattern(s), if any, to the SET FILE BINARY-PATTERNS list. ADD TEXT-PATTERNS [ [ ... ] ] Adds the pattern(s), if any, to the SET FILE TEXT-PATTERNS list. Use SHOW PATTERNS to see the lists. See HELP SET FILE for further info.` @REMOVE BINARY-PATTERNS [ [ ... ] ] Removes the pattern(s), if any, from the SET FILE BINARY-PATTERNS list REMOVE TEXT-PATTERNS [ [ ... ] ] Removes the given patterns from the SET FILE TEXT-PATTERNS list. Use SHOW PATTERNS to see the lists. See HELP SET FILE for further info.<TxSyntax: SERVER Enter server mode on the current connection. All further commands are taken in packet form from the other Kermit program. Use FINISH, BYE, or REMOTE EXIT to get C-Kermit out of server mode. The SET command establishes communication, file, scripting, or other parameters. The SHOW command can be used to display the values of SET parameters. Help is available for each individual parameter; type HELP SET ? to see what's available.P$PSyntax: SET KEY k textOr: SET KEY CLEAR Configure the key whose "scan code" is k to send the given text when pressed during CONNECT mode. SET KEY CLEAR restores all the default key mappings. If there is no text, the default key binding is restored for the key k. SET KEY mappings take place before terminal character-set translation. To find out the scan code and mapping for a particular key, use the SHOW KEY command.h(t0Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, or BLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3 specify more rigorous checking at the cost of higher overhead. The BLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain no blanks.` hSyntax: SET DEBUG { SESSION, ON, OFF, TIMESTAMP } SET DEBUG ON Opens a debug log file named debug.log in the current directory. Use LOG DEBUG if you want specify a different log file name or path. SET DEBUG OFF Stops debug logging and session debugging. SET DEBUG SESSION Displays control and 8-bit characters symbolically during CONNECT mode. Equivalent to SET TERMINAL DEBUG ON. SET DEBUG TIMESTAMP { ON, OFF } Enables/Disables timestamps on debug log entries.,p¸¼`ÈÌìSyntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31,127-159,255. The word "ALL" means all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL is recommended for safety. You can include multiple values in one command, separated by spaces.$ptLŘŜ04|Syntax: SET MODEM ... Note: Many of the SET MODEM parameters are configured automatically whenyou SET MODEM TYPE, according to the modem's capabilities. SHOW MODEM tosee them. Also see HELP DIAL and HELP SET DIAL. SET MODEM TYPE Tells Kermit which kind of modem you have, so it can issue the appropriate modem-specific commands for configuration, dialing, and hanging up. For a list of the modem types known to Kermit, type "set modem type ?". Use SET MODEM TYPE NONE (the default) for direct serial connections. Use SET MODEM TYPE USER-DEFINED to use a type of modem that is not built in to Kermit, and then user SET MODEM CAPABILITIES, SET MODEM DIAL-COMMAND, and SET MODEM COMMAND to tell Kermit how to configure and control it. Give the SET MODEM TYPE command BEFORE the SET LINE command so Kermit can open the communications device in the correct mode for dialing. SET MODEM CAPABILITIES Use this command for changing Kermit's idea of your modem's capabilities, for example, if your modem is supposed to have built-in error correction but in fact does not. Also use this command to define the capabilities of a USER-DEFINED modem. Capabilities are: AT AT-commands DC data-compression EC error-correction HWFC hardware-flow ITU v25bis-commands SWFC software-flow KS kermit-spoof SB speed-buffering TB Telebit SET MODEM CARRIER-WATCH { AUTO, ON, OFF } Synonym for SET CARRIER-WATCH (q.v.) SET MODEM COMPRESSION { ON, OFF } Enables/disables the modem's data compression feature, if any. SET MODEM DIAL-COMMAND The text replaces Kermit's built-in modem dialing command. It must include '%s' (percent s) as a place-holder for the telephone numbers given in your DIAL commands. SET MODEM ERROR-CORRECTION { ON, OFF } Enables/disables the modem's error-correction feature, if any. SET MODEM ESCAPE-CHARACTER number Numeric ASCII value of modem's escape character, e.g. 43 for '+'. For Hayes-compatible modems, Kermit uses three copies, e.g. "+++". SET MODEM FLOW-CONTROL {AUTO, NONE, RTS/CTS, XON/XOFF} Selects the type of local flow control to be used by the modem. SET MODEM HANGUP-METHOD { MODEM-COMMAND, RS232-SIGNAL } How hangup operations should be done. MODEM-COMMAND means try to escape back to the modem's command processor and give a modem-specific hangup command. RS232-SIGNAL means turn off the DTR signal. SET MODEM KERMIT-SPOOF {ON, OFF} If the selected modem type supports the Kermit protocol directly, use this command to turn its Kermit protocol function on or off. SET MODEM MAXIMUM-SPEED Specify the maximum interface speed for the modem. SET MODEM NAME Descriptive name for a USER-DEFINED modem. SET MODEM SPEAKER {ON, OFF} Turns the modem's speaker on or off during dialing. SET MODEM SPEED-MATCHING {ON, OFF} ON means that C-Kermit changes its serial interface speed to agree with the speed reported by the modem's CONNECT message, if any. OFF means Kermit should not change its interface speed. SET MODEM VOLUME {LOW, MEDIUM, HIGH} Selects the desired modem speaker volume for when the speaker is ON. SET MODEM COMMAND commands are used to override built-in modem commands foreach modem type, or to fill in commands for the USER-DEFINED modem type.Omitting the optional [ text ] restores the built-in modem-specific command,if any: SET MODEM COMMAND AUTOANSWER {ON, OFF} [ text ] Modem commands to turn autoanswer on and off. SET MODEM COMMAND COMPRESSION {ON, OFF} [ text ] Modem commands to turn data compression on and off. SET MODEM COMMAND ERROR-CORRECTION {ON, OFF} [ text ] Modem commands to turn error correction on and off. SET MODEM COMMAND HANGUP [ text ] Command that tells the modem to hang up the connection. SET MODEM COMMAND IGNORE-DIALTONE [ text ] Command that tells the modem not to wait for dialtone before dialing. SET MODEM COMMAND INIT-STRING [ text ] The 'text' is a replacement for C-Kermit's built-in initialization command for the modem. SET MODEM COMMAND PREDIAL-INIT [ text ] A second INIT-STRING that is to be sent to the modem just prior to dialing. SET MODEM COMMAND HARDWARE-FLOW [ text ] Modem command to enable hardware flow control (RTS/CTS) in the modem. SET MODEM COMMAND SOFTWARE-FLOW [ text ] Modem command to enable local software flow control (Xon/Xoff) in modem. SET MODEM COMMAND SPEAKER { ON, OFF } [ text ] Modem command to turn the modem's speaker on or off. SET MODEM COMMAND NO-FLOW-CONTROL [ text ] Modem command to disable local flow control in the modem. SET MODEM COMMAND PULSE [ text ] Modem command to select pulse dialing. SET MODEM COMMAND TONE [ text ] Modem command to select tone dialing. SET MODEM COMMAND VOLUME { LOW, MEDIUM, HIGH } [ text ] Modem command to set the modem's speaker volume.(TXǤ$(@Ȑ$pɼPTʠTˠ 8Xx̰̔Hpt͘Hΐΰδ $HόTXА `dш8ptҌҼ<ӈ,tx`hl՜<@xְִD׌א׸ Hؘ؜@ٌِ(dhڌڸڼ@tThe SET DIAL command establishes or changes all parameters related todialing the telephone. Also see HELP DIAL and HELP SET MODEM. Use SHOWDIAL to display all of the SET DIAL values. SET DIAL COUNTRY-CODE Tells Kermit the telephonic country-code of the country you are dialing from, so it can tell whether a portable-format phone number from your dialing directory will result in a national or an international call. Examples: 1 for USA, Canada, Puerto Rico, etc; 7 for Russia, 39 for Italy, 351 for Portugal, 47 for Norway, 44 for the UK, 972 for Israel, 81 for Japan, ... If you have not already set your DIAL INTL-PREFIX and LD-PREFIX, then this command sets default values for them: 011 and 1, respectively, for country code 1; 00 and 0, respectively, for all other country codes. If these are not your true international and long-distance dialing prefixes, then you should follow this command by DIAL INTL-PREFIX and LD-PREFIX to let Kermit know what they really are. SET DIAL AREA-CODE [ ] Tells Kermit the area or city code that you are dialing from, so it can tell whether a portable-format phone number from the dialing directory is local or long distance. Be careful not to include your long-distance dialing prefix as part of your area code; for example, the area code for central London is 171, not 0171. SET DIAL CONFIRMATION {ON, OFF} Kermit does various transformations on a telephone number retrieved from the dialing directory prior to dialing (use LOOKUP to see them). In case the result might be wrong, you can use SET DIAL CONFIRM ON to have Kermit ask you if it is OK to dial the number, and if not, to let you type in a replacement. SET DIAL CONNECT { AUTO, ON, OFF } Whether to CONNECT (enter terminal mode) automatically after successfully dialing. ON means to do this; OFF means not to. AUTO (the default) means do it if the DIAL command was given interactively, but don't do it if the DIAL command was issued from a macro or command file. If you specify ON or AUTO, you may follow this by one of the keywords VERBOSE or QUIET, to indicate whether the verbose 4-line 'Connecting...' message is to be displayed if DIAL succeeds and Kermit goes into CONNECT mode. SET DIAL CONVERT-DIRECTORY {ASK, ON, OFF} The format of Kermit's dialing directory changed in version 5A(192). This command tells Kermit what to do when it encounters an old-style directory: ASK you whether to convert it, or convert it automatically (ON), or leave it alone (OFF). Old-style directories can still be used without conversion, but the parity and speed fields are ignored. SET DIAL DIRECTORY [ filename [ filename [ filename [ ... ] ] ] ] The name(s) of your dialing directory file(s). If you do not supply any filenames, the dialing directory feature is disabled and all numbers are dialed literally as given in the DIAL command. If you supply more than one directory, all of them are searched. SET DIAL SORT {ON, OFF} When multiple entries are obtained from your dialing directory, they are sorted in "cheapest-first" order. If this does not produce the desired effect, SET DIAL SORT OFF to disable sorting, and the numbers will be dialed in the order in which they were found. SET DIAL DISPLAY {ON, OFF} Whether to display dialing progress on the screen; default is OFF. SET DIAL HANGUP {ON, OFF} Whether to hang up the phone prior to dialing; default is ON. SET DIAL IGNORE-DIALTONE {ON, OFF} Whether to ignore dialtone when dialing; default is OFF. SET DIAL MACRO [ name ] Specify the name of a macro to execute on every phone number dialed, just prior to dialing it, in order to perform any last-minute alterations. SET DIAL METHOD {AUTO, DEFAULT, TONE, PULSE} Whether to use the modem's DEFAULT dialing method, or to force TONE or PULSE dialing. AUTO (the default) means to choose tone or pulse dialing based on the country code. (Also see SET DIAL TONE-COUNTRIES and SET DIAL PULSE-COUNTRIES.) SET DIAL PACING number How many milliseconds to pause between sending each character to the modem dialer. The default is -1, meaning to use the number from the built-in modem database. SET DIAL PULSE-COUNTRIES [ cc [ cc [ ... ] ] ] Sets the list of countries in which pulse dialing is required. Each cc is a country code. SET DIAL TEST { ON, OFF } OFF for normal dialing. Set to ON to test dialing procedures without actually dialing. SET DIAL TONE-COUNTRIES [ cc [ cc [ ... ] ] ] Sets the list of countries in which tone dialing is available. Each cc is a country code. SET DIAL TIMEOUT number How many seconds to wait for a dialed call to complete. Use this command to override the DIAL command's automatic timeout calculation. A value of 0 turns off this feature and returns to Kermit's automatic dial timeout calculation. SET DIAL RESTRICT { INTERNATIONAL, LOCAL, LONG-DISTANCE, NONE } Prevents placing calls of the type indicated, or greater. For example SET DIAL RESTRICT LONG prevents placing of long-distance and international calls. If this command is not given, there are no restrictions. Useful when dialing a list of numbers fetched from a dialing directory. SET DIAL RETRIES How many times to redial each number if the dialing result is busy or no no answer, until the call is succesfully answered. The default is 0 because automatic redialing is illegal in some countries. SET DIAL INTERVAL How many seconds to pause between automatic redial attempts; default 10. The following commands apply to all phone numbers, whether given literallyor found in the dialing directory: SET DIAL PREFIX [ text ] Establish a prefix to be applied to all phone numbers that are dialed, for example to disable call waiting. SET DIAL SUFFIX [ text ] Establish a suffix to be added after all phone numbers that are dialed. The following commands apply only to portable-format numbers obtained fromthe dialing directory; i.e. numbers that start with a "+" sign andcountry code, followed by area code in parentheses, followed by the phonenumber. SET DIAL LC-AREA-CODES [ ] Species a list of area codes to which dialing is local, i.e. does not require the LD-PREFIX. Up to 32 area codes may be listed, separated by spaces. Any area codes in this list will be included in the final dial string so do not include your own area code if it should not be dialed. SET DIAL LC-PREFIX [ ] Specifies a prefix to be applied to local calls made from portable dialing directory entries. Normally no prefix is used for local calls. SET DIAL LC-SUFFIX [ ] Specifies a suffix to be applied to local calls made from portable dialing directory entries. Normally no suffix is used for local calls. SET DIAL LD-PREFIX [ ] Your long-distance dialing prefix, to be used with portable dialing directory entries that result in long-distance calls. SET DIAL LD-SUFFIX [ ] Long-distance dialing suffix, if any, to be used with portable dialing directory entries that result in long-distance calls. This would normally be used for appending a calling-card number to the phone number. SET DIAL FORCE-LONG-DISTANCE { ON, OFF } Whether to force long-distance dialing for calls that normally would be local. For use (e.g.) in France. SET DIAL TOLL-FREE-AREA-CODE [ [ [ ... ] ] ] Tells Kermit the toll-free area code(s) in your country. SET DIAL TOLL-FREE-PREFIX [ ] You toll-free dialing prefix, in case it is different from your long- distance dialing prefix. SET DIAL INTL-PREFIX Your international dialing prefix, to be used with portable dialing directory entries that result in international calls. SET DIAL INTL-SUFFIX International dialing suffix, if any, to be used with portable dialing directory entries that result in international calls. SET DIAL PBX-OUTSIDE-PREFIX Use this to tell Kermit how to get an outside line when dialing from a Private Branch Exchange (PBX). SET DIAL PBX-EXCHANGE [ [ ... ] ] If PBX-OUTSIDE-PREFIX is set, then you can use this command to tell Kermit the leading digits of one or more local phone numbers that identify it as being on your PBX, so it can make an internal call by deleting those digits from the phone number. SET DIAL PBX-INTERNAL-PREFIX If PBX-EXCHANGE is set, and Kermit determines from it that a call is internal, then this prefix, if any, is added to the number prior to dialing. Use this if internal calls from your PBX require a special prefix.|<@`ެ<ߌ<(xT 0|h|@$l,| HL(tT48T`(tD$<@\8PTlLdhD@048<X8HT PTtd(tDHLh`T0xSyntax: SET FLOW [ switch ] value Selects the type of flow control to use during file transfer, terminal connection, and script execution. Switches let you associate a particular kind of flow control with each kind of connection: /REMOTE, /MODEM, /DIRECT-SERIAL, /TCPIP, etc; type "set flow ?" for a list of available switches. Then whenever you make a connection, the associated flow-control is chosen automatically. The flow-control values are NONE, KEEP, XON/XOFF, and possibly RTS/CTS and some others; again, type "set flow ?" for a list. KEEP tells Kermit not to try to change the current flow-control method for the connection. If you omit the switch and simply supply a value, this value becomes the current flow control type, overriding any default value that might have been chosen in your most recent SET LINE, SET PORT, or SET HOST, or other connection-establishment command. Type SHOW FLOW-CONTROL to see the current defaults for each connection type as well as the current connection type and flow-control setting. SHOW COMMUNICATIONS also shows the current flow-control setting.4X\@ lpTx|XSyntax: SET FILE parameter value Sets file-related parameters. Use SHOW FILE to view them. Also see SETTRANSFER and SET PROTOCOL. SET FILE TYPE { TEXT, BINARY } How file contents are to be treated during file transfer in the absence of any other indication. TYPE can be TEXT for conversion of record format and character set, which is usually needed when transferring text files between unlike platforms (such as UNIX and Windows), or BINARY for no conversion if TRANSFER MODE is MANUAL, which is not the default. Use BINARY with TRANSFER MODE MANUAL for executable programs or binary data or whenever you wish to duplicate the original contents of the file, byte for byte. In most modern Kermit programs, the file sender informs the receiver of the file type automatically. However, when sending files from C-Kermit to an ancient or non-Columbia Kermit implementation, you might need to set the corresponding file type at the receiver as well. When TRANSFER MODE is AUTOMATIC (as it is by default), various automatic methods (depending on the platform) are used to determine whether a file is transferred in text or binary mode; these methods (which might include filename pattern matching (see SET FILE PATTERNS below), client/server "kindred-spirit" recognition, or source file record format) supersede the FILE TYPE setting but can, themselves, be superseded by including a /BINARY or /TEXT switch in the SEND, GET, or RECEIVE command. When TRANSFER MODE is MANUAL, the FILE TYPE setting takes precedence. SET FILE PATTERNS { ON, OFF, AUTO } ON means to use filename pattern lists to determine whether to send a file in text or binary mode. OFF means to send all files in the prevailing mode. AUTO (the default) is like ON if the other Kermit accepts Attribute packets and like OFF otherwise. SET FILE BINARY-PATTERNS [ [ ... ] ] Zero or more filename patterns which, if matched, cause a file to be sent in binary mode when FILE PATTERNS are ON. HELP WILDCARDS for a description of pattern syntax. SHOW PATTERNS to see the current file pattern lists. SET FILE TEXT-PATTERNS [ [ ... ] ] Zero or more filename patterns which, if matched, cause a file to be sent in text mode when FILE PATTERNS is ON; if a file does not match a text or binary pattern, the prevailing SET FILE TYPE is used. SET FILE BYTESIZE { 7, 8 } Normally 8. If 7, truncate the 8th bit of all file bytes. SET FILE CHARACTER-SET name Tells the encoding of the local file, ASCII by default. The names ITALIAN, PORTUGUESE, NORWEGIAN, etc, refer to 7-bit ISO-646 national character sets. LATIN1 is the 8-bit ISO 8859-1 Latin Alphabet 1 for Western European languages. NEXT is the 8-bit character set of the NeXT workstation. The CPnnn sets are for PCs. MACINTOSH-LATIN is for the Macintosh. LATIN2 is ISO 8859-2 for Eastern European languages that are written with Roman letters. Mazovia is a PC code page used in Poland. KOI-CYRILLIC, CYRILLIC-ISO, and CP866 are 8-bit Cyrillic character sets. SHORT-KOI is a 7-bit ASCII coding for Cyrillic. BULGARIA-PC is a PC code page used in Bulgaria HEBREW-ISO is ISO 8859-8 Latin/Hebrew. CP862 is the Hebrew PC code page. HEBREW-7 is like ASCII with the lowercase letters replaced by Hebrew. GREEK-ISO is ISO 8859-7 Latin/Greek. CP869 is the Greek PC code page. ELOT-927 is like ASCII with the lowercase letters replaced by Greek. JAPANESE-EUC, JIS7-KANJI, DEC-KANJI, and SHIFT-JIS-KANJI are Japanese Kanji character sets. Type SET FILE CHAR ? for a complete list of file character sets. SET FILE COLLISION option Tells what to do when a file arrives that has the same name as an existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if newer than the existing file. SET FILE DESTINATION { DISK, PRINTER, SCREEN, NOWHERE } DISK (default): Store incoming files on disk. PRINTER: Send incoming files to SET PRINTER device. SCREEN: Display incoming files on screen (local mode only). NOWHERE: Do not put incoming files anywhere (use for calibration). SET FILE DISPLAY option Selects the format of the file transfer display for local-mode file transfer. The choices are: BRIEF A line per file, showing size, mode, status, and throughput. SERIAL One dot is printed for every K bytes transferred. CRT Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. FULLSCREEN A fully formatted 24x80 screen showing lots of information. This requires a terminal or terminal emulator. NONE No file transfer display at all. SET FILE DOWNLOAD-DIRECTORY [ ] The directory into which all received files should be placed. By default, received files go into your current directory. SET FILE END-OF-LINE { CR, CRLF, LF } Use this command to specify nonstandard line terminators for text files. SET FILE INCOMPLETE { AUTO, KEEP, DISCARD } What to do with an incompletely received file: KEEP (default), or DISCARD. AUTO (the default) means DISCARD if transfer is in text mode, KEEP if it is in binary mode. SET FILE NAMES { CONVERTED, LITERAL } File names are normally CONVERTED to "common form" during transmission (e.g. lowercase to uppercase, extra periods changed to underscore, etc). LITERAL means use filenames literally (useful between like systems). Also see SET SEND PATHNAMES and SET RECEIVE PATHNAMES. SET FILE OUTPUT { { BUFFERED, UNBUFFERED } [ size ], BLOCKING, NONBLOCKING } Lets you control the disk output buffer for incoming files. Buffered blocking writes are normal. Nonblocking writes might be faster on some systems but might also be risky, depending on the underlying file service. Unbuffered writes might be useful in critical applications to ensure that cached disk writes are not lost in a crash, but will probably also be slower. The optional size parameter after BUFFERED or UNBUFFERED lets you change the disk output buffer size; this might make a difference in performance. SET FILE WARNING { ON, OFF } SET FILE WARNING is superseded by the newer command, SET FILE COLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAME and SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. ( D H h   P   0    p    D  $p$t48t\`0hl$l`4,x dh<t,`XPptHDH|,x|D\`  p   !@!!"("p"####<#|#$Syntax: SET HANDSHAKE { NONE, XON, LF, BELL, ESC, CODE number } Character to use for half duplex line turnaround handshake during file transfer. C-Kermit waits for this character from the other computer before sending its next packet. Default is NONE; you can give one of the other names like BELL or ESC, or use SET HANDSHAKE CODE to specify the numeric code value of the handshake character. Type SET HANDSH ? for a complete list of possibilities.& &`&&'@'''SET SERVER CD-MESSAGE {ON,OFF} Tells whether the server, after successfully executing a REMOTE CD command, should send the contents of the new directory's READ.ME (or similar) file to your screen. SET SERVER CD-MESSAGE FILE name Tells the name of the file to be displayed as a CD-MESSAGE, such as READ.ME (SHOW SERVER tells the current CD-MESSAGE FILE name). To specify more than one filename to look for, use {{name1}{name2}..}. Synonym: SET CD MESSAGE FILE . SET SERVER DISPLAY {ON,OFF} Tells whether local-mode C-Kermit during server operation should put a file transfer display on the screen. Default is OFF. SET SERVER GET-PATH [ directory [ directory [ ... ] ] ] Tells the C-Kermit server where to look for files whose names it receives from client GET commands when the names are not fully specified pathnames. Default is no GET-PATH, so C-Kermit looks only in its current directory. SET SERVER IDLE-TIMEOUT seconds Idle time limit while in server mode, 0 for no limit. NOTE: SERVER IDLE-TIMEOUT and SERVER TIMEOUT are mutually exclusive. SET SERVER KEEPALIVE {ON,OFF} Tells whether C-Kermit should send "keepalive" packets while executing REMOTE HOST commands, which is useful in case the command takes a long time to produce any output and therefore might cause the operation to time out. ON by default; turn it OFF if it causes trouble with the client or slows down the server too much. SET SERVER LOGIN [ username [ password [ account ] ] ] Sets up a username and optional password which must be supplied before the server will respond to any commands other than REMOTE LOGIN. The account is ignored. If you enter SET SERVER LOGIN by itself, then login is no longer required. Only one SET SERVER LOGIN command can be in effect at a time; C-Kermit does not support multiple user/password pairs. SET SERVER TIMEOUT n Server command wait timeout interval, how often the C-Kermit server issues a NAK while waiting for a command packet. Specify 0 for no NAKs at all. Default is 0.( (@(((())\))***0*|***+<++++,4,|,,,-8----.4..//d///00d0tThe REMOTE command sends file management instructions or other commandsto a Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'. All REMOTE commands except LOGIN and LOGOUT have R-command shortcuts;for example, RDIR for REMOTE DIR, RCD for REMOTE CD, etc.1$1l112@2|223Syntax: IF [NOT] condition commandlist If the condition is (is not) true, do the commandlist. The commandlistcan be a single command, or a list of commands separated by commas andenclosed in braces. The condition can be a single condition or a group ofconditions separated by AND (&&) or OR (||) and enclosed in parentheses.Examples: IF EXIST oofa.txt IF ( EXIST oofa.txt || = \v(nday) 3 ) IF ( EXIST oofa.txt || = \v(nday) 3 ) { , , ... } The conditions are: SUCCESS - The previous command succeeded OK - Synonym for SUCCESS FAILURE - The previous command failed ERROR - Synonym for FAILURE FLAG - Succeeds if SET FLAG ON, fails if SET FLAG OFF BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground REMOTE-ONLY - C-Kermit was started with the -R command-line option ALARM - SET ALARM time has passed ASKTIMEOUT - The most recent ASK, ASKQ, GETC, or GETOK timed out EMULATION - Succeeds if executed while in CONNECT mode AVAILABLE CRYPTO - Encryption is available AVAILABLE KERBEROS4 - Kerberos 4 authentication is available AVAILABLE KERBEROS5 - Kerberos 5 authentication is available AVAILABLE NTLM - NTLM authentication is available AVAILABLE SRP - SRP authentication is available AVAILABLE SSL - SSL/TLS authentication is available MATCH string pattern - Succeeds if string matches pattern FLOAT number - Succeeds if floating-point number COMMAND word - Succeeds if word is built-in command DEFINED variablename or macroname - The named variable or macro is defined NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists ABSOLUTE filename - The filename is absolute, not relative DIRECTORY string - The string is the name of a directory READABLE filename - Succeeds if the file is readable WRITEABLE filename - Succeeds if the file is writeable NEWER file1 file2 - The 1st file is newer than the 2nd one OPEN { READ-FILE,SESSION-LOG,...} - The given file or log is open OPEN CONNECTION - A connection is open COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n2 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 <= n1 n2 - n1 is arithmetically less than or equal to n2 > n1 n2 - n1 is arithmetically greater than n2 >= n1 n2 - n1 is arithmetically greater than or equal to n2 (number by itself) - fails if the number is 0, succeeds otherwise TRUE - always succeeds FALSE - always fails The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less It can also include an ELSE part on the same line if braces are used: IF < \%x 10 { ECHO It's less } ELSE { ECHO It's not less } Also see HELP WILDCARD (for IF MATCH pattern syntax).3,3T3X3344444445,505D5H5x5556,6d6677T7778$8t899P99:0::;;X;;<4<<===T===>>T>X>>??D?????@ @@`@d@@@@@A0A4AlSyntax: EVALUATE variable expression Evaluates the expression and assigns its value to the given variable. The expression can contain numbers and/or numeric-valued variables or functions, combined with mathematical operators and parentheses in traditional notation. Operators include +-/*(), etc. Example: EVALUATE \%n (1+1) * (\%a / 3). NOTE: Prior to C-Kermit 7.0, the syntax was "EVALUATE expression" (no variable), and the result was printed. Use SET EVAL { OLD, NEW } to choose the old or new behavior, which is NEW by default. Alse see: HELP FUNCTION EVAL.BBC CTCCDDDLDDDDSyntax: XIF condition { commandlist } [ ELSE { commandlist } ] Obsolete. Same as IF (see HELP IF).E0EpESyntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist the number of times given by the initial value, final value and increment. Example: FOR \%i 10 1 -1 { pause 1, echo \%i }EEFDFFSyntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketed commandlist while the condition is true. Conditions are the same as for IF commands.FGGLGGSyntax: SWITCH { case-list } Selects from a group of commands based on the value of a variable. The case-list is a series of lines like these: :x, command, command, ..., break where "x" is a possible value for the variable. At the end of the case-list, you can put a "default" label to catch when the variable does not match any of the labels: :default, command, command, ... The case label "x" can be a character, a string, a variable, a functioninvocation, a pattern, or any combination of these. See HELP WILDCARDSfor information about patterns.GGH0HdHhHHHI(IHILIpItIJJ$Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specified mode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or write to a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barJhJJKKXK\KtKSyntax: ASKQ variablename [ prompt ]Example: ASKQ \%p { Password:} Issues the prompt and defines the variable to be whatever you type in. The characters that you type do not echo on the screen. Use braces to preserve leading and/or trailing spaces in the prompt. To include a question mark, precede it by backslash (\). Also see SET ASK-TIMER.KKKLHLLMM M$Syntax: ASK variablename [ prompt ]Example: ASK \%n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in. Use braces to preserve leading and/or trailing spaces in the prompt. To include a question mark, precede it by backslash (\). Also see SET ASK-TIMER.MLMtMMN4NpNtNSyntax: GETC variablename [ prompt ]Example: GETC \%c { Type any character to continue...} Issues the prompt and sets the variable to the first character you type. Use braces to preserve leading and/or trailing spaces in the prompt. Also see SET ASK-TIMER.NNOO\OOOSyntax: SET ASK-TIMER number For use with ASK, ASKQ, GETOK, and GETC. If ASK-TIMER is set to a number greater than 0, these commands will time out after the given number of seconds with no response. This command is "sticky", so to revert to untimed ASKs after a timed one, use SET ASK-TIMER 0. Also see IF ASKTIMEOUT.OPPLPPQ0Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally. No expansion or evaluation of the definition is done. Thus if the definition includes any variable or function references, their names are included, rather than their values (compare with ASSIGN). If the definition is omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bQLQpQRRHRRRSSSDSHSXS\SSST4TxT|TTTTTU(U,U@UXSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro). The definition string is fully evaluated before it is assigned, so that the values of any variables are contained are used, rather than their names. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This prints 'goodbye hello'.UUVVdVVW@WDW\WpWWWWWSyntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current value is numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nXX@XXXXYSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value is numeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nY8YdYYYZ,Syntax: SET PRINTER [ { |command, filename } ] Specifies the command (such as "|lpr") or filename to be used by the PRINT command. If a filename is given, each PRINT command appends to the given file. If the SET PRINTER argument contains spaces, it must be enclosed in braces, e.g. "set printer {| lpr -Plaser}". If the argument is omitted the default value is restored. SHOW PRINTER lists the current printer. See HELP PRINT for further info.ZHZxZ[ [T[[\Syntax: SET EXIT ON-DISCONNECT { ON, OFF } When ON, C-Kermit EXITs automatically when a network connection is terminated either by the host or by issuing a HANGUP command. Syntax: SET EXIT STATUS number Set C-Kermit's program return code to the given number, which can be a constant, variable, function result, or arithmetic expression. Syntax: SET EXIT WARNING { ON, OFF, ALWAYS } When EXIT WARNING is ON, issue a warning message and ask for confirmation before EXITing if a connection to another computer might still be open. When EXIT WARNING is ALWAYS, confirmation is always requested. When OFF it is never requested. The default is ON.\@\l\\\]]d]]]^(^t^^Syntax: PAUSE [ { number-of-seconds, hh:mm:ss } ]Example: PAUSE 3 or PAUSE 14:52:30 Do nothing for the specified number of seconds or until the given time of day in 24-hour hh:mm:ss notation. If the time of day is earlier than the current time, it is assumed to be tomorrow. If no argument given, one second is used. The pause can be interrupted by typing any character on the keyboard unless SLEEP CANCELLATION is OFF. If interrupted, PAUSE fails, otherwise it succeeds. Synonym: SLEEP._,_`__` `l`aa4Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given, 100 milliseconds.a\axaaaSyntax: !, @, RUN, PUSH, or SPAWN, optionally followed by a command. Gives the command to the local operating system's command processor, and displays the results on the screen. If the command is omitted, enters the system's command line interpreter or shell; exit from it (the command for this is usually EXIT or QUIT or LOGOUT) to return to Kermit.bbLbbc4ctSyntax: TRANSMIT { /COMMAND, /TEXT, /BINARY } filename Sends the contents of a file, without any error checking or correction, to the computer on the other end of your SET LINE or SET HOST connection (or if C-Kermit is in remote mode, displays it on the screen). The filename is the name of a single file (no wildcards) to be sent or, if the /COMMAND switch is included, the name of a command whose output is to be sent. The file is sent according to your current FILE TYPE setting (BINARY or TEXT), which you can override with a /BINARY or /TEXT switch without changing the global setting. In text mode, it is sent a line at a time, with carriage return at the end of each line (as if you were typing it at your keyboard), and C-Kermit waits for a linefeed to echo before sending the next line. In binary mode, it is sent a character at a time, with no feedback required. There can be no guarantee that the other computer will receive the file correctly and completely. Before you start the TRANSMIT command, you must put the other computer in data collection mode, for example by starting a text editor. TRANSMIT may be interrupted by Ctrl-C. Synonym: XMIT. See HELP SET TRANSMIT for further information.ccdd`dde@ePeTeef4ffgg0g4gghh\hSyntax: TRANSLATE file1 cs1 cs2 [ file2 ] Translates file1 from the character set cs1 into the character set cs2 and stores the result in file2. The character sets can be any of C-Kermit's file character sets. If file2 is omitted, the translation is displayed on the screen. An appropriate intermediate character-set is chosen automatically, if necessary. Synonym: XLATE. Example: TRANSLATE lasagna.lat latin1 italian lasagna.nrchiihiij@jjjSyntax: WAIT { number-of-seconds, hh:mm:ss } [modem-signal(s)] Examples: wait 5 cd cts wait 23:59:59 cd Waits up to the given number of seconds or the given time of day for all the specified modem signals to appear on the serial communication device. Sets FAILURE if the signals do not appear in the given time or interrupted from the keyboard during the waiting period. Also see HELP PAUSE. Signals: cd = Carrier Detect; dsr = Dataset Ready; cts = Clear To Send; ri = Ring Indicate.jk$k(k4kDkXk\kklDlllllllSyntax: WRITE name text Writes the given text to the named log or file. The text text may include backslash codes, and is not terminated by a newline unless you include the appropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGmDm\mmnDnHnXntnnnooSyntax: LOOKUP name Looks up the given name in the dialing directory or directories, if any, specified in the most recent SET DIAL DIRECTORY command. Each matching entry is shown, along with any transformations that would be applied to portable-format entries based on your locale. HELP DIAL, HELP SET DIAL for further info.oLo`oopDppSyntax: ANSWER [ ] Waits for a modem call to come in. Prior SET MODEM TYPE and SET LINE required. If is 0 or not specified, Kermit waits forever or until interrupted, otherwise Kermit waits the given number of seconds. The ANSWER command puts the modem in autoanswer mode. Subsequent DIAL commands will automatically put it (back) in originate mode. SHOW MODEM, HELP SET MODEM for more info.ppq,qxqrr\r|Syntax: DIAL phonenumberExample: DIAL 7654321 Dials a number using an autodial modem. First you must SET MODEM, then SET LINE, then SET SPEED. Then give the DIAL command, including the phone number, for example: DIAL 7654321 If the modem is on a network modem server, SET HOST first, then SET MODEM, then DIAL. See also SET DIAL, SET MODEM, SET LINE, SET HOST, SET SPEED, REDIAL, and PDIAL. If the phonenumber starts with a letter, and if you have used the SET DIALDIRECTORY command to specify one or more dialing-directory files, Kermitlooks it up in the given file(s); if it is found, the name is replaced bythe number or numbers associated with the name. If it is not found, thename is sent to the modem literally. If the phonenumber starts with an equals sign ("="), this forces the partafter the = to be send literally to the modem, even if it starts with aletter, without any directory lookup. A dialing directory is a plain text file, one entry per line: name phonenumber ; comments for example: work 9876543 ; This is a comment e-mail +1 (212) 555 4321 ; My electronic mailbox heise +49 (511) 535 2301 ; Verlag Heinz Heise BBS If a phone number starts with +, then it must include country code andarea code, and C-Kermit will try to handle these appropriately based onthe current locale (HELP SET DIAL for further info); these are calledPORTABLE entries. If it does not start with +, it is dialed literally. If more than one entry is found with the same name, Kermit dials all ofthem until the call is completed; if the entries are in portable format,Kermit dials then in cheap-to-expensive order: internal, then local, thenlong-distance, then international, based on its knowledge of your localcountry code and area code (see HELP SET DIAL). Specify your dialing directory file(s) with the SET DIAL DIRECTORY command.rrrs spssssst<tTtXttu<uuuvvHvpvtvvvvvvw(w`wwwx,xtxxyyTyyzzzhSyntax: TELNET [ switches ] [ host [ service ] ] Equivalent to SET NETWORK TYPE TCP/IP, SET HOST host [ service ] /TELNET, IF SUCCESS CONNECT. If host is omitted, the previous connection (if any) is resumed. Depending on how Kermit has been built switches may be available to require a secure authentication method and bidirectional encryption. See HELP SET TELNET for more info.{ {T{{|4|||TELOPT { AO, AYT, BREAK, CANCEL, EC, EL, EOF, EOR, GA, IP, DMARK, NOP, SE, SUSP, SB [ option ], DO [ option ], DONT [ option ], WILL [ option ], WONT [option] } This command lets you send all the Telnet protocol commands. Note that certain commands do not require a response, and therefore can be used as nondestructive "probes" to see if the Telnet session is still open; e.g.: set host xyzcorp.com ... telopt nop telopt nop if fail stop 1 Connection lost TELOPT NOP is sent twice because the failure of the connection will not be detected until the second send is attempted. This command is meant primarily as a debugging tool for the expert user.|}}\}}~ ~h~t~~~~~(tSyntax: ARRAY verb operands... Declares arrays and performs various operations on them. Arrays havethe following syntax: \&a[n] where "a" is a letter and n is a number or a variable with a numeric valueor an arithmetic expression. The value of an array element can be anythingat all -- a number, a character, a string, a filename, etc. The following ARRAY verbs are available: [ ARRAY ] DECLARE arrayname[n] [ = initializers... ] Declares an array of the given size, n. The resulting array has n+1 elements, 0 through n. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ... by including = followed by one or more values separated by spaces. If you omit the size, the array is sized according to the number of initializers; if none are given the array is destroyed and undeclared if it already existed. The ARRAY keyword is optional. Synonym: [ ARRAY ] DCL. ARRAY SHOW [ arrayname ] Displays the contents of the given array. A range specifier can be included to display a segment of the array, e.g. "array show \&a[1:24]." If the arrayname is omitted, all declared arrays are listed, but their contents is not shown. Synonym: SHOW ARRAY. ARRAY CLEAR arrayname Clears all elements of the array, i.e. sets them to empty values. You may include a range specifier to clear a segment of the array rather than the whole array, e.g. "array clear \%a[22:38]" ARRAY SET arrayname value Sets all elements of the array to the given value. You may specify a range to set a segment of the array, e.g. "array set \%a[2:9] 0" ARRAY DESTROY arrayname Destroys and undeclares the given array. ARRAY RESIZE arrayname number Changes the size of the given array, which must already exist, to the number given. If the number is smaller than the current size, the extra elements are discarded; if it is larger, new empty elements are added. ARRAY COPY array1 array2 Copys array1 to array2. If array2 has not been declared, it is created automatically. Range specifiers may be given on one or both arrays. [ ARRAY ] SORT [ switches ] array-name [ array2 ] Sorts the given array lexically according to the switches. Element 0 of the array is excluded from sorting by default. The ARRAY keyword is optional. If a second array name is given, that array is sorted according to the first one. Switches: /CASE:{ON,OFF} If ON, alphabetic case matters; if OFF it is ignored. If this switch is omitted, the current SET CASE setting applies. /KEY:number Position (1-based column number) at which comparisons begin, 1 by default. /NUMERIC Specifies a numeric rather than lexical sort. /RANGE:low[:high] The range of elements, low through high, to be sorted. If this switch is not given, elements 1 through the dimensioned size are sorted. If :high is omitted, the dimensioned size is used. To include element 0 in a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort elements 0 through n). You can use a range specifier in the array name instead of the /RANGE switch. /REVERSE Sort in reverse order. If this switch is not given, the array is sorted in ascending order. Various functions are available for array operations; see HELP FUNCTION fordetails. These include \fdimension(), \farraylook(), \ffiles(), \fsplit(),and many more.\tx \`\<0|XD<@ T,`dt  lT$<@Syntax: COPY [ switches ] file1 file2 Copies the source file (file1) to the destination file (file2). If file2 is a directory, this command copies file1 under its own name to the given directory. Only one file at a time may be copied; wildcards are not supported. Switches: /LIST Print the filenames and status while copying. Synonyms: /LOG, /VERBOSE /NOLIST Copy silently (default). Synonyms: /NOLOG, /QUIET0X8PT\Syntax: RENAME [ switches ] file1 file2 Renames the source file (file1) to the destination file (file2). If file2 is a directory, this command moves file1 under its own name to the given directory. Only one file at a time may be renamed; wildcards are not supported. Switches: /LIST Print the filenames and status while renaming. Synonyms: /LOG, /VERBOSE /NOLIST Rename silently (default). Synonyms: /NOLOG, /QUIET$L0HLTCommand-line options are given after the program name in the systemcommand that you use to start C-Kermit. Example: kermit -i -s oofa.exe tells C-Kermit to send (-s) the file oofa.exe in binary (-i) mode. Command-line options are case-sensitive; "-s" is different from "-S". If any "action options" are included on the command line, C-Kermit exitsafter executing its command-line options. If -S is included, or no actionoptions were given, C-Kermit enters its interactive command parser andissues its prompt. Command-line options are single characters preceded by dash (-). Somerequire an "argument," others do not. If an argument contains spaces, itmust be enclosed in doublequotes: kermit -s "filename with spaces" An option that does not require an argument can be bundled with other options: kermit -Qis oofa.exe Exceptions to the rules: . If the first command-line option is a filename, Kermit executes commands from the file. Additional command-line options can follow the filename. . The special option "=" (equal sign) or "--" (double hyphen) means to treat the rest of the command line as data, rather than commands; this data is placed in the argument vector array, \&@[], along with the other items on the command line, and also in the top-level \%1..\%9 variables. . A similar option "+" (plus sign) means: the name of a Kermit script file follows. This file is to be executed, and its name assigned to \%0 and \&_[0]. All subsequent command-line arguments are to be ignored by Kermit but made available to the script as \%1, \%2, ..., as well as in the argument-vector arrays. The initialization file is not executed automatically in this case. . The -s option can accept multiple filenames, separated by spaces. . the -j and -J options allow an optional second argument, the TCP port name or number. Type "help options all" to list all the command-line options.Type "help option x" to see the help message for option x. C-Kermit also offers a selection of "extended command-line" options.These begin with two dashes, followed by a keyword, and then, if the optionhas arguments, a colon (:) or equal sign (=) followed by the argument.Unlike single-letter options, extended option keywords aren't case sensitiveand they can be abbreviated to any length that still distinguishes them fromother extended-option keywords. Example: kermit --banner:oofa.txt which designates the file oofa.txt to be printed upon startup, rather thanthe built-in banner (greeting) text. To obtain a list of availableextended options, type "help extended-options ?". To get help about allextended options, type "help extended-options". To get help about aparticular extended option, type "help extended-option xxx", where "xxx"is the option keyword. At present, most of the extended options apply only to the Internet KermitService Daemon (IKSD). Type "help iksd" for details.  dHL,@D$(x|PT4ddh HL(xd<(,Extended argument without the "--" prefix %s %s %s %s A command-line option character, or the word ALL, or carriage return for an overviewallALL?A single character, please, or carriage to list them all. %s The following command-line options are available: -%c %s (action option) %s Argument: %s -%c %s%s (action option) Argument: (none) Syntax: FILE [ switches ] [ ] Opens, closes, reads, writes, and manages local files. The FILE commands are: FILE OPEN (or FOPEN) -- Open a local file. FILE CLOSE (or FCLOSE) -- Close an open file. FILE READ (or FREAD) -- Read data from an open file. FILE WRITE (or FWRITE) -- Write data to an open file. FILE LIST (or FLIST) -- List open files. FILE STATUS (or FSTATUS) -- Show status of a channel. FILE REWIND (or FREWIND) -- Rewind an open file FILE COUNT (or FCOUNT) -- Count lines or bytes in an open file FILE SEEK (or FSEEK) -- Seek to specified spot in an open file. FILE FLUSH (or FFLUSH) -- Flush output buffers for an open file. Type HELP FILE OPEN or HELP FOPEN for details about FILE OPEN;type HELP FILE CLOSE or HELP FCLOSE for details about FILE CLOSE, and so on. The following variables are related to the FILE command: \v(f_max) -- Maximum number of files that can be open at once \v(f_error) -- Completion code of most recent FILE command or function \v(f_count) -- Result of most recent FILE COUNT command The following functions are related to the FILE command: \F_eof() -- Check if channel is at EOF \F_pos() -- Get channel read/write position (byte number) \F_line() -- Get channel read/write position (line number) \F_handle() -- Get file handle \F_status() -- Get channel status \F_getchar() -- Read character \F_getline() -- Read line \F_getblock() -- Read block \F_putchar() -- Write character \F_putline() -- Write line \F_putblock() -- Write block \F_errmsg() -- Error message from most recent FILE command or function Type HELP for information about each one.4pt4p P$txH<0Tt Syntax: FILE OPEN [ switches ] Opens the file indicated by in the mode indicated by the switches, if any, or if no switches are included, in read-only mode, and assigns a channel number for the file to the given variable. Synonym: FOPEN. Switches: /READ Open the file for reading. /WRITE Open the file for writing. If /READ was not also specified, this creates a new file. If /READ was specifed, the existing file is preserved, but writing is allowed. In both cases, the read/write pointer is initially at the beginning of the file. /APPEND If the file does not exist, create a new file and open it for writing. If the file exists, open it for writing, but with the write pointer positioned at the end. /BINARY This option is ignored in UNIX.Switches can be combined in an way that makes sense and is supported by theunderlying operating system.L$(0|48@ lSyntax: FILE CLOSE Closes the file on the given channel if it was open. Also see HELP FILE OPEN. Synonym: FCLOSE.L|Syntax: FILE FLUSH Flushes output buffers on the given channel if it was open, forcing all material previously written to be committed to disk. Synonym: FFLUSH. Also available as \F_flush().HhSyntax: FILE LIST Lists the channel number, name, modes, and position of each file opened with FILE OPEN. Synonym: FLIST.Syntax: FILE READ [ switches ] [ ] Reads data from the file on the given channel number into the , if one was given; if no variable was given, the result is printed on the screen. The variable should be a macro name rather than a \%x variable or array element if you want backslash characters in the file to be taken literally. Synonym: FREAD. Switches: /LINE Specifies that a line of text is to be read. A line is defined according to the underlying operating system's text-file format. For example, in UNIX a line is a sequence of characters up to and including a linefeed. The line terminator (if any) is removed before assigning the text to the variable. If no switches are included with the FILE READ command, /LINE is assumed. /SIZE:number Specifies that the given number of bytes (characters) is to be read. This gives a semblance of "record i/o" for files that do not necessarily contain lines. The resulting block of characters is assigned to the variable without any editing. /CHARACTER Equivalent to /SIZE:1. If FILE READ /CHAR succeeds but the is empty, this indicates a NUL byte was read. Synonym: FREAD.Also available as \F_getchar(), \F_getline(), \F_getblock().P,xP4DHX4TXd4Syntax: FILE REWIND If the channel is open, moves the read/write pointer to the beginning of the file. Equivalent to FILE SEEK 0. Synonym: FREWIND. Also available as \F_rewind().\Syntax: FILE SEEK [ switches ] { [{+,-}], EOF } Switches are /BYTE, /LINE, /RELATIVE, ABSOLUTE. Moves the file pointer for this file to the given position in the file. Subsequent FILE READs or WRITEs will take place at that position. If neither the /RELATIVE nor /ABSOLUTE switch is given, an unsigned is absolute; a signed number is relative. EOF means to move to the end of the file. Synonym: FSEEK. Also available as \F_seek().T4|Syntax: FILE STATUS If the channel is open, this command shows the name of the file, the switches it was opened with, and the current read/write position. Synonym: FSTATUSL`Syntax: FILE COUNT [ { /BYTES, /LINES, /LIST, /NOLIST } ] If the channel is open, this command prints the nubmer of bytes (default) or lines in the file if at top level or if /LIST is included; if /NOLIST is given, the result is not printed. In all cases the result is assigned to \v(f_count). Synonym: FCOUNTxTFILE WRITE [ switches ] Writes the given text to the file on the given channel number. The can be literal text or a variable, or any combination. If the text might contain leading or trailing spaces, it must be enclosed in braces if you want to preserve them. Synonym: FWRITE. Switches: /LINE Specifies that an appropriate line terminator is to be added to the end of the . If no switches are included, /LINE is assumed. /SIZE:number Specifies that the given number of bytes (characters) is to be written. If the given is longer than the requested size, it is truncated; if is shorter, it is padded according /LPAD and /RPAD switches. Synonym: /BLOCK. /LPAD[:value] If /SIZE was given, but the is shorter than the requested size, the text is padded on the left with sufficient copies of the character whose ASCII value is given to write the given length. If no value is specified, 32 (the code for Space) is used. The value can also be 0 to write the indicated number of NUL bytes. If /SIZE was not given, this switch is ignored. /RPAD[:value] Like LPAD, but pads on the right. /STRING Specifies that the is to be written as-is, with no terminator added. /CHARACTER Specifies that one character should be written. If the is empty or not given, a NUL character is written; otherwise the first character of is given. Synonym FWRITE.Also available as \F_putchar(), \F_putline(), \F_putblock(). \,08(t,x XptdOperationDOHELP xxSyntax: APC text Echoes the text within a VT220/320/420 Application Program Command.Describes how to get technical support.Syntax: BEEP Sends a BEL character to your terminal.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: CD [ directoryname ] Change Directory. If directory name omitted, changes to your home directory. Also see HELP SET CD.Syntax: UNDEFINE variable-name Undefines a macro or variable.Syntax: PDIAL phonenumber Partially dials a phone number. Like DIAL but does not wait for carrier or CONNECT message.Redial the number given in the most recent DIAL commnd.Syntax: LS [ args ] Runs "ls" with the given arguments.Syntax: DISABLE command Security for the C-Kermit server. Prevents the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Executes a macro that was defined with the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1 through \%9.Syntax: ECHO text Displays the text on the screen, followed by a line terminator. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: XECHO text Just like ECHO but does not add a line terminator to the text. See ECHO.Syntax: ENABLE capability For use with server mode. Allows the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exits from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: E-PACKET Sends an Error packet to the other Kermit.Syntax: QUIT (or EXIT) [ number ] Exits from the Kermit program, closing all open files and devices, optionally setting the program's return code to the given number. Also see SET EXIT.Syntax: FINISH Tells the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Prints the prompt, makes user type 'yes', 'no', or 'ok', and sets SUCCESS or FAILURE accordingly. Also see SET ASK-TIMER.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1999, Trustees of Columbia University in the City of New York. %s, Copyright (C) 1985, 1999,Give a brief introduction to C-Kermit.Syntax: REINPUT n string Looks for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored. Introduces a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Equivalent to SEND /MAIL /ADDRESS:xxx filename.MMOVE is exactly like MSEND, except each file that is sent successfully is deleted after it is sent. Prints news of new features since publication of "Using C-Kermit". New features are described in the file DOCS\UPDATES.TXT.Syntax: PING [ IP-hostname-or-number ] Checks if the given IP network host is reachable. Default host is from most recent SET HOST or TELNET command. Runs system PING program, if any.Syntax: FTP [ IP-hostname-or-number ] Makes an FTP connection to the given IP host or, if no host specified, to the current host. Uses the system's FTP program, if any.Syntax: PRINT file [ options ] Prints the local file on a local printer with the given options. Also see HELP SET PRINTER.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Reads a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with \fexecute(macro), which allows macros to be used like functions.MOVE is exactly like SEND, except each file that is sent successfully is deleted after it is sent.Syntax: SUSPEND or Z Suspends Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET ySorry, help not available for "%s" Syntax: REDIRECT command Runs the given local command with its standard input and output redirected to the current SET LINE or SET HOST communications path. Synonym: < (Left angle bracket). Display current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS [/BRIEF] Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Declares a variable to be local to the current macro or command file.View the terminal emulation screen even when there is no connection.Synonym for SET FILE TYPE TEXT.Synonym for SET FILE TYPE BINARY.Just like GET but asks the server to delete each file that has been sent successfully.Equivalent to SET PARITY NONE, SET COMMAND BYTE 8, SET TERMINAL BYTE 8.Syntax: SAVE KEYMAP Saves current keymap definitions to file, "keymap.ini" by default.Syntax: EDIT [ ] Starts your preferred editor on the given file, or if none given, the most recently edited file, if any. Also see SET EDITOR.Syntax: BROWSE [ ] Starts your preferred Web browser on the given URL, or if none given, the most recently visited URL, if any. Also see SET BROWSER.Syntax: CSEND [ switches ] [ ] Sends from the given rather than from a file. Equivalent to SEND /COMMAND; see HELP SEND for details.Syntax: CRECEIVE [ switches ] Receives to the given rather than to a file. Equivalent to RECEIVE /COMMAND; see HELP RECEIVE for details.Syntax: CGET Equivalent to GET /COMMAND; see HELP GET for details.Name of function?No such function - "%s" Syntax: KERMIT [command-line-options] Lets you give command-line options at the prompt or in a script. HELP OPTIONS for more info.Syntax: BACK Returns to your previous directory.Syntax: WHERE Tells where your transferred files went.Syntax: PIPE [ command ] Makes a connection through the program whose command line is given. Example: pipe rlogin xyzcorp.comSTATUS is the same as SHOW STATUS; prints SUCCESS or FAILURE for the previous command.Syntax: ASSERT Succeeds or fails depending on ; see HELP IF for s.Always fails.Always succeeds.If you haved logged in to C-Kermit as an Internet Kermit server, the LOGOUT command, given at the prompt, logs you out and closes your session.The Internet Kermit Service Daemon can be started only by the system administrator. The IKSD is documented separately.Closes all open files and logs.Syntax: SHIFT [ n ] Shifts \%1..9 variables n places to the left; default n = 1.Syntax: MANUAL [ topic ] Runs the "man" command on the given topic (default "kermit").RASG and RASSIGN are short forms of REMOTE ASSIGN.RCD and RCWD are short forms of REMOTE CD.RCOPY is a short form of REMOTE COPY.RDELETE is a short form of REMOTE RELETE.RDIRECTORY is a short form of REMOTE DIRECTORY.REXIT is a short form of REMOTE EXIT.RHELP is a short form of REMOTE HELP.RHOST is a short form of REMOTE HOST.RKERMIT is a short form of REMOTE KERMIT.RMKDIR is a short form of REMOTE MKDIR.RPRINT is a short form of REMOTE PRINT.RPWD is a short form of REMOTE PWD.QUERY and RQUERY are short forms of REMOTE QUERY.RRENAME is a short form of REMOTE RENAME.RRMDIR is a short form of REMOTE RMDIR.RSET is a short form of REMOTE SET.RSPACE is a short form of REMOTE SPACE.RTYPE is a short form of REMOTE TYPE.RWHO is a short form of REMOTE WHO.Syntax: EXEC [ [ [ ... ] ] C-Kermit overlays itself with the given system command and starts it with the given arguments. Upon any error, control returns to C-Kermit.Syntax: TRACE { /ON, /OFF } { ASSIGNMENTS, COMMAND-LEVEL, ALL } Turns tracing of the given object on or off.Sorry, help not available for "%s" %s %s Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command (see HELP TRANSMIT): SET TRANSMIT ECHO { ON, OFF } Whether to echo text to your screen as it is being transmitted. SET TRANSMIT EOF text Text to send after end of file is reached, e.g. \4 for Ctrl-D SET TRANSMIT FILL number ASCII value of a character to insert into blank lines, 0 for none. Applies only to text mode. 0 by default. SET TRANSMIT LINEFEED { ON, OFF } Transmit Linefeed as well as Carriage Return (CR) at the end of each line. Normally, only CR is sent. SET TRANSMIT LOCKING-SHIFT { ON, OFF } Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE. SET TRANSMIT PAUSE number How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode). SET TRANSMIT PROMPT number ASCII value of character to look for from host before sending next line when TRANSMITting in text mode; normally 10 (Linefeed). 0 means none; don't wait for a prompt. SET TRANSMIT TIMEOUT number Number of seconds to wait for each character to echo when TRANSMIT ECHO is ON or TRANSMIT PROMPT is not 0. If 0 is specified, this means wait indefinitely for each echo. Synonym: SET XMIT. SHOW TRANSMIT displays current settings.(,pt48T@`dDhl <@\XSyntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screen even though Kermit thinks it is running in the background.dSyntax: SET BUFFERS n1 [ n2 ] Changes the overall amount of memory allocated for SEND and RECEIVE packet buffers, respectively. Bigger numbers let you have longer packets and more window slots. If n2 is omitted, the same value as n1 is used. NOTE: This command is not needed in this version of C-Kermit, which is already configured for maximum-size packet buffers.0|LSyntax: SET COMMAND parameter value SET COMMAND AUTODOWNLOAD { ON, OFF } Enables/Disables automatic recognition of Kermit packets while in command mode. ON by default. SET COMMAND BYTESIZE { 7, 8 } Informs C-Kermit of the bytesize of the communication path between itself and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow entry and display of 8-bit characters. SET COMMAND HEIGHT Informs C-Kermit of the number of rows in your command screen for the purposes of More?-prompting. SET COMMAND WIDTH Informs C-Kermit of the number of characters across your screen for purposes of screen formatting. SET COMMAND MORE-PROMPTING { ON, OFF } ON (the default) enables More?-prompting when C-Kermit needs to display text that does not fit vertically on your screen. OFF allows the text to scroll by without intervention. If your command window has scroll bars, you might prefer OFF. SET COMMAND RECALL-BUFFER-SIZE number How big you want C-Kermit's command recall buffer to be. By default, it holds 10 commands. You can make it any size you like, subject to memory constraints of the computer. A size of 0 disables command recall. Whenever you give this command, previous command history is lost. SET COMMAND QUOTING { ON, OFF } Whether to treat backslash and question mark as special characters (ON), or as ordinary data characters (OFF) in commands. ON by default. SET COMMAND RETRY { ON, OFF } Whether to reprompt you with the correct but incomplete portion of a syntactically incorrect command. ON by default. Use SHOW COMMAND to display these settings.t(,L0x$(P4LPxX PTt Syntax: SET CARRIER-WATCH { AUTO, OFF, ON } Attempts to control treatment of carrier (the Data Carrier Detect signal) on serial communication (SET LINE or SET PORT) devices. ON means that carrier is required at all times. OFF means carrier is never required. AUTO (the default) means carrier is required at all times except during the DIAL command. Correct operation of carrier-watch depends on the capabilities of the underlying OS, drivers, devices, and cables. If you need to CONNECT to a serial device that is not asserting carrier, and Kermit won't let you, use SET CARRIER-WATCH OFF. Use SHOW COMMUNICATIONS to display the CARRIER-WATCH setting.D(pPxSyntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission of selected file attributes along with each file, and to handle or ignore selected incoming file attributes, including: CHARACTER-SET: The transfer character set for text files DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFF l X,0H`tSyntax: SET TAKE parameter value Controls behavior of TAKE command: SET TAKE ECHO { ON, OFF } Tells whether commands read from a TAKE file should be displayed on the screen (if so, each command is shown at the time it is read, and labeled with a line number). SET TAKE ERROR { ON, OFF } Tells whether a TAKE command file should be automatically terminated when a command fails. This setting is local to the current command file, and inherited by subordinate command files.4PSyntax: SET TERMINAL parameter value SET TERMINAL TYPE ... This command is not available because this version of C-Kermit does not include a terminal emulator. Instead, it is a "semitransparent pipe" (or a totally transparent one, if you configure it that way) to the computer or service you have made a connection to. Your console, workstation window, or the terminal emulator or terminal from which you are running C-Kermit provides the emulation. SET TERMINAL APC { ON, OFF, UNCHECKED } Controls execution of Application Program Commands sent by the host while C-Kermit is in CONNECT mode. ON allows execution of "safe" commands and disallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, and RUN. OFF prevents execution of APCs. UNCHECKED allows execution of all APCs. OFF is the default. SET TERMINAL AUTODOWNLOAD { ON, OFF } Enables/disables automatic switching into file-transfer mode when a valid Kermit or ZMODEM packet of the appropriate type is received during CONNECT mode. Default is OFF. SET TERMINAL BYTESIZE { 7, 8 } Use 7- or 8-bit terminal characters between C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CHARACTER-SET [ ] Specifies the character set used by the remote host, , and the character set used by C-Kermit locally, . If you don't specify the local character set, the current FILE CHARACTER-SET is used. When you specify two different character sets, C-Kermit translates between them during CONNECT. By default, both character sets are TRANSPARENT, and no translation is done. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } Specifies how incoming carriage return characters are to be displayed on your screen. SET TERMINAL DEBUG { ON, OFF } Turns terminal session debugging on and off. When ON, incoming control characters are displayed symbolically, rather than be taken as formatting commands. SET TERMINAL ECHO { LOCAL, REMOTE } Specifies which side does the echoing during terminal connection. SET TERMINAL ESCAPE-CHARACTER { ENABLED, DISABLED } Turns on/off the ability to escape back from CONNECT mode using the SET ESCAPE character. If you disable it, Kermit returns to its prompt only when the connection is closed by the other end. USE WITH EXTREME CAUTION. Also see HELP SET ESCAPE. SET TERMINAL HEIGHT Tells C-Kermit how many rows (lines) are on your CONNECT-mode screen. SET TERMINAL LOCKING-SHIFT { OFF, ON } Tells C-Kermit whether to use Shift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bit characters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } Tells whether to send CRLF (Carriage Return and Line Feed) when you type CR (press the Return or Enter key) in CONNECT mode. SET TERMINAL PRINT { ON, OFF } Enables and disables host-initiated transparent printing in CONNECT mode. SET TERMINAL TRIGGER Specifies a string that, when detected during any subsequent CONNECT session, is to cause automatic return to command mode. Give this command without a string to cancel the current trigger. See HELP CONNECT for additional information. SET TERMINAL WIDTH Tells C-Kermit how many columns (characters) are on your CONNECT-mode screen. Type SHOW TERMINAL to see current terminal settings.,0H$h\@dh,HLldL(<@`,pt@D  X      $ l     <   SET HOST [ switches ] hostname-or-address [ service ] [ protocol-switch ] Establishes a connection to the specified network host on the currently selected network type. For TCP/IP connections, the default service is TELNET; specify a different TCP port number or service name to choose a different service. The first set of switches can be: /NETWORK-TYPE:name Makes the connection on the given type of network. Equivalent to SET NETWORK TYPE name prior to SET HOST, except that the selected network type is used only for this connection. Type "set host /net:?" to see a list. /NETWORK-TYPE:COMMAND means to make the connection through the given system command, such as "rlogin" or "cu". /CONNECT Enter CONNECT (terminal) mode automatically if the connection is successful. /SERVER Enter server mode automatically if the connection is successful. /USERID:[] Equivalent to SET LOGIN USER . Sets the value of (userid) to . This value is sent to the host during TELNET NEW-ENVIRONMENT and TELNET AUTHENTICATION negotiations. This change is permanent. An empty is accepted. The protocol-switches can be: /NO-TELNET-INIT Do not send initial Telnet negotiations even if this is a Telnet port. /RAW-SOCKET This is a connection to a raw TCP socket. /TELNET Send initial Telnet negotiations even if this is not a Telnet port. Examples: SET HOST kermit.columbia.edu SET HOST /CONNECT kermit.columbia.edu SET HOST * 1649 SET HOST /SERVER * 1649 SET HOST 128.59.39.2 SET HOST madlab.sprl.umich.edu 3000 SET HOST xyzcorp.com 2000 /RAW-SOCKET SET HOST /CONNECT /COMMAND rlogin xyzcorp.com The TELNET command is equivalent to SET NETWORK TYPE TCP/IP,SET HOST name [ port ] /TELNET, IF SUCCESS CONNECT Also see SET NETWORK, TELNET, SET TELNET.  L  0hldDHT(t<@P0D`x<ptSyntax: SET NETWORK { TYPE network-type, DIRECTORY [ file(s)... ] } Select the type of network to be used with SET HOST connections: SET NETWORK TYPE COMMAND ; Make a connection through an external command SET NETWORK TYPE TCP/IP ; Internet: Telnet, Rlogin, etc. If only one network type is listed above, that is the default network forSET HOST commands. Also see SET HOST, TELNET. SET NETWORK DIRECTORY [ file [ file [ ... ] ] ] Specifies the name(s) of zero or more network directory files, similar to dialing directories (HELP DIAL for details). The general format of a network directory entry is: name network-type address [ network-specific-info ] [ ; comment ] For TCP/IP, the format is: name tcp/ip ip-hostname-or-address [ socket ] [ ; comment ] You can have multiple network directories and you can have multiple entrieswith the same name. SET HOST and TELNET commands look up thegiven in the directory and, if found, fill in the additional itemsfrom the entry, and then try all matching entries until one succeeds.pPDDHhlHSET TCP ADDRESS This allows a specific IP Address on a multihomed host to be used instead of allowing the TCP/IP stack to choose. This may be necessary when using authentication or listening for an incoming connection. Specify no to remove the preference. SET TCP KEEPALIVE { ON, OFF } Setting this ON might help to detect broken connections more quickly. (default is ON.) SET TCP LINGER { ON [timeout], OFF } Setting this ON ensures that a connection doesn't close before all outstanding data has been transferred and acknowledged. The timeout is measured in 10ths of milliseconds. The default is ON with a timeout of 0. SET TCP NODELAY { ON, OFF } ON means send short TCP packets immediately rather than waiting to accumulate a bunch of them before transmitting (Nagle Algorithm). (default is OFF.) SET TCP RECVBUF SET TCP SENDBUF TCP receive and send buffer sizes. (default is -1, use system defaults.) These items let you tune TCP networking performance on a per-connectionbasis by adjusting parameters you normally would not have access to. Youshould use these commands only if you feel that the TCP/IP protocol stackthat Kermit is using is giving you inadequate performance, and then only ifyou understand the concepts (see, for example, the Comer TCP/IP books), andthen at your own risk. These settings are displayed by SHOW NETWORK. Notall options are necessarily available in all Kermit versions; it depends onthe underlying TCP/IP services. The following TCP and/or IP parameter(s) may also be changed: SET TCP REVERSE-DNS-LOOKUP { AUTO, ON, OFF } Tells Kermit whether to perform reverse DNS lookup on TCP/IP connections so Kermit can determine the actual hostname of the host it is connected to, which is useful for connections to host pools, and is required for Kerberos connections to host pools and for incoming connections. If the other host does not have a DNS entry, the reverse lookup could take a long time (minutes) to fail, but the connection will still be made. Turn this option OFF for speedier connections if you do not need to know exactly which host you are connected to and you are not using Kerberos. AUTO, the default, means the lookup is done on hostnames, but not on numeric IP addresses unless Kerberos support is installed. SET TCP DNS-SERVICE-RECORDS {ON, OFF} Tells C-Kermit whether to try to use DNS SRV records to determine the host and port number upon which to find an advertised service. For example, if a host wants regular Telnet connections redirected to some port other than 23, this feature allows C-Kermit to ask the host which port it should use. Since not all domain servers are set up to answer such requests, this feature is OFF by default.Hh@tx h$hPT4  d     !H!!","|"##d###$ $T$$%4%%SET TELOPT [ { /CLIENT, /SERVER } ]