@NH@|HG@(<@Q0N  92453-07X10.197I: 92453-07X10.163wc@ @@X"66LX >|8N|8tX!>pNpX!@(P(X!>0N0X!?OX!70G0X! 50L E0LX Ӏ` `X ]P ]PX 00X ffX 8\oloX H˸۸X I88X X88(>(@`>(@<>( @P>(@h>(wT@Tt>(& P@ P >('p(@p(>((@>(P@>(R@Y>HHY <? @>Q0@ $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$CODE$$LIT$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$$ANS$$CI$yp t,, p j [m_se}3y,@P2@L9@H@@DJ@@P@U^@ Ui@Ut@U}@ 0U@UmUNU @U bU@U fU@U h@U@U iU@U  aU @U b`U@U gU@U %gU%@U -U-@U 4LU 4@U ;xU";@U AXU$A@ U HU&H@(U PU(P@0U WU*W@8U )]pU,]@@U cU.c@HU j(U0j@PU q `U2q@XU U4@pU 5U6@xU ڠU8@U @U:@U ֐U<@U %U>@U =U@@U +UB@U /@UD@U 7UF@U @UH@U UJ@U #UL@U 3UN@U CUP@U -@UR@U ;0UT@U pUV@U OUX@U 9hUZ@U IPU\@U UU^@U ' U` @ U Ub@(U cUd@0U aUf@8U S# @Uh#@@U M)0Uj)@HU k/ Ul/@PU [5 Un5@XU W; Up;@`U oA UrA@hU gGUtG@pU sM(UvM@xU ASUxS@U yYxUzY@U iapU|a@U !jU~j@U 1rUr@U uxUx@U ~U~@U @U@U U@U }U@U m`U@U qU@U U@U w(U@U _U@U U@U YHU@U eU@U KhU@U 8U@U ]`U@ U pU@(U U@0U 8U@8U U@@U `U@HU U@PU EXU@XU  U@`U  U@hU hU@pU pU@xU ?U@U "U"@U G(@U(@U .U.@U 4@U4@U :U:@U @@U@@U {FUF@U LxUL@U RUR@U XUX@U ^ U^@U Qd8Ud@U jUj@U pUp@U x8Ux@U ~U~@U XU@U HU@U U@U ИU@ U U@(U U@0U U@8U (U@@U  U@HU  pU@PU  U@XU  U@`U  U@hU pU@pU U@xU U@U  PU@U U@U U@U U@U U@U  U @U 8U@U U@U  PU @U !XU !@U 'U'@U /xU/@U  5@U5@U ;U;@U ApUA@U GUG@U MUM@U S0US@U Y0UY@U _8U _@ U eXU"e@(U kU$k@0U %qU&q@8U wxU(w@@U }U*}@HU hU,@PU )U.@XU U0@`U +U2@hU  U4@pU 8U6@xU /U8@U 7HU:@U `U<@U U>@U U@@U - UB@U 8UD@U XUF@U ;HUH@U IUJ@U HUL@U =UN@U ?UP@U KUR@U QXUT@U ! UV @U C UX @U 5 UZ @U W hU\ @U (U^ @U # #U` #@ U a )Ub )@(U S /Ud /@0U O 5Uf 5@8U  ;Uh ;@@U 1 A@Uj A@HU G IpUl I@PU U O Un O@XU A UUp U@`U [ Ur [@hU k a Ut a@pU M gUv g@xU ] mUx m@U sUz s@U { yU| y@U c pU~ @U w U @U u HU @U ' hU @U o <\U @U Y >U @U 9 U @U E `U @U i HU @U  U @U q + )U +@PU g E d`U E@hU L S Y _ e l u |  '.5;CJS[dkrz %+5:CJPV]dkrw~%*07?FNV^fmrx(/4BITZ`hs} %-4;AHPW]cjqy #)/5;AGMSYajrx~"(.4:@FLRX^djpx~ !'/5;AGMSY_ekqw}     # ) / 5 ; A I O U [ a g m s y     $ + 4 = Ewermit/usr/lib/libcurses.1/usr/lib/libc.2errno_ktepv__ismt__dld_loc_tepv_CPU_REVISION_FPU_MODEL_SYSTEM_ID_environ_endenvironchmodstrncpyisalphawaitrecvgetegidftruncatecryptkillexeclbindsetuidmkdirtoupperumasktzsetrewindunamectermidfwriteinitgroupspipetolowermemcpysetbufpopenreaddirfflushisxdigitgetppid__filbufselect_startsysconfchdiropenloglongjmpsetjmpctimesprintfioctlwritegettimeofdayaccessgetpeernameutimerealpathsignalgetpiddupgethostnamegetloginfopengetpgrpisspacegeteuidrmdirinet_addrforkvsprintfmallocfcntllstatsscanflistengetcwdputenvfreepcloseopengetgidfputs_exitgetpwnamgetpwuidsocketlockfisdigitunlinkrandgetservbynamestrcatdup2endusershellatolfseekatoifreadconnectsystemreadlinkgetenvexitcreatsetgidttynamestrcmpstrncatmemmovevprintfisupperrenamelinkfstatchrootstrncmpfdopenalarmsleepinet_ntoaacceptreadislowerfgetsisattystrlenfcloseopendirstrcpyfilenoclosedirsysloggetusershellisprintgetsocknamegethostbyaddrgetuidstatgethostbynamememsetgetsockoptsrandcloseasctimesetsockoptlocaltimewclrtoeolwmovewcleartputswrefreshprintwtgetstrendwintgetenttgotoinitscrmain__d_trapdotakeinifailtakeinidocmdfilefailcmdfiledocmdlinefailcmdlinedoicpfailicpcctraptimerhttincsighupsig_ignputfilkgetmkgetfputsrvnxthlpnxttypenxtdirnxtdelxduasxfiasxfrasxfcasxgeasxhuasxitasxnoasxpoasxspasxswasxchasxl1asxl2asxdmasxneasx43asx85asx52asxaqasxdgasxr8asxlcasxacasxskasxk8asxh7asxlhasx62asxegasxlgasx69asxl9asx58asx55asx1251asxleft128x1250asxmzasxukl1xdul1xfil1xfrl1xfcl1xgel1xhul1xitl1xnol1xpol1xspl1xswl1xchl1xl2l1xdml1xnel1x43l1x85l1x52l1xaql1xdgl1xr8l1xlhl1x62l1xlgl1x58l1x1250l1xmzl1xgel2xhul2xl1l2xnel2x43l2x85l2x52l2xaql2xdgl2xr8l2xl2lgxl9l2x58l2x1250l2xmzl2xaslcxaclcxskcyxk8lcxleft160x55lcx1251lcxbulcxl1lhxh7lhx62lhxl1lgxeglgx69lgxl2l9xdml9xnel9xl169x58l9x1250l9xmzl9xasacxasskxask8xash7xasegxas55xas1251zl1asxl1ukxl1duxl1fixl1frxl1fcxl1gexl1itxl1huxl1noxl1poxl1spxl1swxl1chxl1dmxl1nexl143xl185xl152xl1aqxl1dgxl1r8xl1skxl1h7xl162xl1egxl11250xl1mzxl2nexl243xl285xl252xl2aqxl2dgxl2r8xl2skxl2h7xl258xl21250xl2mzxlcacxlcskxlck8xlch7xlc55xlc1251xlcbuxlhh7xlh62xlgegxlg69zl9asxl9dmxl9nexl958xl91250xl9mzputtrmzputfiltrapstptrapcmdgetczzstringtrtrapck_outcckcgetcdialtimegetokdialint_dodialfaildialoktimodookfailokscrtimedorseqfailrseqdooseqfailoseqrlogoobhnetgetcwinchh_ktepv_tepv__ioberrno__ismttimezonestdscrcurscrsys_nerrsys_errlist k? k?@x@K?@ @+H5:H3: k?#m(7{ P7 +rh#+rh8'y 4yEe'y7D7%767+4># -744445 rנjb+rh%+rh% (4Ц @Ц D(43 H?p(ਃ 43 ` 7+4>7D7%7744z# %74444@H@7D7%7#0$P7444+rH8#-7@@@@ 7K?@ @@@@WSE}@ 3 K> U@WSE}@ 3 K> @XE8 Wy@>_@ _k?7k?#Wk? 7Yk?4@ @4 @@K?K?7@ 4K? *@K? K? 7@ 4K? rKa?H:@7?#7(4@ x4@x7?7?7@ H4#77984@ 4Ka?@ H:K>@7? 44@B7?@B?7?B?@7 7?"6/ '047?'E' 81@0N1N 8E1! ' 8G' F  z6`_m?@7?k?okY4`@44` G>] ""׀46_54+rH6K>iK>K>k< *K>ߟԟK>yK k?45@H44?"74@4Kv k?+rH3k>z 4 c?1+rK?14"k?!+r43k?)Ka?44k?9֠ k?1Ka?45Ka?k?A46+|k?I4<@k?a+r4!!k?Qk?Y4K>5k?4@`44?!07  #W7ZH4_47=Y#77:x4_M4 G=]+r"6(4:_ 4+r"684:_4+r!5H4:_44+r W4YH4:_]4k?Y+n0Kh&8 k?q( k?4?pk?( k?47xk?+bk?i49k?y c K>qk> k>7>7>444?}7K@7?ςK>  4 "@R@@@  4 "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4& "@@@@  4 "@@@@  4 "@@@@  4 "@R@@@  4r "@@@@Ka?4! <4?@@WSE}@ 3 K> U@WSE}@ 3 K> @XE8 Wy@>_@ _k?7k?#Wk? 7Yxk?4_4 @@K?K?7_4K? *@K? K? 7_4K? rKa?H:@7?#74_-4@x7?7?7_4#7794_4Ka?_H:K>@7? 44@B7?@B?7?B?@7 7?"6`/ '047?'E' 81@0N1N 8E1! ' 8G' F  z6`_m?@7?k?7+{H60+r H4?44477K?Y@7?K?Yk?4?k?474_4$4?+{0 h< _H: eK?Y+r#74:079_4%K?Y_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?+H5?H3?  k?k?ok? k?k?k?! 7C#77# +H74@4%+r4'p _4y *H4_ 4|+r48x 4|K>K?!K?K?K? @O?k?ok? k?@ k?!+H74`P4$+r4%pL(_ K?! "H4c_L(4?4|K>K?K? @O?4|Ku01Ks09 k? # !2k?ok?7D@ 4@ _u4#774_u4@4^? 4 _84"66 4 _4w4|K?YK?@O?`4|`4|Ku0!Ks0) k?k?7+H?  _@K?Y@7? # !2k?7+y4h=`4h h4?h5p47`h x"h 6h=6 h=4 h h h +H3k+ _h7 hK?Y@7? # !2k?ok? k?k?k?!k?)k?1k?9k?A7+K>K>K>K>7 # 6@#:#Z#z#`# #+r4&:4 (: +4(Ch:4 8C4 0CI4 @׸ DJ4 H ?DJ4 P _DJ4 XDJ4 `DJ4 h?DJ4 p A 5yI4 x׳ Y A 5YI4 U U A 59I 4 ׋ 6 A P4I4 A A A 4I 4  " A 4I4 z z A 4yK>K?AK?9K?1K?)K?!K?K?K? @O?Aw04 @<@AX04 <@@ 04<@@04_+s44'p A 4f_ +s44&p A 4e_ K>K?!K?K?K? @O?@0@K?@ @ (p )Rk?7ZP@+H7 #E`7 +H? h _u4K?Y@7?@0@K?@ @ (p )Rk?7+H? _4K?Y@7?@@K?@ @ 0@ + # !2 2 ( 3 . 3 '" # , 0` ! 0p , ! !Bk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Q_ w+4eH7 4$4x4_4+H7 4x4_4H  +H! !J *+h +4(h? +h +4h? +h?+_h H+h< DT7?H  0+H8@K?E4z0(+d`H8@K?E4z+d`@"Ѐ 4zE49E4zH #+H8 44y_4 +H5 4$+D h5 +H6 4!4%+4'+x4(+4)+4*+4+4 4 D d@H @`_4z_@4y04x 4 _4A!h4yP4xp_4A!"il Pa-Z`iLH  :D @H 4`H  >@+H h 4yP4x _4 H  J+x@(! O04zD44_4+H< + Ph +h +h +h @+h 8+h P4e _5@+H74$4y4 _4H@J+4&_4Ӏ;Z``H_@4yP4_-4 K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?444_ 4A? h ZpiLH @=/4E4z 4@0@K?@ @ # ,k?7#D 7"D6 4_4?K?Y@7?@`@K?@ @ 1p .b 4p % 0p , 1p #2k?ok?+H9ȇ #W_}7Z 0@74_e4+H94#?@J+4$_54Ӏ;Z H`Hw_@_@+4#_4Ӏ;Z `|@@@K?@ @ 5P #2 # !2k?7_@+#h 47 P7 _4K?Y@7?@`@K?@ @ # !2 1p .b H3> k? # !2/'0_k?ok? k?k?k?!+H6x+H5p+H:X+h6h+_h5`+H:h_}77 7+4H:@4$ec w+H8X+H7h_E4y +H:P4C] h _@ 4Wb@7H@_4y +H@_H9P+4H:_A  `7 4?@H@_}4y 0+H@_]H9+4H:_ k?1`jK?1 7:@JH@_4y +H@_H9K?16} +_!H:`J 6@2H@_e4y!+H@_EH9+H9p+H?`+}pH@h9 +~@h?44y!_4 K>K?!K?K?K? @O?_]4y K>@P@K?@ @ # !2 0@ + (` /"+H5K?)K?!K?K?K? @O?+4h8X+4h4X4h5X_}4z!4z!_]4((4_=4z"0%+_4z$7_4z$U+_4z%@++H9`_4++H9`_4++H9`_e45++H9`_54M+ # !2k?7_ B+b h< 4?K?Y@7?+_ H:+H7#+{h<7 k?7&_54 +{H9 ϟeK?Y#7'K?4_4ˀ%K?Y_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?@ 4#7C_ @47_7?@ 7\ˀjC :? *7C ?79 7(4@+H5?AH3?I k?+H5:QH3:Y k?k?ok?7_ 0444|K?YK?@O?C@?4|7_@  _ 4c ?@?@M4|7@`4Z47>"''E6 0, 8$0c?o0N1$N 7?m14<9AE'E8G7?1'G z7\`/p<?87>87?0N1$N 19AE&`E8G`&yGy 46`@.6?87>87?0N1$N 19AE&E8G&G 7`.`5?87>87?0N1$N 19AE&E8G&G 6`@-4?87>87?0N1$N 19AE&E8G&G 6`-P3?87>87?0N1$N 19AE'E8G'G=6`@,=?87>87?0N1$N 19AE$0E8G 0$(G ( z6z`,@:?87>87?0N1$N 19AE'AE8G'XGXA 7`@+!?87>87?0N1$N 19AE'E8G'G 7\`+0<?87>87?0N1$N 19AE&`E8G`&yGy 46`@*6?87>87?0N1$N 19AE&E8G&G 7`* 5?87>87?0N1$N 19AE&E8G&G=6`@)4?87>87?0N1$N 19AE&E8G&G z6`)3?87>87?0N1$N 19AE'E8G'G 6`@(=?87>87?0N1$N 19AE$0E8G 0$(G ( 6z`(:?87>87?0N1$N 19AE'AE8G'XGXA 7`@'x!?87>87?0N1$N 19AE'E8G'G 7\`&<?87>87?0N1$N 19AE&`E8G`&yGy=46`@&h6?87>87?0N1$N 19AE&E8G&G z7`%5?87>87?0N1$N 19AE&E8G&G 6`@%X4?87>87?0N1$N 19AE&E8G&G 6`$3?87>87?0N1$N 19AE'E8G'G 6`@$H=?87>87?0N1$N 19AE$0E8G 0$(G ( 6z`#:?87>87?0N1$N 19AE'AE8G'XGXA=7`@#8!?87>87?0N1$N 19AE'E8G'G z4<`"<?87>87?0N1$N 19AE&`E8G`&yGy 7`@"(6?87>87?0N1$N 19AE&E8G&G 6`!5?87>87?0N1$N 19AE&E8G&G 6`@!4?87>87?0N1$N 19AE&E8G&G 6` 3?87>87?0N1$N 19AE'E8G'G@ 7?=6}`=? 7? 4Z]+H8+s4=p !  7!" ::"@?:4x@+h @7>  h4@7>k?7_@K?Y@7?k?ok? k?k?k?!7K>k?A7$k?96@!k?1!^K?A7^4``7?ajarar ab g4`P 4K?AK?1@44!444K>K?!K?K?K? @O?K?9Pg_4K?AK?1@(4 r4?_ M4ˀEK>ˀ5K>ˀ%K>ˀK> 4 # !2+H5=1H3=9 k?k?ok?k?7CKX7%#47_]4 #744 _-4HzE 4 "@ _@ `^4@2_A7 74_4Hz@ _@ ` d#7Hx479_-4 K?YK?K?@O?k?7 _@K?Y@7?k?ok?k?7$7\7 4 ʈ@€ `@7_4 z`"7 8_"` B`"79_ y" _7K?YK?K?@O?k?ok? k?k?k?!k?)77D7%!@6 #77$ #7@!@! '! (!* Z_4 _4Ӈ_5 _5ӈ@ʉ`Ҭ?g '4K>K?)K?!K?K?K? @O?ˀK>ٓ 4?K>ςK>ّ 4?mK>ς]K>ϟMK>ς=K>k?ok? k?k?k?!7D7%@ 4"6 #p7_%4 _E4ӆ_4 _4Ӈ *4c &  '?m@4|K>K?!K?K?K? @O?+H59H39  k? # !2k?ok< k<k<k7=_"44 4@ *_5 _5ӎ.%J'4Z'' 4 ':  4X B 04 B(z4(J45`$`5A4 04 ŵ&BK<@4 0k<_M5z _m5zӋj%44@K<@6R@%Pk< Z_5z _5zӋ_5Z _5ZӊK< >@k-75z4_5Xk? j  4?45z_47_]5zf 6? 4K>O4T@44 H40606?`5JA_?@#4 #4 4 _6k<<@K<46_=K< 45Sk<55A;@bm54 4 "ڬ@j%*4 #7 נ444 _444 4 4_UK< "@4\ @ "447= 4 +H. ?44?44?444@4_4 ˀK;ـ 4Tt @ ςK;ˀK;ˀK;ف@844~844 85@ ` 'ˀK;bu4@ @? ?8407x'4 6җ4ˀhK;ˀXK;^5Zɼ5?6:4_4w047@5? d 5E_K<m@ _i6Z?]76:_6K<^E6: Q K<6:4_4x7_ e6:_@ςK;ˀK;Ax ςK;@ zK<5z4_54x`J4@@ 2K<5z4_4x4@ 4@4K;K#k?y74gk?q@5  @0K?q`BCW 2^@@ K?q % K?y4?_ 5 `: @*  7 5 `PRB4BG` _4  ˕L   50K?q^e@A>M@^)5~/ K?qK>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? # !2k?ok? k?k?k?!k?)k?1k?97(K>k?A7K> 6 W4H 74' #7 "נ6 wK?A44y`_4 A *@ @ @!*FK?A2I4i^5:74y458_M74""A 5:^)5A@ 5:^4b@ 5:^4B @ 5:^4bK>@@bD$K?A74y 04x4 _%7aꌿ@aꌟ@BK> 2+H8K?A4z _ }4"K>q4"JK>yb:+4' @!HK?A_ 4"r4_ 4ςK>44y5_4 ˀK>44y4_4 ˀK>44y4_u4 ˀPK>44y 4_=4 ˀK>ςK>K?A4y `4_4ˀK>K?A4y 4_4ˀK>K?A44y _4 ˀ`K>44y @4_M4 4K?A4y _%4 4K>K?9K?1K?)K?!K?K?K? @O? 4y p4_4K?A44y _}4 ˀ]K>_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?o7C^k?`:K??7? |  *_7?4K?Y@O?K?Y@X@K?@ @+H5;1H3;9 k?k?7C@+`4:_4K?Y@7?@ @K?@ @+q04@h?+H5>H3> k? # !2+H5>AH3>I k?k?ok? _U4 k?44 4 _]7K? j_MK?`P7_4 k?44 04 _7K? "4?K?YK?@O?_K?@*+h#+h<ςK?YˀK?Y+`4? `4 _"+h h @h k?7_@K?Y@7? # !2k?o+H?H74 * 77 RX7 #7 `7 4_]4wK?Y4|@O? # !2k?7+H=H74? 6 RY79  8 : 7449 48 _]4 ϟhK?Y6k+`43 ` 4 \8k4k4K?Y@7? # r # !2k?ok? k?7D#7%7 k?!4_4@(4_= :_7"6 K?!4 _-4w4|K>K?K? @O? # rk?ok?"6k?^ a7DK?7_4@4@ :4_%@ :@ 7`?@4|K?YK?@O?+H7H34w 4?+`48 ` 4 ]7KK74k 8kK  58k@@@+H5;qH3;y k? # !2k?o+H8  #47(_m7?k? w4x k?4y 4 _e7K?`G?` G?@K?44y_ 4_@K>@O?_@K>_@K>+K?h7+h?4yP_e4 +H7K?4yp_54 ς5K> # !2+H5>H3> k?+H5;H3; k?+H5:H3:  k?k?ok> w4x k>44y_4C0@ 7Ka?4:@C 4yKa?4:@C4y0ǤKa?4:@C4y`_e442_4+"h<+K>h 44y_4+H9_42B 4C@4_44 _44"_44_4_e@_7?Br4z _@$H7+s4484y0_4 _E4zP$(7_%4z`$07_4zp$87_4z$@7+}@4: ^4y_4z$0k>E`@+r4$7^4^4d0+r4^`3` 44y4_u4 _@4K>YK>@O> @K>44y_ 4+4h944y_4+4h<+s4:Pk>7?a_94+s4:k>7?_ 4+s4:k>7?=_4+s4:k>7?O_4+H" K>44y@_4 K>44yp_4 K>44y_]4 K>44y_54 C?k4p4 +4h:h +H7K>4y_4 4z +s4:_Q4~+s+}p4: _!4~+x04: _4~+b4:_4~+}@4: _4~+}@]K>^7+7;h<^MK>w4= 4^;4 7 +H59qH39y k?k?7+H:@ _4K?Y4@7? # !2+H5?H3? k?+H5=H3= k?+H5?H3? k?+H5;AH3;I k?+H5aH3>i k?+H5:AH3:I k?+H5>!H3>) k?+H5>H3> k?+H5=H3= k?+H5?H3? k?+H5H3> k?+H5:H3: k?k?okh?M@_ HP_ HX_ H@_ HHC4z5|^ 4+`4:5^]4 +H0h*8+hhh`Mh)+`4:5^44y _ 5h4y@45_ M7+`4:5^m4H؈  h4 h+h +h*8+h +h4`h5@5hCp@4y4x5W_ =4H4y4 _ 4H4y4 _ 4=4jC(5I9p44y`5_ 4 y5|Ka?4:@4yC H5Ka?H74y5_ -4_ EH4?I9ph_4u5|]4 87]u4 7]U4!Z _ e4|H4 _ =4| 4_ 4747=Q^M5y44y05x_4 _ H؀ x7Aw!J5z7=Q_4 4h4y@5x_U4H4h_ E7=Q44y`4 _7=Q_ H77=Q4_7 4h4y@5x_4H4y4 _]4H/'H+H! .H44y4_4_Hh4y 54_5w_H4?I9ph_I4}!b+s4$4yP5w4_=4@4@x74zC p4+s4$4y4]e444y4_4 +s@! j^)40 P7+H84y4]4F4^U4w5|{5|44y4_4C 4zuHk?7+H?0 4B??K?Y@7? # !2+H59!H39) k? 2 *bk?ok? +4 H7k?4p_U4 +H7K?4#4_4 _Q@+H=؋c+H4#+H7+h !Ha`+`_ H:0+`_H:(Hz+`4?h?04_h?(+ȁh@_%7?Hx 2 *K? ?h@h`+h`4?h"Hs zK?44_e4_@K?h`+H74_4 4Hv ZK?44 _4@ @ Ka?4:@C4`Hu!B+sH9_4h|_-4K?47_-4 +`_%4:Ј jK?44_4@@K?44_4@@+H7K?40_m4 +_H:B@+4?h:4K?4_44K>K? @O? # !2 2 *bk?ok>+H6؈@Ȁ4K>44y0_}44?K? +H:K>k? _7? d"K? K>]7?44y7?_4 4K>YK>@O>+H4` Ȁ4+H5Ѐ 2_4`4m4+H< 2_-@`44 w4x k>44y_4#H+7H:k>_7? 2K>44y@_U4̟m44yK?k>]7?44y4 _7?K?K>7k? k?7?]m644y4 _7?"b@+6yH:k>_7?@2K>44y0_4̟54B4+H:K>_i7?\%4K?K>]e7?44yp4 _}7?K?0K>44y_E4̟K? 44y_4K? K>44y_44? # !2k?o+H:؈@"4?4|K?Y@O?+H9 `4|+H= +`h +H3Ѐ `m4|+s"48_ Q6(#7 k?77 4 _7@2#Ka?7 PH7K?_}4 +h  # !2+H5<H3<  k?+H5=H3= k?k?ok? k?@k?)@074K>K?K? @O? w4x k?!4y p4 _4Ka?_h K?!74y 4 _7!RKa?4K?!4?h?4y 4 _E4Ka?H8 K?)4y! 4_4+H7  K?)4z!PB4B l@_K?)B,7K?)4y!4_u4@ ˀ-K>+H9 ςK>4_4Ka?H7K?!74y _4 K?!4y 4 _4m@eKa?BY@O>4?k?ABK>K>_7?a#k>7"47?a_m7K>ar4?k?A@z ϟ=K>YB <@Cl4zB k>#7 K>k>7"@_4 K>@ ϟK>YK>4>@ ϟK>YB @4z_4B Dk> wK>K>4y"`_ 4 K>^K>ϟK>Y Wc?4Y7?A_57?aJK>h zK>7?A_4K>"wk>6y"4 _E7K>`4?k?AK> K>7?Q_4K>"k>6"4 _7K>$`4?0k?AG?QӁk?A4?k?A_9K>"K?AK>6#_4 K?A # !2+H5>H3> k?+H5;H3; k?+H58H38 k?+H5?aH3?i k?+H5=H3= k?+H5?H3? k?k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=a+h 4$+s` 4)+s` 7H_m4%k=4^^5 7 w44y#`4 _}54y#7>A]5A4f#04  P5_ 9 24@ _ ?444y#4 _4@4_ Қ 25kAz5J_ Z?5kA `4 Au_ 1Һ b5kAs4 _ z 25kAy5J_ :?5k Am 4g 44y#4 _e4@(+s4=+Kh  4*C!+s4+44  y4y#5]-4B@C 5'4B74y#54_e5! y]4y! y0iM k?4y$5]e444y$04 _5B@C ,5'4B74y$P54_u5 _]5& hC>O y5)4y%47>A]e5:`4y% 5_4 J@ :+H/  "44y%04]4K=4y%P7>]4+H7 r44y%p4 _5844y%4_4 44y%4 _7>B@4H_7>@p7Ka?H74y%4_e7>Ka?H=#BB l4B l4z&B44y&`4 _7>44_%7=+H.7 z4x K=k=y4y&_4 K=y4y&4 _e4K=y4y&4_=4 _!44H_7>H"+4'Ka?44(7>_}59044j h4y'4 _5XH!B44y'04_M5XH4_4 I4y'`4_5X4`ZI J_4H4_4?IXH_ E5:I Z "+H+ B4z'hH 4D~=47>+H3`#_ 7>B@4y$4x 4 _4?̟P4@ Z4k=q_u4HK=q74y'4_57Br`7>_ @B@H4y$D04?4x 4 _4h45:]5̝@444y$5Z4]5Bp@C5Z'4 B 74y$54_5X85)_ 5Z85)5:]5Y44y$5_}4 4y$4x 4 _U4?4?4K # !2k?ok? +H7+s w48k?4y( _4+H9"z+s@:"b_ eK?_%7 RK?4y(04_4K?4z(`B44BP@Ka?K?_h K?74y(4_7@BKa?H7 +H8!r4z(BK?+h +s@?+s ` +s4:k?Ka?_h K?k?!4y) 4_7K?!@BKa?H= +H3` 4z)PBK?+s` +H:4_M4BX@4K>K? @O?+`B<4:m4z(+`B4:54z)P # !2k?o+H8Ѐ 4`4| "w6x k?!46y)_u4+d`D7 48 d7 +#3H:^-790 WK?!74Y)4 _7"K?!46*0_44|D!J#7 k?47*_m4+H:+d`48 k?)^=#2 7K?749*4 _7A+d`D? +H:+d`K?)"d? ^ 607#K?7*4_e4w4|F j#W7X 7Y+k?4_4"נK?46*0_44?4|K>@O? # !2k?ok? k?k?k?!+H?7F7%d7 4 k?A4+@4 _]4wK?A4+`4 _54K?A4+4 _ 4+h#@+h&` 4+h'}04h=4#K?A4+4 _}4HwK?A4+_U4 H}"+H3Њ`"+H4 +\ H:؃"  +h%Hu!"7?Q נ&4 /00N8F&F@ K?A4+4 _=4 4 Z+H?004 204 +H68 4+sB(4:+h +H: hB!R+sD%4(Fd&4_48+sD֠?d4Ht`+`̒0`H: 349(^u4dz+4h ן4K>K?!K?K?K? @O?ˀK>ˀK>و J+sD"4]d'4_48+sR J+sD3D<44(  w GXd'D F P @+sD<4 d'48_4+sD9D8D:D?4%+@d4? 4ֿ֠d_4( H7 d4 _d=7DHz@=D+H7 BK?Ad44,_4X+ BD րK?Ad44,1_4+DH? 4_?? d4ރ_ z4ڃ 4ʋ<4D 8֠_K?Ad449,Q_44D X_K?Ad44Y,_4e4#7,K?A4_E4%4ϟK> # !2k?o+H!7C a#"7-6 4 _4w+H"Ј@ d f p +s484z_4+sD44 d#+H:+s#48^7(`ˀK?Yן4K?Y@O?b R+sD84( Zd:448_%45+`?'++sD?4 d=448_4+ϟK?Y # !2k?ok? k?k? W+7D7# 4X H7k?14-1_u4 +H7K?14-Q_E4 K?14-q4 _4K?14-4 _4w+H:+4@c0h"+H4Њ$"+H5$+H3 R+H6 :+H<| "+H?0+H6$+H! \@$ K?144._4+H9 7?A#&7 /00N8F&F@y 4l Z+H?004 204 +H:8Y 4+sA4:d f p# +s484_4z+sD3D84&+4 w\H9 d[C  d+H7 +H? #bD#ןK?1d47,_4`+@@`ˀ@K>Dנ?dDDDנd+H:4``4(4 d U"sd6y(^14cϟhK>ϟXK>ˀHK>4K?1h=44-_=44K>K?K?K? @O?K?144._4ˀK>44.Q_4ˀuK>ٌb R+sD54( Vd6448_ 4z+sr J+sD4D=44(   Fed&`<]+s448_ E4z+sD54 d" :DK?1@d44,1_=4+DH? 4_? d4ރ r4ڃ? 4ʋ # !2k?ok? k?k?k?!#77E78 xk?14y/4 _}4+H7K?14y/_M4 +H7K?14y/_4 +H"4@a*+H$!+H'!:ˀK>DDD+H:  $]dX SK?9d Ud T 3d^49(K?1k?I4y04 _7K?I@j4K>K?!K?K?K? @O?+H?Ѐ ˀK>و@ ϟK>#74(H44-%'4E'R4&4&b4%4%r4$4h$r4#4x#4<# 4("""!!B ҄ b'K?14y04 _ 4K?14y014 _44K?14y04 _44K?14y014 _}44K?14y04 _E44K?14y014 _484K?14y04 _44K?14y014 _44K?14y04 _u44K?14y014 _E4h4K?14y04 _ 44 K?14y014 _44K?14y04 _44 K?14y014 _u44K?14y04 _=44K?14y014 _ 404K?14y04 _44K?14y014 _44K?14y04 _m44K?14y014 _=4`4K?14y04 _44K?14y014 _44#ϟK>K?14y04 _44K?14y014 _]44K?14y04 _%44K?14y014 _44K?14y04 _44K?14y014 _44K?14y04 _U44 K?14y014 _%4M4K?14y04 _44"K?14y014 _44K?14y04 _44$K?14y014 _U4}4K?14y04 _44&K?14y014 _44K?14y04 _44(K?14y014 _444K?14y04 _E4K?14y014 _4K?144y0Q_4ϟ-K>+H:+s48P#k?94%^ 7(K?1k?A4y0q4 _m7K?AtDXϟK>ϟ}K> # !2k?7+H9h +H:k?4?k?@`h="x#k?6y07 4 _U7K?K?K?Y+K?h?+h7@7?+a4?+q4?4<+q4?_4d444 k 4,k(4k04Xk84k@4 `kH4kP4kX#8Pk4%k`"6 kh"6kp %4:,kx#7k"#6k7k+a4&@h?+q # !2k?ok?+H?!+H7Њ!#7+78 H7 xk?4y0_e4 +H:؈@H+sD?(K?4y14 _ 4K?#7(^Q48PK?k?4y1A4 _7Ka?H7K?4y1q_}4 K?`+sD7XK?4y14 _-4K?44y1_4 4?"w6x ( ̟4̟4̟x4Ȁ@K?(4d444 4,44X44 `44x4%"`6 #H7 %04$, G4D 4?K?4y24 _544K?YK?@O?k?o+H?4p4]]@ @K?Y@O?+H<8 # !2+H5:aH3:i k?k?ok?7#k?"#X6 7Y21k?4 _U4w+H7H4$!עab`#H8K?72Q_4 H8`R\4z hH+aHHH8_49-qH8h@+aK?4:-q_m4xh84?h04K?YK?@O?ϟK?YϟK?Y # !2k?o+H=Ka? Hh +H78`*#X7Y2 748 _u4 +H?8`4#@P@h|8+H7 2#W"ؠ7X Hw862_4 H8@:h`0+a7?@<-qht8K?Y@O?h`8Ka?H7#7 k?4?#8h0793_=4 H z+H3b bKa?H7 J 2#8K?793!_4 ^=4ϛK?Y bHb RKa?H7 : 2"K?63Q_M4 ^4Hx8`4?eK?Y # !2k?ok?+H7Ѐ +`H$0+H$#Ka?h 7 xk?44y3_M4+a4^49-qK?k?4y34 _7+H70K?4y4_4 Ka?H7K?4y4A_4 K?K?YK?@O? # !2 5 # # ,k?ok?4\ `7D+H? "H7 +H8 B +H6 "4K?YK?@O?#7 xk?44y4_4+sH8+H9 H_К74y44x44_}7B"A ڄ@„ `z @@22ˀK?YA@ϛK?YA@^4ϛK?Y+4ˀmh9 H+ˀUh HE4+x@:! r+H= Z+H3  BA@K?44y5_4ϝK?Y+x@5! Z+H4 BK?44y51_4At@ϝEK?Yˀ5K?Yς%K?YA4@^4+H!  :+H" "4_ 4ˀK?YϝK?Y # !2k?ok?+H?4# 4 Ht 4+H504204 +H< 4#X7Y5a#Hw87 _4 H8`+a46-qk?47?h}8`jHs0K?6? h0Ӛ8_M@H8_7?04?_U@Ӛh`84?ha0K?YK?@O? # !2 2 /k?ok? k?k?+H?4# 4 Hu 4+H604204 +H" W 4+H!Ѐ +`H$0+H$H+4? h7]@` נ7?]ec?`"C?454 _54 Hx ]@_7?#7+78 H7 k?!45_4 _@Hz +H=  +H3Ђ` R+H7K?!45_=4 +H4؂`rϟ@K>K?!445_4_@K>K?K?K? @O?K?!446_4#47(]54ˀ}K>+H?@4+H5K?K?K? @O?@@@K?@ @ # !2 # ,k?7+4#8#h? 47987 _44_}4?K?Y@7? # !2k?ok? k?7#k?)_4K?)]}4# 7 k?!448!_]4+sH9]4+H7 K?!48Q_ 4 +K?!H7P48q4 _4%+H?  HP HPK?!48_4 K?)]M4HP`04 y4] 42H@ hK>K?K? @O?K?!48_4 42] 44] }44] e4mK>@ @K?@ @@ # !2k?7#791#47 _44] 42+sH9] 44] m44] U4K?Y@7? # !2k?o+H!k?!7C Xk?i#K?!7\y7?q#79A7?q4_]4wb Z+H8@K?i6k?i]@K?i bHk?i +H" j+H?؋ab+H9 :+H:0 "A@@7ǷKa?K?!"Hh 6 ]7?i+H87 #7 #k?79_4 "K?iK?6:_4 Ka?"H7K?6:A_m4 ` K?iϝK>"נ6 #79a4 _ 4x+H3  :"ؠ4694x_4^44?K>@O?"+6 H78"xk?6y:q_M4 XK?iK?4Y:_4 +H?8`K?i k?i#W 87X K?i49:_4 K?i~K>ˀK>k?7+H?Ѐ +`H90+H9_54K?Y@7? # !2k?ok? k?k?k?!k?)7E7#4Ba4Ȁ(4H6 748 "k?16:4 _=4bj+a4<-qk?94gH87Y?h8 aH0K?96 h0aH4  "_H8 ؠ+H?@: 4?h"_@@̂4+H44&>+]@`Jg]@ 44?]@_g _ @@2ȇ44?_m4y7g _E4 _@=@ K?14:4 _574? ؠK?14;!4 _4`d  `4?4K>K?)K?!K?K?K? @O? # !2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Q+H<7E7&4c04"נ6 k?a4;14 _444;A4 _4+H4Ѐ +`H'(+H'+H70K?a4;Q_4 +H30  \ q6 7@4 Z+t47 p 85" Y "5 @? 84e5`4Ka?4 4+4 4 4;qK?aW _]4 44^!4!7AIwK?a4;_4 I!"@845J?O4;q \U4zp4 ?5<K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?;5<K?a4;5_4 `?W5<\}4z55<+H! Z+H"B BKa?H7K?a4;_e4 ^44? \4z(5<K?a4;4 _5  ` @04^@5J? # !2k?ok?+H#c??@"4?K?YK?@O?+H=+` H#(C??+sH9c??])4+h<]4+`RD4]4:Ѐ A@4?` ]]@+H6 C??"6 #8k?79<_]4 +H7 ""K?6<1_4 ϟeK?Y7??4z^4`jA@]e4#WKa?"x7X H76yk>k>k>k>k>k>k>k>k>k>k>k>k>k>+k?!7.H4k?7DC>4 4 4 ?h04 W4X xk? 4y44_K?! @D@_6\4 K? 'r4 H  @?4'b@Ҷ6?Ӌb@*K? 4y>4 _ 5w4 @>@5b^}@ _>]@+H/'K?P'K? 4y?4 _e5wK? 4y?14 _=4H8gj4@ @&7K? 4y?a_4 H8@_4k?4y=K? K?_4 5?d4+a49-q+t40 pKa?K>k?41HXj _[H8K? 4y=14 _6W4?hX H "H +H5  Z+H:  B_6Zc7B +@' xH;@+H=(  T@H <74 +H3 `<4 H+H7 ;4 +H" 5{@K?! @4@+H? B7A4z>1K?! b+sH9]4+K?!]h<K? 4y<7_4 +`]4:Ћ K? 44y<_U4+H8@+H: 44 4 4%h&@<7H4%k?[6\44y<_4@@_6\_ a@\M@@@p6\] JH :K? 44y=_4]U44?@L@6\K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>@4z>Q]U6\K? 4y>q4 _6W * "@"4I?)7]@`7M@@ ) _Ӫ_5J?K :  6 K? 4y>4 _-5w4 K? hX4y?A_4 ( K?4y?_4 H!+H3@!44J@4+7h<@ajK? 4y?_%4 44y?4 _44`h4` 7?7?06Z 7ѹ$Ҽ$_$7 "X"44y4 _4h+h @hK?!@ @ @`x4?4y04_e4F6\@@@K?@ @ # !2 2 *bk?ok? k?k?k?!k?)+H"c?+7E4#h `@cbH 4 Hg 4+H(04204 +H4 4+H7bH ]7?B+@H7Hx8@+sH9] 4h|])4+`7]A4:Ѐ 4ha`4?@l@c"7BHfHu86?h}8b*He0+a4hx049-q8 @ `HbGHv86?hu8aHy0+a7?h04=-q ""x6 6y4 _5ahc?@"` Ha'4K>K?)K?!K?K?K? @O?4#X7YP7X`_4+H<4?ӇUh6"xC?6yp6x_m4C?_Y@@_9@]"`4? B#"76 4 _4]4Hf>%@>@_@h`Ka?4h: # !2 3 "k?ok? k?#+7D7 #8k?14#H779_m4 Hs؊`aJ+H4Њ!B+H5!Jab4'aR#X7Y0K?14 _47?A 7'46 .00N8F'F`B 4Hz]i4( `_44K>K?K? @O?ϟK>_4K>_@K>ϟK> X4ZP@@ϟUK>k?7_u4&K?Y@7?k?7_54 K?Y@7?Ku1Ks1 k?+H5:H3: k? # !2k?o7#k=44_M7=K=\M7=+`h 4?h#Ka?k?4h 44_7=`"w#XKa?6x H77Yk=_4 K=\%7=K=#k=!74 _7K=! 4K<@O=Ka?"#8H76 79_-4 ˀK< # !2+H5;H3; k?k?/,/-ok?)7C#W7X 8k?I494 _M4w`A24Ј}`7?Q  W$F4V . 8$ 0N0$]} 1#7 '0N08G$H  t`#8K?I794 _E4w+`4:k?Q_-49`Jן4K>K?)O?!/0-@/0,ˀK>K?Qc ]k?} +`h  h3444_54#70K?I7_%4 ˀK>+H5;H3; k?k?7_4+K?Yh<@7? # !2k?o_M4+H7# 7`#7 4 _4w``K?Y4|@O?`K?Yk?7+`4_4:`K?Y@7? # !2k?/,7p4_M7>+`K>H9hK> 7H8`k> `0k>"z6} k>7?k>7>'X"נ6 0.'P.0n0 +H!1& 1 0$ 0H R#1H7p[q7?!#477?!_e4 1HK>Y7>@/0,Ku1qKs1y k?Ku1QKs1Y k? # !2k?7k?+4?h? +`4:k?49+_h? @+`43&`"6 0/H8+0NK?47 0&+_h8 _7K?+\#8H7 797_4K?Y@7? # !2k?o+H4 :Z4 (+H3`Bˀ(K?Y+4?h?4?K?Y@O?#8#4797 _4"6 ] 4RC4#S7Y(+sk?48 \=4z@ ϟ=K?Y+sK?48\4z@ ϟK?Y+sK?48\4z@ ϟK?Y` ]I4z+4ς}h= # !2k?ok? #k?+ x7 H7k?4y_4 +H7 K?4y _]4 +H9"`"+H: @0_ @+H=`z44K>K? @O?H7@K?4y_4 +H3 ` Ȁ4+H7K?4y@_U4 +H7K?4y`_%4 Z4K?k?!4y4 _7K?!>+Ȁ4+sK?D7+`K?`= +4h34y_]4 K?+sD5D?׋ @7ԟd$?d?4y_4 +`@6 +s4`?4`6 S`44`4484Y(\@K?74y 4 _=7=4 # !2k?77Y=k?Z4 4K?Y@7?_@"x#46y@7 _M4K?+sD9D6D=4`"4`7?_`? d6{C`? 4 d4 5d<48+``7 +"h?4\6(K?Y # !2k?7#W+7X H7#k?7P_4 +H=`4K?Y@7?Z4 ˀK?Y#7pK?4_ 4+K?#8h 479_4+s"448 \ u6(K?Yk?7+H? c?? +H7 27??4] 4K?Y@7?_QZK?Yk?7+H? 7X 7:+H7 *7Y] e4K?Y@7?_ a7K?Yk?7Zk?+H? 7 +H7 *K?]4K?Y@7?K?_ 7K?Yk?ok?k?K]C +4#+4$7EH  :H *Z  _ 7 _ `J C ?H 4K?YK?K?@O?ϟK?Yk?7k?+H? c?4c?4 c?+H9 B_K?7?4]4K?Y@7?Z]K?K?_77?_y4K?Y # !2k?o+H9h 2Z=4 4?+h#h#+7#H7h7 _U4 +H: @ r+H=h`Z+H3  +H4 :4^M4K?Y@O?ˀK?Y+H9^4K?Y # !2k?ok? k?k?+H? 7C z+H3`" Z+H44$ :+H7cH \7?C2`Ka?4# נ47?]i4?4CHw4 4 _4 Hw"+H?4$?w4+`@7 hh+sH9\54+h<\4z 748 k?!4p4w_4 +`\4:Ѓ" @ 4?K?!44 _m4wKa?H7K?!4_=4  RKa?H$ :+H% "+h +`@? 4|K>K?K?K? @O?_q4z7+H&` 4?}4|#X7YP7X`_%4+H"4?Ch<#C?77_4C?C?4|47?]47@ @`]K?!eC? # !2k?7"+6h:0#7W7 _4 +K?YH<0@7? # !2k?o77k?#7C7#7 _4 K?D  H H4K?Y@O? # !2k?7+H? +H7؊`+H8 "ם4?K?Y@7?+H9Ѐ ϝK?Y 2+"bHH:6y\7?"#H47\]7?@ ϟMK?Y"#K?67 _4 K?44ݟן?ן_ߟן_ן_ןK?Y # !2k?7 4?K?Y@7?4\ -40`B#8#479P7 _e4ˀK?Y#@7 #WKa?7X #H770_4 ϟ%K?YKu0Ks0 k?+H5=aH3=i k?+H5H3> k?+H59H39 k?k?7+H:p_ _]@ J+H:_ _e@ *4K?Y@7?τK?Y+H?p +_H:xςK?Yk?o+H?4 (+_H: 4+H7p "+_-H:x ?K?Y4|@O?k?7_%@K?Y@7?k?7k?_k?K?]K?_k?K?YK?@7?k?ok?_m4 P7_@+H? "_E@+H7 _@7 J_@+H8p "_ @+H9p _M@ C4|K?YK?@O?+@H<k?7\U4+H9Ѐ "\y4+h 4\I4K?Y@7? # !2k?ok? k?+H4؆"k?)_@+4?\h9@ 7_@!+H:\u4+H:\U4\}K?)#K?)774 _7z 4\]@+`!24\4k?14\4k?9"w6z k?! x7?\=@K?!74y4 _7 ?7?K? h+hh7@#@`7pˀK>\i4+ˀK>h?@4yK?!_%4 +H7@K?!4y _4 K?1\ 4K?9\4+`@6 _K?04K>K?K? @O?+H5H7 k>k>7>!8k>Ka?49 : k?!4=@] 45U +e4%5qK>_47Zy444a04+x@8 l+e449-q444?  j   "4343h79K>_7|4|!!:   "44444@79_  :+x@3 l (+e4:-q 4+eK?!4:-q4_44|K>K?K?K? @O?   "44 ="44/'0/'0k?ok?k?+k?!H7 k?1k?)7?9 k?9_7K?Y+e4$5qK?9_54Z)444a4+x@8 l+e449-q444?  B   "4c34c3@79! !2   "4c4444c@79_G  :+x@: l "+e48-qx 4cKa?47 +e4:-q4x_4K?YK?K?@O?   "4c4 ="4c4 ! *k?7_k?C#7 7P7p#778 _K?K?Y@7?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?+H5?qH3?y k?+H59QH39Y k? # !2k?ok> +k>7CH87$"+H? "+"6[4: #7  "ؠ6 +H7K> :+H:4]14+ah<+H:_M7>ɋ!"7>i4[4y44[}7>Q_ 7>+H:7>Q]q4x4x +H:_K>#47 P4x_4 HK=+"xh 46y 4x_4 K=K> @O>#X7Y 44x_=4 K= # !2Ku0Ks0 k?k?ok? k?k?+H?7$7!@6 #87$  #7  "6  ؠ44 4 _444 4 _4x44 4 _4Ka?k?4 h 44w_u4 Ka?H74 4 _54 @K>K?K?K? @O?+H5:H3: k?k?7_@7\4\7K?Y4@7?k?o+d04#p` pC4x@zX :4B4 b X w8?4cK?Y@O? # !2k?7+H<!+H6 @!+H5 H #+7 @h7 H+H: HCX!4\E4`#+h< @7 k?7 p7_4 +H4 @`+4h3#X+7Y H8 H_E4Ka?#H7K?7 _]4 +h @+h @+H! @ B+H"@ *+#8H8 H79 _4 K?Y@7? # !2+H5Z 4 +sh `Ka?4"+sςPh"ˀHK>K?!44y P_4 +d0` +4K>K?K? @O?Ka?4:@_ 4y 44y 4x _u4 ˀK>ُ`B+H4 *+d047p4y 4 _}4 4FX # !2Ku0qKs0y k?k?ok? k?k?k?!k?)7Ck?1786 4 4_E4w 44 H84 4 _4H04 @4 _4H4 `4 _4*4 44 4_}4@|4z"`"b"4 Z7?q RH8 B4 Ze7?q444_44+H< @ *+H!(`R+H" :_eK?1+d0448p4 _U4 44@4 _-7?qK?1_7?q+s4' +s!xh `Ka?H74p4_4 +H(d+H?#+d04 47p4ˀK>+sh hKa?49 +sh 0h948 4 4_4 +{H7+}ph +rςXh7 4k?4 _4x+{+H744 _54h j Z4+H3  Zt *v "f h j l n "+H?K?1\U+H4a+H5!+d04!h47p`4f?'++H: _ 47\4@87_ _75\44404_m4]+f>O++H=>/+ Z444p4_4+4k?4 _4x444_4+{H6+}p h +r(4h6 K>K?)K?!K?K?K? @O? # !2Ku0AKs0I k?+H5;QH3;Y k?k?ok>k>k>k>k>k> x7D4x k>4y4 _ 4@4a!+}pH= a@@ȼ+s4' Ka?43 z "46 _}@7 +4?!h5Јb+H8 @$ $z+H:@0_u@+H7K>4y_4 +H9$ ^%4+H?+`!ph<p+hH' ˀK>Y4+sH'4 "+s4(P  >7+sAX4K>74y4 _7+s4? K>4y0_m4 +K>4y`4_54 ϟK>YK>4y4_4 ϟK>Y+|4'P0K>@ 04g 2+s4(A@04h +`BL@7+`4:p_}k?^ek>k?a+dPH:+H?k?+H8P+0 4 H= k?q 4k? 4k?i+d074|k?y44p4y 4$p k?4@4K>k?Y4ek?I4Zyk?Q44y4 _4Y4+H: @7\ 4K>4y4 _]44K>YK>K>K>K>K>K>@O>+H5:H3: k?k?o+H< 7# (k?9+H? @ jB bK?9 +dpH7p6?@`h"p+oH=p7h5pC_4` |4K?Y@O?+s47 K7Y? `bK?9 Jt6vHBϟuK?Y@(@M |_ 7 ϟ%K?Y4 y # !2k?ok? k?k?k?!k?)k?1k?9k?A7$k?Y744 4@(K?Y` 4?k?q5?!hk?Q+4(4 4A84 K?qK?Y_7?q`BA84 rK?q K?q4|#77 4 _M4 "K?q Jz " R I"44?4K?q4 Y"44@>4?"K?Q 6 4_44|K>K?AK?9K?1K?)K?!K?K?K? @O?+H5>qH3>y k?k?ok?k?k?+H? 7# (7+H7 @ zB r+s48 4z4_474K?YK?K?K?@O?^@`74_4_44_)4_U |"4=4 # !2k?ok? k?k?+H" Ka? @h +H4 "+sH5Ka?4=" x+4x H7k?!4y0_%4 +H? +sH8` +sH%DyCR+sH6+F׀XH& +sH7` K?!4yp4 _U4+s_]H:7^4K?!74y4 _7"+bH: +sH7_4+dpK?!h<p4y4 _}7+dpH8p"+sH:G__:K?!44y_4Ka?H7K?!4y_4 Ka?H3`14?p4]@@7̝@4`h4+bԢ4&4^5@H C 4c@<_4+bH= +dph#p+o4? h=p̟x4Kp+dp4t?h4p7kp0CK?!44yP_U44?4K>K?K?K? @O?̛40K?!44y _4̟444y`_4̝U4+bH? +oh?p477jp+dp7?h3pC+H5=qH3=y k?+H5:H3: k?k?ok?7C@7$`€ @@ +H7  "+H8 ` b n +s49_-# k?Y e4K?7\i4Ȝ4ԟ44K?YK?@O?Ȁ4Ȁ44? k?_474?t?4K?_ U4k?ok?_ 7C`+H7  "+H8 ` b n +s4$# _7 x t _- 4K?YK?@O?ϟK?YˀK?Y49_# #X7Y7\14}K?YϟmK?Yk?o+H? k? (7+H7 @ RB J+s48_ K?7\i4x|(4?K?Y4|@O?k?o+H8 k?9 (c?7+H= @ jB bK?9+s h4#_1 w 7?77\4 4?@4K?Y@O?C?7 w "6_  :K?9 y Ftҕ_ 4?}K?YˀmK?Y # !2k?ok? k?k?k?!k?)+4#+{HyH8+r 8h8 +}p"xH7 6y6x _E4 +}pH? !4$a+H4  :+H5 "+sH7Ka?4= !B+{`H&+s4'!H_@H 7\!4H@7 "55 4 _4H  h __H4K>K?)K?!K?K?K? @O?ˀK>ϟh 4@4?}h  j#XKa?7X H77Y k?1_ 4 "ؠK?16P4_4 ϟh # !2k?7@`H7W`:+s48 (4K?Y@7? "#77 _]4 ϟK?Y+H5H3> k? # !2Ku0Ks0 k?k?o k6 k6k6k6!Y7D (4?#7Y4"@4 H4B@ 7"6 CU047YZ77qY77q`27?77q 77q `0^+h `+h h77q_76aG6^ZԊ!J+{ `  4% +4h=h477q_4 744 77q_7@4` K6 77q_U76@r4|`4?4|K5K6!K6K6K6 @O64Z4G6^ 844 44 _m4 +{ `  49 k61Ka?h 4_77q7477q4_7`K6144_4 4`*K61+ 4h=hG6>ւ 84+`~h4` K6Ka?H74P4_4 _wG6%4 # !2+H5;H3; k?k?ok>4@!k>YqK>aʏ (K>#879Y4z!@}4 BB4z 7#X7C @|0K>7>_4za07G>> Bߋ_!J4+H3x ֢ 4 !*#74_%4x4_4zA7 X4Y04x_4כ4?K>YK>@O>ϟK>YˀK>Y#Ka?7H74x_M4ϟK>Y>֢+ 8494x_4ϝ-K>Y+d0K>4:++h?4Z4y+ H74`4x_m4+H<Ї^K>YˀK>Y # !2k?ok? k?k?k?!7D@#4Y4+ xH774y4_]4 4yY4#z@4? 84B42G4g @04+H3 B4#Y-4"74Y4a4^4? "_64g 4y4 4_ 44y44 _44\4 @ 4yY44_4b74y@44_=4ZE4`4?K>K?!K?K?K? @O?4g 4y4 4_44y44 _4>^ 4?  @@>@BX4>w@4^4Y)@a7? E ڃ_7ϟK>ˀK>ϟK>Ka?4:@^E4yϟUK>4g 4y4 4_5444y44 _4 0 @=@B4>4@Ka?H74y4_e4 # !2k?o+H4 k?!4?#7pK?4_4 +H9(`+H:@ K?+d0` p48pk?B@4#K?47_4 ``b"xK?6y_!4 4|K?Y@O?[K?|##K?7^4 4|k?74k?4@X4K?Y@7? # !2Ku0Ks0  k?k?ok.k.k.k.k.k.k.k.k.k.k.k.7#7K7 644&4 !5  444 _5xA|4 \ 2B5z04 C 7c/q4Y a5z04 #B#:7/Y@5z7/qK/Y4Ze5047/q5y4Z-54c7o4@4 _54`4 4 _m4A4:4 5 77 444^55B 84 :A":5@ 5k_5 577Z4c7o445_U5w ":@"2k/YA њ#+H+X4)b4 @4 B5Zb4Z@"8Կ#Rk/Y@f#2Z9@ *K/Y@EZIкK/YK/Y7k/YB:@?@4@=7/q 27/q5y4Z%54@<7/qY 95z<7/q405xY 54 "5A 7?5% :K.4zZU5K.Y=@K}@h 6 Z_@ Կ?K/Y 7k/Y4 6@ I5X]5@K/Y4B5?k/Y K/YBӳ`JwB6?k/YK/YB@ 6?@u<@4Y 4z444x_-4 K.YK.K.K.K.K.K.K.K.K.K.K.K.@O. # !2k?ok? k?7Dk?)"464 _4 (4K?) 845 @#X04+e07Y4%344 _4@k?!: J4^44? K?!49:@?@K?!K?) #x47@_M4 K>K?K? @O?4y "_u4cM9k?74k?4@h4K?Y@7? # !2+H59H39 k?k?o k6k6k6k6k6k6k6k6k6k6k6k6k6k6k6+7 H8k7 +v49 8 +7J6 xh 44y`4 _5XK644 c7q7?q_5Z77qK?q4Z5c?o44y4 _5 !K7 5Z4K6Y4y4[15Z?5J4y4[5Z D4y 077q5Z4B545Y4Z54A+e0_4)3!k7a 4 4 F4 T4 4~4@44Z "6Z4]7Ӓ_6Z _=6Z( <"R  1"r!j -"5A4 ?  4\ +e0@=34\ K7 4T7ZK7Z4K7 44y_4 K6YK6K6K6K6K6K6K6K6K6K6K6K6K6K6K6@O6  } -" e 0"@ M -"4\_ 5%% 0" 2" # !2+H5;H3; k?k?ok?k?7D x44y4 _e4 4w  @ @@744y4 _4At42E4e @4044y4 _4_40ׂ4K?YK?K?@O?k?7"Z 60 #7K?Y@7? # !2+H5=H3= k?k?7+e0"4?;6@6 k?4 _e4K?_]4 #7K?Y@7? # !2+H5<H3< k?+H5=H3= k?+H59H39 k?+H5:H3: k?k?ok>k>k>k>7Ck>78 4p4_4w_4ze*b%2`%*d r%*4K>44 _=4Z=7?A%[9@+&@h<^Y4Ћ%+4 H7k>4_4 Z5K?AZ%44[ e4ezZ4_]K?I%bZ4_5K?I%JZK?IZ }4 x7^9@_774 4@4_7 H@@04@4 H44^797 87 ?K>44`_444 4_4K>k?44_ 4Z4+4 H744 _E4ZK?I+s4"PC 4K?AZ4 @+s4& 7d <+H< ^ @47Z4@7444 _E4^ _74Zm4474_4 +b H6 +sh?+dph p+oh6p4K>YK>K>K>K>@O>ϟK>YˀK>Y4K>44 _ 4^@ :K>_4 +s48   <ˀK>Y+{H3+}ph +s4$P+rh3  4ς]444 _4ˀK>YZ4+ˀUK>YˀEK>Yˀ5K>Y+H7ȎY # !2+H5=AH3=I k?k?ok? k?k?k?!k?) 7C4 k?1404 _E4w` `04K?14P4 _4+s4$P  !P+s4' 4K?1k?9_4 +sH7K?14_e4 +H74&" K?14 _%4 HZ=4[y7?Hȃ\ : 27?[I@Hȃ ?7?K? +h7@4(_u  +ӟh?@7K?14p4 _7+H7@K?14_4 +sh    4h8@4(4PK?1_e4 I@K?14_=4 h^ K?9K?1+sh  ` 4_4 +H!@ 04?4K>K?)K?!K?K?K? @O? # !2k?o k7 k7k7@!7F 444 _4+4 H7k7!4#4_M4 HwK7!4_%4 @4 BA<477a74Z940477a44Z4444 _u4@ jX 4 6?C4^ B4Y 44ˀpK6ˀ`K6ـ:C?4^ B4T0\(4 4T0\4404 _U4A4k7)4P44_7K7) X e4`j7? 4^  4^7 4Tb7  44p4 _U4+H3 +H4  +H78 04&Y Sۈ h8h`H8A4xh|+H88 04&Y ASۈ h8ˀ(h|H8A p4h|+HwH?H8hw+ Xh80@*K4_4(H|K7!4_4 H|K6K7K7K7 @O7 # !2k?ok? k?7%k?)7X x4y4_4+4$п04h704Hh84x k?!4h4h4 h4y_4 HK?!4y_4 HK?!4y@_4 HK?!4yp_]4 HK?!4y_54 _K?)hhhhhK>K?K? @O?+H?8 @4?+H<+h?0+@h< # !2k?7+H9k?7:?h: @zK?+H8#7K?7_e4+H3K?Y6|@7?+H?0K?7h70Y !KU+@4 # !2k?o k6k6k6k6k6k6k6k67#7G44@  #X7G XU4e7 44_44 k644_4 W4K64 4 _4+e048 k64A$4$@7I+4XUk6K674 04_%7I'K64 P4_45 ABK6 k6Y4 pK6_4K674 4_u7`j+4(I07=i0K!' 4ZZ5@h7I04K64 Y4K644 _4 PK6  K64 4 _m5W4 774Y9K6 g6t?   Y 4 p4_M474!44_7 @ g4 `b+4'H06h0J  Z}6h7?H0`z76#X'7\/0'0N09G 'I 05?4  4 X4K6Yq4K644! _U4 K6+ }h%HK6YK6K6K6K6K6K6K6K6@O6 # !2+H5?QH3?Y k?k?ok? k?k?7Xk?17% x44y!P_U4 44y!p4 _-4+H9 4 +H: @!BA4!Jk?X4k?9X4K?1Xi7 Y6 74Y!4K?94^ B?x 4y!Xe4K?1_7?K?X5444y!4 _4H4߁x4߁h444y!4 _e4K?1_]4+H?"F4?`+H7 K?1+d0` p48pk?!A L4+d0` p48 pk?)4A 4 (K?!K?)4y!^ !4 K?)4y"0^ 4  Y 44K>K?K?K? @O? # !2+H59H39 k?k?o k5 k5k5k5!k5)7F7% x44y"p4 _E444y"4 _4+H< 4? +H!  $75^u4$7>^U4 *K5K> K5K>ɂ$j+d0` p48pk594(4A4 K5944y# 4 _4a p5 pk5A4A44 K5A44y#@4 _44X4#44y#`4x _M44A4 k?X4 @6?4^ 875 n  _K5A 47?_I4K5AK?X5 44y#4 _M4_M4G54 |4l4 T  Zk5IKa?h 44[4k5Q4y$44_7K5Q4?_BK5I4[Q474y$044_-7BbK5Q4[76a7476[ 4aK5Q4[i76_7h4y$PB:+H&b"+H(" "hK59K5A4y$^4 4444y"4x _44Ka?H74y"4_4P4A@4<5@44y#4_E4 44?4y$P4x k514 _4Ka?H7K514y$_4 4?K5Q@ Z9K5Q@ Z!4=@Ka?H? Z b04?4K4K5)K5!K5K5K5 @O544K5A4y$^a4 u4 # !2k?ok>7C#X+e07Y%0k>44$ @4 _4x #7%@4K>YK>@O>H?7>4z ^^e@`B"6%@@w?+"xU6d%@#8G>79%`XM4K>44 _u44 # !2k?ok>k> X+e07E4Y%pk>4# 44 _4!4d44|K>YK>K>@O>64 #4X#4#r#4Z64Z4 8#64x##b#4Z64 _$ 4#ڇ#$4ZK>@ `e4|+H?7>4 ^ ^5@@ x4c%@G>Ծ Ԧހ!2 !" F ע߂ Rbw b4 4~ 444 44 44 44Z e44 E44 %44 _ 44Z6g4Z4]44*446_W4Z4E@4*446ǿ44Z6/4Z464@K>4 K>47K>44 _4x]4| # !2k?ok>k>+H7 RX7RU6 $4Ң7C `_ 4  y+d0 e@6+" `he 4?h`(+d0hh4?he0h`8he@h`HhePh`Xhe`h`phexh`h`h`heh`heh`he@=+ +d04:+^7>ыaG>+d0W4%48+_4G>+e04: pk>X4%`X9K>K>h|4hxG>4 4$ _?_+`7@`3x4` z47xhthw4%HxHw_4HxHw4%_4he4&ha4hw+he4h`h`H:hzK>YK>K>@O>+d0@H4:+h| X7 | # !2k?ok? k?k? k>4 7W4&4 _4xK>B ]7>"(7H(4&`4 4x_-44Ј@"4&4 4x_44k?!4&4 _4xH aBA:Ha*4>AH a 4.`H@`4v]@Hp h4k?+e0K?!k?4# k?4'k?7X4zXA4zk?)4'@44x_7K?)4"` +e0` 4|K>K?K?K? @O?44&04_ 4x4| # !2k?ok>k> @7D#7 4K>YK>K>@O>@4 "ؠ6 4? B@t4z 7"6 @}04+H7+e0"` 6'P4_4x+H: X7>^U4z#7 77'`4 4_E7J^}4z"6 6'74 4_7 B#Ka?7'H74x_44"xK?6y'4_m4 _]K?Ȝ4 # !2+H59H39 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>7D7# 4(44_4w`("4"(@4@'@4t'@'4(A44_4w4 ZӺ'4 4(q44_4w44 @j 77? ZZy@' )ZY:'_ 4(44_m4w_m@#878 k?144(_%4c?y7?q4?49_"Z7?q74)47?q_74daRK?14)!5_u4ϟK>Y6c?q7?q Zc?s#gJGBK?A< k?A\]7?AK?AK?174*A_4 'I@ 2K?AK?16w#k?A4*a_u4 I(6~ K?ARN5 '04 z7? !$5.0&0N09G $I   4z7? ("%16.0&0N09G %9I 9 04c?u4 7?c?q51'!X'5N530-5\0N' 1'1 50/RV60N 9!D'D- +s650  Z 4)Ka?c?s 4*Ye7?q4 v4 X4 .4>!2 ʆ RY4(44w_u44?K>YK>K>K>K>K>K>K>K>K>K>K>K>K>@O>4(44w_4ϟUK>Y4)Q44w_4ϟK>Y4)44w_U4ϟK>Y4)44w_4ϟK>Y4)44w_4ϟuK>Y4*44w_4ϟ=K>Yϟ-K>Y # !2+H5;H3; k?k?ok=k=k=k=k=k=k=k=k=7Tk=7+7 y44y*4 _6Ix Iw4y*_4Iy44"4?Ix#"46 4y*_4Ȁ`4IyI `9g4 4n4`9:ZWGZXgR I ӧ"_6i?@5%``2I`"IzW5&??IyIa_'IyIs`G_4k=4y-K=4 _=7K=4 _ӚK=4 K=4y-!4 _5IzK=CU4y-A6?4 _5wK=44y-a_m4K=44y-_E4K=`?`?44y-_4`?ǫ"(?_Iz @@7"x46x 4y*_4 ̟`4#878 4y+4 _E5Ix Iw4y+1_4K=^7>9 :Ka?H7K=4y+a_4̟44+H44  4 IxIw4y+_e4IxIw4y+_=4Ix44y+_4 #8G>I79%`X a7?Q44y,7?Q_4 !+5 H7 k=4y,Q_4 +K=H74y,q_U4 +H< ;WIb+H6K=g>I4y,_4 K=4y.4 _5WG>I4l  K=574y-_4 IK=4y-4 _U57K=4y.4 _-5WK=_7?  :Ka?H7K=4y/q_44K=44y/_4 Ȁx44d0K>yK=4_]44x0144_55K>y H44K=YK=K=K=K=K=K=K=K=K=@O=4 5%`7?QX 5844y,7?Q_e4 K=4y.4 _=5W@ RK=4y.14 _ 57G>I^J ]g>I4G>I4y.QX 17?Q4y.a7?Q4_4K>iK=4y._m4 K>ik?=k? >/4K=4y.4 _4G>I^ Ղ߉ ZK=4y._4 G>Ib aK=g>I4y/_4  :G>IZK=K=4y/Q7_E4 <K=Ȁ4k?7+77H9 7X 4?K?Y@7?+d04:)p#k?X 70A@K?ˀK?Y # !2k?ok? +k?H: k?@!* yK?44y0a_4 K?44y0_]4 +H844y0_-4 +#H77 4y0_4 +H9 h+H7 J+d04$)pK?4y1Xq44ϝK>+H7+d0 04$)pK?4y1!X 4H4K?K?k?+H84y1AX444y1a4 _4@44K>K? @O?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Q7G7#W7+H:7Wm4$H 4`P4H4i ( X@ 4H (hX95"7!H451X44^ 4+dpH5p4(+e04) k?a6?44 ?b8ip+oH=p7h4pC!R+o4+4 @ӟ  K?a ^7I @5:H  H  jWU5:X7 7K?aX54`h m@ ?"Ip6z?ip@`Ip7iypC>ӟ4Xu4^4h5\K>K?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_5\]@]m@ # !2k?ok? k?k?k?!k?)k?1+7F yH74y14_u44y1W44 4 84&@4^0^4@!#7 k?A44X@K?A74y14 _7  Hi ȉH4K?A44y2_M4Ȁhhh4@ `5% R57497"` 4' ?9 @@:@ * "4@ ?4@84@>W4 J+4:0X4+H8044y2A_4 4K>K?1K?)K?!K?K?K? @O? # !2k?ok? k?k?k?!k?)7_k?A7k?I yk?Q4y2q4_m7^=@44y27_54 K?A+h  4%h+e0` _}h#7K?A+e0C44^4& k?14\ 4K?A "48X K?144y2_=4 H84C *786??@h(#7 k?94y2_4 HH+`4'h  H@4d`W7hH ZH@R_7RW6 _h@0H@H@K?94y3_4 H@a@H8H8Wh H0@hH8H h4y3q_M4H0H4y3_%4HK?94y3_4 HHK?IK?QK?1h4h4h@@ "HX 4?4HK?94y3_M4 HK>K?)K?!K?K?K? @O?ϟK>Ka?4:@\4y31ϟK> # !2Ku0QKs0Y k?+H5:H3: k?Ku0Ks0 k?k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;7G7#@&7+H74%&4 44A44x_e5WH "H04A0\hH :H84\C C4 ^h44qH8H(_4H0H44_44444 _e4H `@%44614_%4xH4(4@@746a44x_54644_57H`*  H H  b % 4474_%4xH @4z7 #447A4 _4x4474 _4x_4z%7#XKa?7X H747_M4 K;Y45Q4_4x4?f4H(@ 7d"4?ÿ@PH8Av4  "K<: 2"@?:C]-4z h4464 _%4x4^ 44y_H}K;Y464x_4 MK;Y_5Z#*7_:_AvCK?K? @O?+e04:Pk?!W4y +e04%@W)4z`H4+e04?04^ d  4"_ d +e0470  ( _-@_7ȼ+e0_4:27 `K?!W=4yH8+e04%@W4 W}4M4W4y+e04%@4yW44k?oYk? 7@ϟK>\@ k?#"6;17K?k?^7\ K?Y44K>@O?Y7?| Y7??@K?#\ }7:YA4k?k?ok? Yq7C!7#X7X\k?!#8X}7: H7\=@^7 K@CD0K?CT7Y H7_4^7=7 87? @u B#4^7;ABX4#8"ؠk?6^14wX44K>K? @O? ϟK>4X4k?4Xm4k?!Y97?y 2 *7?yY@ ?7?yK?X4K?!X4K?y +h?@h"@04K>k?o+H< 7C 4 b!6 344T4~44w  28 b5 !"3!S!! 4 b5Ҵ?ҳ44|K?Y@O? B`4|4^ 4z_@b4|W4&k?^Q7K?V4z 4X !K?-4|b4| # !2k?o k6 k6k67D!H4ˀK5H9 ZG6׾ j 84#X7X 4y;4 _54"6 k6!4y;4 _4G6K6!4y<_4 "G6^ ba84K5K6K6K6 @O6@ ˀK5+H7 P76]4 y74y;Q44_7B]4 y74y;q44_7=+Ka?"ؠH76 4y;_M4 ˀK5774]4]"6 4k6!4y;4 _4G6K6!4y<_4 ˀ K5 # !2+H59H39 k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?YV7F y74y<144_ 7c44CW4#74WQ4@4V _4 7 ؠ4 @ 44y@XY44K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?̟4̟u4X4̟U4̟E4̟54Ka? H74 4y<_4 X94̟4+H5QH3>Y k?k?7k?+dp4?7W#9#h?p79=7 _U4 +sH:K?_=4 4?K?Y@7? # !2+H5;H3; k?k?ok? k?7Dk?! 74K>K?K? @O?V4z+sh<`#h#h47=4 _4x+sH"`C 4?:4^C!7?C+s@ ˀK>و ˀK>K?!4zX4V4zK?!+sh<`"yh#h6y=h p4_4@4 r_ %4#747=14 _u7 84% @@ 44_=4y=@Ka? "٠H74 6=Q_4 ˀeK>+s7#h8p47=_4 +s4<`k?7V k?WA7k? 2K?WK?K?YK?@7?#\7=X4K? # !2k?ok?k?_E@"y76y>16x>Q4_7 ȣH4+e0H:` P4$W@W}HhWmHW]HWMH4`4w44BJk_Hzh`_Hzhh_Hz0h_Hz8h_Hz@h4K?YK?K?@O? # !2Ku0Ks0 k?+H5>1H3>9 k?k?ok? k?k?k?!+7E H74#4>q4_4 "6 +H7#+s` 07 k?14>_4 K?144>_4Hz@ h`4>k?94V5h` 4>V4 _4+h<"K?144_44K>K?!K?K?K? @O?ˀK>+H7K?14?_M4 +H4 ˀmK>@K?9 4>@4 2K?144?Q_4ˀK>_K?9+h< hK?144?_e44h+sh4:0W y4ςeK>44?_4ˀ5K>440_4+H94 K&@40K?1@04`4_e4_e@ h7444 _44V4 _@?7K?144_4_@K?144_}4@4K?1k?A404 _=7 K?A :K?144`_4+ˀ%h 4+sh}4:04W4ςK> # !2Ku0Ks0 k?k?ok= k= 7C#7 Ve4z k=!444x_=7@y !+H: #@04\i7 @k=)+H8 44_7K=) K=)c=4_7= 4F4404 _M7=C=`*K=!7=X4y c=4K=)_7=?o4\mK=)444x_4 4K4x ˀK>#47 4yP_4+h +sˀ` 04: W 4Ka?"i]6!~w4I4y@4_ 4+s_E` 04K>K?)K?!K?K?K? @O?]A4}44y4_m4 ]+sH#J4yp7 _%4 H+s!` +4h= +s4:+h X4W4+s` +H: ؠ+4!4&!hh"x+H"!J+H8 4y04x4\94 +s+s490+h +4&+shx4:W 4+sH` n4z[K+H< Z+H! B+H7 H04wKX4y\)4 +s4$0Hx4W 4+e04&%+s4%04y 4V4_4+e04&4y04V4_4+e04&`4yP4V4_E4+s4:+h$ 4W 4+H=p]=ӺςK>_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ? # !2k?ok? k?+H# 7D :#4770_4̿h4 40VI4 yk?94y044_7+`H6h$+}pH: k?14x0k?)4y@k?!4 _4+H? +}p4h7 +`h7+4y`H7 K?!_=4 +H: @4+`H7K?!74y_4 @ZK?9+`H8 x2+~@H7K?!4y_4 4?K?!4y4 _U4K?)+}pK?1h4 +`h54h"4K>K?K? @O?@ @K?@ @+~@H?47h7H8@@ @K?@ @k?7+H3 ` b+H?047`8h80+H786h98H48[QZK?Y4@7?@0@K?@ @ # !2k?7#7]ӷk?70k?4_7+H8K?4 \y`4K?Y@7?+4h7"K?64 _4ϟK?Y@ @K?@ @k?7_ZK?Y@7?+`H76?h?@ # !2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y+H3P7E`#+H4 #+tH55##70k?47p_4+`H# +`4$dPh%+t4% 0+t4&+4'+4(+4)+r4*+}p4++4,+dP4-+4.+4/+404H+6h4c?BH8 h X +H7  j7h+|CH9H6?Th 6h 4 h6H4c?B+@8 <4X!H4c?6yhBrW7 47 4~W!Z+oH"` 24Sh3`(WI?6ziZ vI} I77bPiy 4II7Ui!JI!:J4 X udӶ   j4@4K>W4@ 4 " +q0H=x7h4xH  4h H @RI؃>OIS I4?iH 6?h _I؀`\H4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?\@]IKa?"ٰH7K?6_u4 ϟK> # !2k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H$k?7E 0k?!+H& +H' +tH"K?b$"ٰ60k?46_4+`H# +`h%4$+4%gh +t4< 0+t4!k?+4&+4'+4(+dP4)+r4*+}p4++4,+4-+4.+k? 4/4Y4+@6 <4 H47h4c?C 4= 4~] B+oH4`46h1` B4@= 4!  +q0H"x4Rh2x+H1  ʀ Z Z+H<   r4 ] +4h3\ +4h4^ "+ph +h  QH  4h HP +@?8 :! 07IJ BK?! 2+xH6 P :e7ӑ+tH5K?:H H `Z2I؃;HPI"4Zi:H 6?h `_I؀`YH4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ϟmK>Y\!@ZI=Ka?!H7K?5_4 ϟK>YK?:7ygH ϟK>Y@ @K?@ @k?7+}pH: p *+`H67XK?Y+dpH9p78?`@h8p+oH?p7h7pCK?Y@7?\ @K?Y@ @K?@ @+`H?7h7C4?@+dpH5p` @4+oH4p4 _4?6?":]  _":4@ˀ@ # !2k?ok? y+4x0H7 k?4y_4 +H4 a+H7 K?4y0_U4 +H= 47?`+H9 K? 7 h4?44yP_4 `4K?4yp4 _44K?YK?@O?4h3 `4'++H8 X04+ # !2+H5=H3= k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H?P+`@'4&4$+H0 &+}pH1 &+H% &+~@h _4#+H/k?! 2K?!"6604 _=6H'R+H++dPh +t` p+ %h _@h+dPH-+H'+dPh5h? +H' +H6+t45 0 4+t 4<d   + h7+H( +H8 z+t4?`H47p4+,4 "H)5"?@_h"cp+h H%r+4(BPh +t4,+t4* 0+t4++t4)k?+dp4)k? +dP4*k?+q04+k?+4,+o4-+|4.+4/44?+H7؀ *I_Drh7?i\I:p7Y? ei9p+oH<p7h=pCF"%$h+4h6+H: " " A : 4+K?! "7H" 6Eh|gH^++H= ht H|K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>+dpH.p5?a h-p+oH3p6|h<pBfz+dP +H2 "ٰ Ehw660_54 H|>K>YˆK>Y04@@uK>Y#Y7Y7X04_4ϟ5K>Y[@ܞ@h`4?h H#47070_-4+4(h647`70_4ˀmK>Y:+H"@9+ˀ-h`+H3 eh|_I  ]`K? iIK?Ӳ  4 IBI4AiA49 5 i4+H"+H: F44!Ӹ!H!I 6}i {H!IHi ] iH7@y[e@ܚM@+H4 !ٰ` hw550_}4 H|:K>YˆK>Y+I_H:7@>miR+H6>W4+H? 4K? K? bdӗ 7 "+ h4I `:IH7i iH7Bi 9K?4 T 2I`A :74i`8 4@=@ 4 Irx6UiuxA : }86w +H: ]86w 8@4D47+7+ " Ha2@z+ h7+t48p` 7":_"+H7 hxH|` # !2k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H$ +`k?14@'-4#+~@_uh Hk?90!50544 _4+}pH?  "+}pH' p +dPh +H5+t` p+-h -_@+dPH6ӂ6h3+t4, ɧh`]` 4X +q0H<x7h"x+@? :+H3 87`8I Њ8Š884 9"9B9Z "I6 9j+H3 K?9 dTY4Hq?I+H, +~@ h"+ "YH8 +~@H76Y @_m4+~@H<K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>H4p6?qxh4p+oH2p6Vh6pBM YK?4Y 4 _U5 Q1*4? ho+4h.Ip +H. +H-P +rH6 rK?1 b47+H?Ӆ * 9K?49 4 _=4+H? 4 44441k?!+@?8 +H7P 1 1Hr0I7 64i? |Hq4_1 +|H1Hi ? h3H7@ӱH-p5?@ih"p+oH1p64h4pB-5 4 4_5i+dPH5h`6h.+H=ѧ "54 4_=4+H8!+H9$!+H)4+t Q 41 0+t4/vdT6 ) + I8h?H:K @f7+}pH0 h` ѧ+dPH6+H,+dP6 h0+H:D +H*4+t r 42 0+t40ќdu\  J + jh7+H)+H7 H 54 _445 4_4K?1 +H7 5@4 4_u4+H754 _E4+H754 _4+H? +H2P +rH6 jK?1 Z47+H!Ӈ "544 _]4+!50H7k?4&5 `_4 H b+t`@4?p44""H7?_h` phH&R+4)Vh +t40 0+t41+t4/+dP4*+k?4++k?4,k? +t48k?)+H7؀&+}pH8 4(&bI_E4?hw7?i] 2H|7hnC"Bh`+}pH5 p8+dpHvm7bH7+dPH6ѧh`6h<454_4M+!4550_M4ϟK>Y+H)P >@+H*J>@K?1@>}@K@@+}pH4 9G+t+t5H:+~@h 4 ? Hhi454_M4+4(h145@4_4ˀK>Y+~@h 4?hg454_4ˀMK>Y+~@h 4?he454_U4ˀK>Y[@ɼU5 r+H= +~@ h75P4_4 +~@H<2gK>YˍUK>Y+~@h 4? Hhd454_U4+4(h0454_ 4ˀK>Y9+H! 9++H9 j +40H74 4 _ }4x+dPH74 @4x_ M4 +~@ˀh +H? +~@ h<+ֿH!  5@"K?  +h"+H7K? ! +ISH-6p h66yEiY+H9P!K?1 +H:J +}pH2 4( +tH:+tH:JT@@24? Hhe+4 (h-I  IB4XiXI %ӥ+}pH? 4( RH}4 ?7IrhzChm _E+}pH7 p.+dpHv7@ 4?hnIq <=%[@ɼ Y+H! "ٰK?`g$+~@h76P_ 4 +~@H<-OK>Yˍ=K>Y+IOH95iZ .OIp+H/./Ip+H?ѽ 4K?K? Ҝdҥ  T n h<I? @B+|H9H7i= = h=H7Bi +H?P!b+@?8!J!H+H'  zH jI Ѐ +H8 @ "+@< :4 4D4 "h+tD9Ԁ Z+@6 :4 4$4 "+oH:`7S0h3`4 "+q0H=x7h4x4+H?  zH Z_)4 I Ј 4h4+H7 +I Ѐ +H5 6Gpү bH R_i4 I Ј h4+H9 /+H8  "\ ^ 4 284K?)4 G Z@'?4@+oH7`+@- :+o6h8`4% _+H6 875I +H5 87'@ " "+@0 :4 6D & "+H: "& "+H= ؁& "+@: :  "i 04 44<?<"+H5 K?9 K?9 ?xk?! Xk?!+#K?47 _4+H: +~@ Dh5 I  2 Hw6?hx+~@ H<+H9 K?9 $ wABK?!+t 48ph4`X744"I  Hi5,?hl7H4+~@!yH75y _u4+H8 K?!!ٰ K?5 _-4 +H- K?!+~@ h< +~@H<}`g # !2k?ok? k?+H# + ` yh +h +H4+h +h 4s0k?!+ h3+h p+h 8+H7+h x+h p+h +h 8+$h @+rh +xh P4y `K?!_u4 +H7K?!4y _E4 +H?+`h 4h +q0` +h x+h +h +}ph +}ph p+h$ +h$ +h x+h +h +h +h +h +{` +h +h +h +H"h+h"p+H5H+h5P+h5h+h `+4?h% +4Lh7 +4#h8 +H= P+h= H4%4y H HK?!_4 +H6 ( H HPC@+H7 +K?!h7 4y _}4 +K?!h$ +xh +h$ 44y _%4 F4`7F4K?!74y 4 _7`F@+FH: `h7+h +H5+ (h$+h +4h"X44K>K?K? @O? "+rh +x-h P+H8 +v 49 y +v 46 P+xh$ P v X +rh:+H: 8+DH9 0+4%h< H # !2k?7+h +x#h 47 70_4 K?Y@7? " !k?7k?Z97?+H5Ȃ B+H! *#Y7Y @K?4_m4 +H4Ȃ j+H< R+H7P# 7 p7 @7 4_4 +H3Ȃ` b+H6 J+H?X+t480#9 479 _e4 +H"Ȁ@ B+H? *#7044_78+d`K?h +xAh 8Ap@D7K?Y@7? # !2k?70H+|h H+xh 0+xh +h  +th +H?+rh +rh +oh `+q0h x+4:0 /A+4?h9 #+7 H7 70_4 +K?Yh x+h +h +h +h p+h `+h h+h 0@7? # !2 ! *2k?ok?+H<؈ "+H? a+q0h? +H6Ȉ "U4+!`h<+H5 +40H7 4 P4 _4x+H844 p_4 +H844 _4 +H= +h#+H: @!"+H? rC h+h?+Xh#4?eh3  9_4: ++4 h9+H:+UH9+H8+{h84?h#+4h4 +`h? xK?YK?@O? # !2 " ! " ""k?ok? k?k?+d`h +x_h 8+H= y4d0C`k?!+H8 ( b+H9 P+H?4BC "7h3+4h98+H$44y 4 _4A|4K?!74y 4 _]7@%D„$BC„#B"+H7 K?!4yP_4 +{48k?)44yp_4 ++H7 K?!4yP_}4 +{48k?)44yp_E4 dZ+H6 :+H5 "+H: 8@PW @+xFH:@h4Y7?+H&Ȁ :+H7 "K?44y @_e4 +H%Ȁ%+H?%+H:P$4y p4x +H: X +H= pK+H$ <4+H3؀ 4d +`H4 xJH7 K?!4yP_-4 +{48k?)44yp_4 4e +H7 K?!4yP_4 +{48k?)44yp_}4 4e `+H7 K?!4yP_=4 +{48k?)44yp_4 4e +H7 K?!4yP_4 +{48k?)44yp_4 4e +{]u4: 4e @4e+H7 K?!4yP_4 +{48k?)44yp_4 +H4 D4++H7 K?!4yP_u4 +{48k?)44yp_=4 U4e +H5 R+H6  :+H<H "444_4+H!Ȁ :+H" "444_u4 +xFxH:ˀK>4x 4_-4 +H<Ȁ :+H! "K?!44_7K?)44y_44K>K?K?K? @O? # !2k?o yk?+4x0H7 k?4y_4 +H? +dp47 K?k?!4y_M4 K?! `J+H: +xF`h:K?4y7_4 X@A@k?)T%7K?+H9 K?)C7K>@O? # !2k?7+xH7#k?770_4 K?@ F pK?D4K?Y@7? # !2 " ! " "" /p 2 " !k?ok>k>k>k>k>k>k>k>k>+H)h +H= 4(+{H8+h +~@h= y+4d0h$4&+rh 4'k>+~ph 44y 4 _}4%+{H:+tH9^4+h)+H4 *+4h5+4t@h4I CS U4y`+I U4:I 4CSu 2]m@C 7UiI +H? +H<Xj +H3X@JI 7?!4Z[@I K?!T u4:,B+t4++4 4 4, j @ :I IV4+5JP j +H:! !" j 4y5W_4I 44y_4 +4h7+h7H+4eh%4y4 _e4+H,Ȁ :+H? "44y 4_4ςK>Y ?7++H74)0i$I844y`_4 I?C J+H8**I I C] U II9I 44y_ 4 +H9 ( +H: I 4BC r+H8 H Z7C "7C?+4h884 TMI |` I c[I i:+H7 R+H9  :+H:H "I 44_4I 44y_e4 +H=4* :+H3 "I 44y _4 +H98(+~`4)I 4y@U5:K>U 59+H8+t4%4U59+4:U444yP4 _%58K>H8p+H7X+~`4)I k?[59+H8 H!:k?q!5k?+4h?844yp_]4 K?U4:7 k?q+H8 H44y_4 +H: H7?q_7?K?4y4_5xK?FI U5yU}5z44y4 _M58]]5:74y4 4_ 7[ i5:'4+`h7 4y4 _584yT]5: *+H+ +`H"  )+H7X4y4_558\5:h44y 7_4 +H7X("چ&B2 ˆ&4[5:4h44y@4_]4$IKȀ (r+H9(`44y4 _5804$4[5:IHȀ :+H8 "H44y_4 44y4 _]58H44y_54 `4+H9 R+H:  :+H=H "444_57K>U59+H( +H+X 44y4 _E58]5:g`JI\Ȁ :+H! "44y`4 _58+H"؀'+H84&+t4%4U59H+4gpˀHh'"+"6I +~`k?Q4:U4I I:k?Y7?Y_7?QmI I 44y_4 4h+h"+4hˀPh(I<C8'++~`4)I 4U5:5+4zZ4+4t`h4U 5zˀK>YIB+4z` @h:+H& "44y4_M44h+ˀh?I\+4} @h=+H% "44yP4_ 44 h+ˀh,h+4h7+h7H4y4 _ 54ILȀ "R+H7"@44y4_ 4444y04_ 4 IV+4|` @h<+H+ "44y4_ M44h+Hh7IGȀ!2+H?! 44y4 _ 58444y 4 _ 58 IU+4b@ @h"+H( "44y4 _ -584h+(h?h4y4 _ 444y 4 _ 58H44y@_ }4 H44y`_ U4 +H&X8++`H' 7+H7+H5 J+H6  2+H<H 44_ 4HTK>+44y4_ M4IJȀ :+H+ "44y58_ 4 +4h3+4i ˀh)H94&+t4%5:]M4H+ 4:U4K>44y_-4 44y58_4 +dPh +h +h 8+h P+4?Yh5H+Yh< 7>0&+480/4y4_54 +xH7 86_Mh: 84K>YK>K>K>K>K>K>K>K>K>@O> # !2 " ! /p 2k?o k7 k7+k7)7Xk71 yH7X4y_m4+4x0H7k7!4y_54 +H?+h +44%"h$x+H: +H7K7!4y`_4 +H7K7!4y_u4 +{H844y_E4 +H! 2+{H?+C04h7+H? +H6 +h$ +H" hx@hxHx"4y@K7!_M4 +H5 4!G@K7!74y4 _7a+H7؂!Hx"2+H8؃"@4"r4yK7!4 _e4+{` 4K6K7K7 @O7K7!44y _4 +H?H4F hx 4~ 8hx4y@HxK7!_4 +h +d`H76Ȁh8+d`H56h<+H"Z 4Hx +d`H"4_h?hxHx=HxK7)K71\Y4Hx+H4`֟_h4`K71Jy =@K71K=CW+H98 =w4y=g4y4=O4y4=74y+H8 +H=Ȁ 2+H3 44y_]4 +H9+{[U4:+H84y 7_4e4y+H:@++H48>+H3P%+sH< %4( I4%p4+{4)+4*  IX59U 4% 4E  ?  +75!7Y4UY444y4_4 C5!!+H7`K44y0_]4 +K4H7p4yP_-4 +K4H74yp_4 +H?+H'p+ H(`44+H78K44y_4 H PK44y_]4 +H!8 H P 44K44y4 _5K44y4 _4+{4k?4:75!4[5C5! "+xH8 875!T=4y+{4(44y04 _%575!44yP4 _4H P k7i4 k7yT47k7i H P44yp_}4 H P77i_m77yK7y4y4_558K7yBB5T59U5:44y04 _544yP4 _4G 5!HP +H" D!+H7 "b+H:bJ]i@B2ˀK4Y+h P+H=P8++sH"@8+4(I484+{4)+4*  IX59U14 J4x7+  ?   +ˀK4Y+4h8P4zY 4U95:ˀK4YˀK4Y4yp4_u5+H: 4yT)5ˀ(K4Y+f4'+h P44&4y4 _4HPK44y _4 ] e4+~@H8+ 4H7 +H9 CкF2&z+H5!z+H= b+H3  J+H4H 2+H8 +{474_4+H6 R+H<  :+H!H "4475!_e4+H" r+H$  Z+H%H B+H8؋ +H8 K44_4+{4%44] 77 77S44y@74_=4+H84$ :+H9 "44yP4 _ 4+4:U y4HȀ :+H? "44y`75!_4 HP PHȀ!+H* !K44yp_E4 +x :+H) "K444y_4HȀ j+H( R+H5+v S4? 44y_m4 +H? HȀ +H* 244y4x _4 p+x Z+H' B+v J46 44y_4 +xH( 84 5_mh: 8+dPh +h +h 8+`h*+4?XMh?H+XEh< 740K4'A+A4)0-!4y P_ ]4 +#H7 K47 q_ %4 4K4YK4K4K4K4K4K4K4@O4+H? b+H7  J+H8H 2+H8 +f474_ m4+H9ȃ =+x+H:@=+x+f4484y 0_ 4 }+x # !2 " .k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y"+` z60H7k?4y _4 +`H7K?4y _4 +`H6 +`h +`H<%+oH7PK?4y!_u4 +oH$P`+H4@$+4%+4&+4'+4(+4)+4*+4++4,+4-+4.+}p4/+}p404y!1K?4 _]4H@$H 6wRX7~ h H K?4y!q_4 _@dH#2I#"I! rIw K?4y!_}4 IWPK?4y!_U4 I K?4y"_-4 IBP JI  :I  *J p ]Iz <(I Iz ^ 47I ;"2K?4H K?4y"Q_e4 K?4y"q4 _=67I 4y"4_67H 686WB<4`7H@ H +xh?X@K?74y"4 _u7 `BI 7:Qb|4y!1H@<4y!146<K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?+H! "A:?M6< =H +H8 +xH3!J?6<+xH7K?4y _4 +xH=+H" Ј] ?6< 6<C@K?74y!Q4 _e7 {OH -6</6<+H7+`4h:4y!K?_4 6<+`4K?h74y"!_4 }6<"m6<k?7+7W@ h "60B+ pH9 4B\4+H7`+d`H84?+?h7`7(k"y46w0B4`"+h +h 84K?Y@7? # !2k?7k?+E@H: Ћ`"_mK?K?Y@7?#+7"#H7 70_U4 ϟK?Y # !2k?7C Pk?`b#Y+7X0#:H7 79#1_4 _}K?K?Y@7?+##H7 707#_%4  # !2k?7C `@k?#"706#Qk?4 _7K?@4?K?Y@7?+H9 K?4B 4K?Y+h +h +D4h ˀmK?Y # !2 ! %k?ok? k?k?k?!] "60k?A74#q4 _e7+H7 PK?A4#_54 +H? P@ X7K?A4#4 _4+H? 4c(+}p4a(`8 H= `} +@w gh7+H? 07`g` +H4 #+H3 '+H5 `u J+H6  +H< +H4h0+H' 7@`a S 44?7E4$`r4  7@4@ :47&4"6?4E+H98+4@H40 4B+P?4x H:k?I6@  "   JK?I44$_4 SK?IK?I_7+q0K?IT Y4:4| 7@`9 4#+H: @B 4+H3 +@9 B7@`| 6a@`a +4@: > `b +7Z@@' :`z c`g +H? ȇC#R` #z#r+H? #Z+4Lh3 +0h3 4@`z d"+H6 $Z+PH?  G4@e(`w  +H? @47@e`| +H? +7?Ph6 +49 ' D 4p8/@8'P7?Q1NH= 0N 01! '! 9G!')E4U@)`u 4 4"@a`b 4``s 4`f 4"`f ``f +H:+H=P+4H3p@ 4+H70 ?` _#Z`` +h +h +h 4| K>K?!K?K?K? @O?+H7Ѐ +H? +h? +H7 K?A4_4#+H7 K?A4_4#+H8 7+4`y `` +4h' `` +h +@& 8+h& {`f `` +h 0+h `+h H+-h 4+H& 0 +H7 8@4+H4 ` W +H8 h@4+H? H W +H8 P@4+H5  W:4+H8 +4 h& +4h6 Ў "+H=h @+H3 " +H5h +H7P5@E # !2 " ! ! "2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i+`H# +h P+r` +h 8 ٰ+407E k?q4$!h @4 _4w+H7 HK?q4$A_4 +H? H@ X7K?q4$a4 _E4w444$_4 bj@4?@6? (ӟi +H7 HK?q4%_4 I @K?q4&_4 I K?q5_e4 @4 6?2l`*5 5? _5K?q4&!4 _5J XK?q4&1_4 J X3RH +H6i +4`h? 4&qH K?q_M4 I K?q4&_%4 +I: HB$H9 0+H? Hi< H3+H9 "U4'K?q4 _4w5#v+H?P_ǟ+H?0 : j+H?h  J+H( 2+H( +h'8+h h +H78+K?qh7(4'_4 +H7PK?q4'_u4 +H0P`*+H!P4 /+h8X+H7XK?q4(_4 +H?X SU4+H7X+h7H5xBz5 K?q4M?Ѩ4(!4 _]55 K?q4(A4 _%4K?q4(a4 _4w`4 `҈f`+r 4) 55T-5:+r@? 4(4_m58+r@+ BS5:+h< 4(587_ 4 4@ 7A??+_h?H+H= BW 4+K?qh784(_m4 +H%H*+H4X h'X+h'+H? Ar+H0+r4<x  8 +H3 44)_4 +H5 @At@+H7 +r4% 4)14_544)QSA4 zK?q44)a_4+td'd'd'd'd'd'd'd'd'd'+H'x4? +H( (0kx+H) _M4z+h `4K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?H? 8a+h? H4)BxI: Hi< H+h 4'+4+` Dfa@7?th hab@4 Hau D4+H. + H* _@8+ h? `4+h? +H? 4&+H9 0+4( (h? +H8 8+!h8 Hd~O+@7?~?++H7 8+!%h7 Ha` DH  R`H4 +b4- 5AAz DH  "_5j` @ 4+``? @4>` 4 `+ @`` F@ 4 @` 4~@"4?` 4_H4F+`? 7+4 h- +h-@6?~w4Wx` 4~`48`24X@"j +h8 @j +h +h @4-+h X40+h ( i toE4 @K?q5?4%a4 _ 5+H: 8 N 4 +H= 0 4+H7 h+h? ( ? 4 +H3 ` 4+H7 Pj X _ 4 +H4 H 4+H8 i @  4 +H5  4I +K?q4%h? 4 _ E5+H7 K?q4%_ 4 +H7 K?q4%_ 4 I D+++H=  `+i +H4 +i +H5 Ђ+i  ui 5#lH 5 56?  B7A?b9  : K?q4&Q4 _5+H= ؀ "5 Nh5O0h "a6@ h @h H kH 4 mh 4Sh  4&qlA*5 K?q6?I4&4 _57+@+h+ h) 4?+H7 K hk K `k K @*+H* i @_` 7h: 4&K?q4 _57 ++K?qh' 4&4 _}5K?qi @+H7 4'!_E4  ]++H8AI I j?4'H +H"i + h? 4Sh 4'AI K?q_4  4'5 +5?WK?qh7P4'_%4  + # !2 " !+H5?H3? k? " "" " (k?o k6k6k6k6k6k6k6k6k6k6k6k6k6k6k6!9+q0580 zk74$H7 4y)_4 +xH7 8K74y)_4 +H7K74y)_U4 k7+H"c7a+4?44P h' +H.8 b+H? +H(h+h(P+H7hK74y*_4 +H78K74y*A_U4 +H-8 'B+xH1 8 &k7+{` + h 8IR @77a54TQ6:44y,A4 _686F\6: *I0`4y,aR6:#44y,q4 _%68Y6:L*I i  4i I0 I ֟_i 6:ZI K774y,4 _u7*ʈ"I5 IV @h4?0k7+H4k?+H=k?+H7(K7)k?+t49pk?+t48@k?q4+tk?y77aT47.4?H a+H9  R544Y 69f44y+68_4 +H7 K74y+1_4 +H< 7?k71`h" +H8 )2+H: X'+H? `'K '54T4+H? `K%+h7hz4?h H _(56:Z @A \ 6:?6:4y,468_=4A(*K7h 4y,4 _5]H k7+{` K7K6YK6K6K6K6K6K6K6K6K6K6K6K6K6K6K6@O6+h0 +H3k?+H8k?+H?(K7)k?+t49pk?+t48@k?q4+tk?y77aT47*H !R+H9 @ek7+H9+{S4:4%k7H ?}@+{4:SI4y*ah +H*+h +h 4k7+h* +`H2 x+{JYS4:+h 45k7+H/ +H?Ȁ :+H7 (K744y*_4K744y*_m44?k7+t4++t4,+x04'+{4(+4)+4*k7!+4+k7)+4,+4-+4y-4?4.4k7X%4+H8 44y*_=4 +4T4: =k7K7+h7+K4y+h1P+KH7 +h5 `4_44IW @K74y,_e4 I=i` 85_IR @5R6Z57IR @IW @UIR @77a 4T i6:6:6Y_44y,!468_4io 8X)4z+Q4?k7H ^4+H6 >4+`H" x54Fh& x4HYT ik7 +H7 K7 4y+_44Z6:44y,68_e4 C7a4?mk7K7K714y,_4 +{-` 77a69T i4C7a4K7!4 :[ 77aC7 77aT 4YI77a7k7!I7 I] @\I=44y-14 _77a+H"Ȁ :+H5 "44x-a4_77a+H1 R+H6  :+H<H "44 4_77a+H!Ȁ 3H +H43H K7k?+H:+H8 +H7Pk?_77a-H vGK7!3H +d`H2+H6+d`6_ Hh?+H1 *#Y7Y 477a_ 4 +H2 R+H?  :+H7H "477a4 _ 4+H!Ȁ 1H +H"@1H +H:+H8 +H7PK7k?77a_ Ek?mH +{4:77aT144k7+{4:77aT44}k7k?7+H9@k?+f4:+h +4Sqh7K?+`h8+}p4h? +h P+`]Eh?K?Y@7?+H?  +t47@ +t48@ @ @K?@ @k?ok? k?+H?8H:04#`BH|@"7hy@4?6 +f4=  7hhs8+f 4$ 4-S 4R u4+H?  :+H7  " S i4.R 4+ H: _k?!K?!4.A4.S 78h`8+_H:+f"ڰ4$ 6.6/7S 4h`8+_=H:+f"4$ 6/a6/7S 94hh`8+_H:+f"4$ 6/607S 4h`8+_mH:X+f"z4$ 6y0q6w07S i4h`8+_H:P+f#4$ 707117S 40h`8+_H:H+f#Z4$ 7Y1q7W17S4h`8+_5H:0+f#4$ 717217S14`h`8+_H:`+f"4$ 62q627S4h`8R u4Ha8h|04" hb8K>K?K? @O?+_ H:+f#4$ 7373A7S 4=h`8+_H:+f 4$ 43437S4h`8+_=H:+f Z4$ 4Y4!4W4a7S94mh`8+_H:@+f"ڰ4$ 64647S4h`8+_mH:8+f"4$ 65A657Si4h`8+_H:+f"4$ 65667S45h`8+_H:+f"z4$ 6y6Q6w67S4h`8+_5H:+f#4$ 76777S14eh`8+_H:+f#Z4$ 7Y7a7W77S4h`8+_eH:+f#4$ 777817Sa4h`8+_H:(+H? +f"74$  6862@68S4h`8+_mH:+f"4$ 69!69a7Si4h`8ϟK>k?7+h +f4:+4h7+`"h7S69+H8@+H7h+f4: #k?S79R5K?+H8 +h<0 BK?" S!6:RK?+h<0+h 8+tH?+h @+}p4h9 p+h P+`]uh?K?Y@7?@ @K?@ @k?77?X 4`K?K?Y@7?X4ϟK?Yk?77YSa77+f4: +REh 8+h<0Yq77 4K7Y@7777X4 ˀK7Y+h +f4:+4#:h?Sq79:a+`4h8+}ph8 p+tH7+h P+`]=h7K7Y@0@K?@ @ # !2k?o k6k6k6k6k6k6k6k6+H"#+f70k64 4# + H78K64:q_%4 +H70K64:_4 +H'844: _4 +H?8H*04$bH(cz+`4'+4(!:7?h(Y76C6"H؊ I5::4S76759;764_7@"H(_W7?+`476XU4!75;144_=7+H)`Z47@0K645;Q4_7A_"z5 ;qZ 4745;4 _7 "H 7h h8+f`  h0 H0K64:_ 4 H8H0erx4|  7K6#h847:_4w 4|_h(74|K6YK6K6K6K6K6K6K6K6@O676=w76+`H5>h8H(>oh8H K6р H H +H8#"7<7=!c>4ZAV5Yc>7?AWc>A]c>c>ATc>AS c>c>A\ c?AW7>Rec?HH6h  h+H7h +{ 4% 5;4_4 @ Bk?5;k?5<4zR5x8h8k?5q_4 H(Bap4|44=4 _}7/q+H7+fk?4: k/)4=R]77K/)Rh8Mh0[7/q>gHxK/17/qC?`0^4>!` ^4>1R@44>A4 _u7/qHx4k K ׿_k +h +h%R7/q4+f@(4:4>R7/qheR4>he+}ph% p+tH3]yhsK/!74>4_=74|K.K/K/K/ @O/@ @K?@ @k?ok= k=k=+H?84#H!0abH(b7?7=ah|(Y 4C=a!rXm47R4  :@4^ "4? @?4?@0^4AX4 +H=+f#4& k?4$7>7?4R ]4ph`8+f4$ 7h8K6x?14R E4Xh`8+H7+f"z4& 4$6y?A4R 4h`8R 48h|0+f!4$4 Hwk=!+H?# 7?q 94:0@7=AHuk? k?#70@7=AK=!k?7R k?Hv(K=!h`86?R iht(h|0` h`8h`0H8Hu0@"4 _ 7%hf8ϟKg+fˀEK?Y#K?47_4+4h  # !2k?ok?k?k?7E 9474?ҕ T `"#7@7444_M7444 _%4x4>4? Y4]@ T4zg+h< PςK?YT4z+h< 0ςK?YT4z+h< +h< ςHK?YTY4z+h< +h< ςK?YT4z+h< +h< ςK?YT4z+h< +h< ςK?YT4z+h< +h< ςHK?YTY4z+h< +h< ςK?YT4z+h< +h< ςK?YT4z+h< x+h< ςK?YT4z+h< 0ςXK?YTi4z+h<P+h<H+4?ςh&T4z+h6p+h6h+4?ςh%+H:  "+H=  ˀpK?YT4z+H? +H3H: +H3H@  ˀK?Y +4h"0h +h<XςK?YT4z+h<ςhK?YTy4z+h<0ς8K?YTI4z+h<(ςK?YT4z+h< ςK?YT4z+h<ςK?YT4z+h<ςxK?YT4z`2`*+h< +4?ς h$ @x4 2+4h" +4?ςh# ˀK?YS4z+ ah< 4w+4?`h< +h7 +K 4H9 Pk +H8+@HH: +h< ςK?YS4z@H74Έ@2+@DH9 0+h< @ςK?YˀxK?YS4z@*4@+h< ς0K?Yˀ K?YˀK?Y+H<4`P4%+v4&L0Qe4y H4d_L0# ڰ704P4 _]4H ˀ@K?Y+v C4: V+ h?+xXh P+ H?+v 9 45  +xh6 PςK?YS4z "44@@*ˀ@K?Y@4@+H: +H8+h< +4h= H@7+h< ςK?YS4z :"W449+ ٰh7840_E4 ς8K?YSM4z+h<Pׂ4K?YK?K?K?@O? # !2k?o+H?k?I7C!k?Q Y4X0#:k?A794 _u4w#K?AK?I7_E4 :K?AK?Q49_4 K?I7?1K?Q4} '' 8G'F`K?I7?1 y'4sP.`0K?Q 0n'01N 1! 'J7?"6 K?A4 _4wK>4|@O? # !2k?o+H78#+70 zk?4y@h _4 +H78K?4yp_]4 +r@? !48 k?44y_4 +H9 Q-K? +4xh= K?Q4yЈ +48h: K?Q4y +4h9 +H7 K?4y_%4 +H3  +K?h p44y _4 +H48 +H58 B+4K?h7P+h7h4yP_]4 K?Y@O?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?+H? \!+H7  *+H8 +x@9 l +H: +H=  4 Ӝ4ނ J4ڂ *4ʋ R+t4! p@ < @ן+t4? p 4 @+H? H +xh X X+q0 h  9 +}p h7 h+xh7+oh7X+{47+q0484?4?B_+h?X@ # !2k?ok? k?k?k?!+H5 H+7$4#!h5X+H% (!+H7 HR+{48  @4? 4?4~ 4~+q044A  A 40 _44 4_4aj4萀P4~+q0 4:@D @ 40 44 4_4OˀK>ϟK> z4e04y@4 _44yp44_e4 ϟ`K>#Z7Y7X04_%4ϟ K> X  ؄` 4 Y 9  +xH9 X47+}ph? h75 j X+xh8J X4<@PK?!K?K?K? @O? # !2 " "" " .k?/,/-o`k>k>k>k>k>k>k>k>k>k>k>k?k? k?k?+@/ z4x0k?Q44y`_5+H7K?Q4y_4 +H7 K?Q4_4y+H7`K?Q4y_e4 +H7K?Q4y_54 +dp4%+x4&+4'+4(+4)+4*k?Y+4++#7. . 44,4 (4H844y_E541qrC@H@ B4  *I p4z 076Ai p442r4,+xH0I I p4/  +6I9`RX7~H4Xi p7:i:` 6h<X4y K?Q4 _6I424y K?Q4 _6W @bK?Q4y 4 _e6W qZ I_ J01*6\RA4!~ <P?74y HII _ IW @2 r  Jt02Z7XRY79~  8? U@m+@/-+H3%I @+xH7K?Q 4y0_4 +xH0K?Q 4yP_}4 @J+ H/ +x KX(H7-A@7 P7K?Q4y5_4 A@7?7+H9 ;W44; +{H84y4_M4N4U@+H4 6`A@7K?Q44y _4+{H84y4_4 P4K?Q44y0_e5AT@7?74//ʍo0C@H@ B4  *I p4z 07A xi p4404(:I pI5`+xH:63i p6AXi5`{@A 4z044/+xH5I ,K?Q4y _4 I K?Q 4y 4 _6m +xI H9BI K?Q74y 4 _=7 2H@ A I BtI @ BTI H@,+d`H? +xyH:@@zM@A 84z p4H@ +H6 46 rK?Q4y _4 +H7 K?Q4_4y `+xH?+q0h? 4K?Y.I b@2+xH74?+{48  +bH@ +H" 4R+A ,@Ȝ]+{+H? 42 R&@+H8xIw 7?r 7?A4y@'K?Q4 00N8D'D _Uiw Iq +H7 7@"K?Qiw 4y_ 4 +H7 ( 2+H8 H +H:_J BJ BJ J I2K?Q4y_e4 45I3`H@6yi9`3J K?Q4y_4 J @IS  b K 4v ZK4(6Ӓir @`(ix Iw K?Q4y_M4 BJ 3"K?Q44y0_ 4J @2 IP4@  J 2j@Ib9+q0+H"X+H0 +xH74/+4TK?Qh4X+6h? 4y _ 4 IK?Q4y _4 U5@T@e@It]@IK?Q4y 0_u4 A 4z p4)"I"`+H0 +xH7K?Q4/4Ri2`+6h5 4y`_ 4 IK?Q4y_ 4 @IhI S5@IB Q K 42@K4(72ir @`(iz Iw K?Q4y _ 4 0+H7 4w 40r@47K?Q44y_ U4@4+` +ȏh `+q0K?Qh7 4y_ 4 B@+H0+{ KZQ1h:+H*+`h<  HD +4h.A4z04+H4 j+H5  R+H6H : 4wP@4w44_ 4R44K?Q44y_ e4 B4@4z ++H7K?Q4y _ 4 +K?Q4y 4 _ 6W@6Z"m@/]@IK?Q4y @_ u4 @dIo@@4z p 4R 44+H1 ( 2+H2 H +H:_6+q0H7 K?Q4y p_4 8+I K?Q4y _]4 @ 4z ` 4@4z 4@ @ 6RI5)~    (k4y K?Q4?_4 84_4o5@m4+4 h-@4z0 4+H7 j+H8  R+H9H : 4wP@4wp44_4␀'R @ p4@$4z+H7 K?Q4y_54 +xH7K?Q4y_4 +H7 K?Q4y_4 Bt4 h++H7K?Q4y_4 (++H7 K?Q4y_E4 @4z0 4+q040+xJ H9I B 4/J K?Q74y`_4 IK?Q4y_4 K?Q4y4 _e6742k?Y%+H9 J +{44 J K?Q `i `74y4 _67?Q+ IT < 4 J K?Q44y_U6W41?++Iw H8x@*+K?Qh7x4y0_4 +H= IUK?Q 5 Jw04yP_4 ITK?Q 4 K4yp_e4 +H7 K?Q4y_54 IS 3 K0 K+H1x6?`b+H7 +`h?x+h7x+H7xK?Q4y_4 +H? RI K?Q4y_E4 +H7pK?Q4y_4 +H:@-++H2p+H5 m++H= m+I1` -+Iq K?Q!iw 4y _U4  Iq I 07?A7 &01n0N1 9$G&J @-wIq MgIq +H7 +H8x6?m/Iq I mIq 7?Ab4y`&`K?Q4 00N8D&hDh  _iw  Iq 7RE4~+{4' K?QԠ `i4y_a4 +" I D`I!`J 4<K?Qi<`4y_4 B\J @ Ic@@|4z0X4J K?Q4yP_4 BJ '@4z4@ L@b@@4z04+H6 J 6RR6R~@ V I "@XK?Q4yP_4 @Ib5@@$4z044y_94 J /_7?4~j 4k?Y A@+q0H7 K?Q4y_4 @l4zH4J I!=@K?Q44y@_Q4+H= J+H3@ 2K?Q44y_4U@4 :+H?+H/`04 _h?`+xH7K?Q4y0_i4 +q0H7 K?Q4y_94 K?Q44y_4+h$ 4K>YK?K?K? K?K>K>K>K>K>K>K>K>K>K>K>O>/0-@/0, # !2k?o7"7Ck?!Z#7k?70k?7_4 "K?K?6 _U4 @xK?!2K?!ja"@y@@w 8A B C4 8    +t4= p 4 0      * <     Z4?K>@O?ϟK>ˀK>444 # !2k?ok? k? +7C7%40H7@k?q4@_4 +H?@ `x4|K?q4p4 _54wK?q44 _ 4#+H7 K?q4_4 +H7 K?q4_4 T @+bh< +H! "r7?Q#:'D7",@80N0'bk?y7?Q#Z&D7\/8G&F8+H? 0N8D&D+H8  h7K?q zk?7?!$($44 7_ 7K?7?!$($@4#:074. 7?Q1(n4'.K?y04 0N 1A'F80N0 ' K?q`4 h7_4w4|K>K?K? @O? # !2 " ""k?/,ok?k?!k?)k?1k?9k?Ak?Ik?Qk?Y0H +H<+H6 6 (4 7#7  D ڰ404@4 4_4w4 R+H7 4P4_64p458_5744 4_]5W444 _55w+H6 +H3 4"LP4 +H"+dp4?04 6y?  ڰ40k?44 _m4K?44 _E4@:+H?@ "K?44 _4w@j+ H? ІH" i(H? kF +@5 z+h 4x@ Д 4& +H! k?44 &P* 7?7"ڰ'!'!D60/@8'P4@1N0N 041!'))8G'1G5@1@@  @@ W 6w@   4 ]: :   ҹ7:@  @ ӗ:  6B 35Ӝ 7B6+@= @  =+H74) x5 +H<  +H!" *+H" *+H+ +@7 @% EI8&b+H? &+H: @(b+H9  (h4CI?! 40H 44 _5844 58_5iz+H H5p hh?p+H< rU ]@"0.6-7?4 0N580&4 _+H?+H" +xH< 0+4BH h" +tH44" hH+x K?h3 0+ @h" B@@#:79@44_4w+H7 R+H?H4 4(j4 4(J4H 5K>K?YK?QK?IK?AK?9K?1K?)K?!K?O?@/0,+H+ H e4%U @`ERP4?6D  2 2  5 "3_?"@   +H7 +:w † J:+ @0   7@5u @ ӟ:  7@ :5Ә 7@6 @ ׾ ]x7@   ]56 ӕ:6@vӓ 6u@7]+x@9 l +H?+H? E "9 E  E B ` E 4 B} +H3`9+44y4A(5M+4!j4ރ 4ڃ? z4ʋ_9+5A?% ++t47 pC ?C+5B?E 帗+C՟?C]+5H?  ?++t47 p4C 8?C+5K? e +C?C+U@+I7:++bT4: ]@4~+q048  0 U5@+q044 @0h +H6  I, *+H* U@0H I+ :"K?46`_E60=I?H T4I?+H?85x5+H:  :+H=H "444 _4+4Qh7+H: 4pQe457H +H8 7H 7H K?4x4_ 4MH # !2k?7 @4B7? 4 ]: 7#7k?70_e4 K?YK?@7? # !2k?7 @4B7? #7k?70_4 K?YK?@7? # !2k?7 @4+t4? 0+t474B<}  x4dv  U? }w"k?660_4 K?YK?@7? # !2k?o z+4x0H7 k?4y_4 +xH7K?4y_u4 +H8 4y7RW6~ K?k?_4 +H:@ +H8 +xH9BK?K?k?!4y4 _7K?! RAK?`H7K?+h9 4K>@O?ϝK>K?4y0_4 ϟK>k?7+x#H:@870K?Y@7? # !2k?o+xH7+xk?45 #70k?!7`k?_}4 A@O? # !2k?ok? k?7Ck?)78 44_4w+x47 40k?14k?!_M4 A4zA 4z`(7K?!4 4 _4wPK?)K?)74_4y`+xH7K?!4P_4 K?!4p4 _]4w+xH? rK?1@ ADK?1@ A4+xH36yRZ7Z~@ Yh84K>K?K? @O?k?7#_}70K?Y@7? # !2k?o@ 7C"60#474 _4x+xH:_4yK?Y@O? # !2k?ok?@`7C4~`"z6x0k?6y4 _4w+dp4$ @A4z` +H7  K?0+7k:0H4 @ϟ@K?Y#7704w_4 4K?YK?@O? :K?494w_U4 ˀK?YK?44y_4uK?Y # !2 " ""k?/,ok?k?!k?)k?10H z7D4x0k?I4y4 _e4+xH9+H8 Ad47 4?+dp45 `K?I4y4 _4+ H5  Jw0+6jf0H6 c"+H9`+H8+ 8F4?h&`?@+H<"R"J!+H7 4~A+q0@'!+H% +H& +4h? +q04'+h? P4447_4@44x 4A4F+h& +h% +H: x+H%+7G `h' x+H9  B+H:H *+H8 4w@4_M4J4K>K?1K?)K?!K?O?@/0,K?I44_Y4K>+K?I4y`4 _4K?I4y4_]4 ˀ%K>+H84y K0K?I_ 4 A@+H?4@ Ja " +H6 _4+H$ x+H6+4 `h' x+H?  B+H7H *+H8 4w4_4J+H3 J0ˀK>+H: U1@0H +H= H`*U@+q043 d +H8 KT K+H9 pk?QU ڰ4@0..7?aK?I0N4y 0'4 _K?IK?Q4yP_m4 +H4 x+H8+6 `h" x+H!  B+H"H *+H8 4w4_4J+H74 KKAx4+H= 5J0 # !2 " ! " ""k?/,/-/.ok?9k?Ak?Ik?Qk?Yk?ak?ik?q+h @+7G z4h$44y4 _ 4+H?Ȁ :+H7 "44y4 _4+H(4% R+H) :+H*H "444_]4Y=4+H9 +~@H8+H7 _4+H: 74Q4+H<h$+k?Cth$+C H:+H?@K?+ 0h4+H= 8+h=X+h= H+H5"+H7 +H6؂"+H7 @"4x00H k?4y_u4 H R+H"  :+H'H "44w4 _-4A+4&+#4'7 `-q +4(4 4 1HU @1 0H 0$ 21.5X4 H00'&H Hb` iXh HU4d@h@ 7j rH RH  B+H:H *+q0H8 K?y_4^1HH@ R+H= :+H3H` "44w 4 _%4+H?4 `+H9` ?Th4`+K?h xK>K?qK?iK?aK?YK?QK?IK?AK?9O?1/0./0-@/0,k?7k?Y7:`4?K?Y@7?+H9 +~@K?H8+H7 _K?Y # !2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i+H-4'+H( 4$+H+ 4*+4 4444#$`h !:P459P4_6H I_ 0  h 5iX  QIH$I ! H!rP 4!X7hP 4 $zIP E59P9II597_4 4I59C_]зYI75945_7~7H "I4590_4 5H I`4 ?'4 h 5iK 44_e4 +40H74 4 _-5+H66`h<_@b+H7 4 p4 _5+H9 H 4_ 474 4 5_]7b* 44 54 _44K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? Z4A@ha44Y4X0_U4̟54459580_4HiK  Hh H@ QA@HQ)4?4h5&̟}hfI5QhHQ55'p̟%hg4 0̟ hh4 he # !2k?ok? k?k?k?! z7+7E7&4x0H70k?I4y!_m4 K?I4y!04 _E4K?I4y!P4 _4K?I4y!p4 _4+H7 K?I4y!_4 +H7 K?I4y!_4 +H844y!_e4 +H=+h 4$+h  K?I+h3+H:C\ : Y e@FJ4|hϟHK>4z!h4K?I4y" _u44?K>K?!K?K?K? @O?+H9 4?AXc?P4 H74}"PK?Ih44y"_4ϟEK>+H8 4y"P97?O7?7@c?P-77 H 4s"K?Ih44y#_4ϟK>PU7? +H"@0h%+H: _AjPm4 H74t#@K?Ih44y#_E4ϟK>+H8 4y#P7?O}7?7@c?P77 H 4u#K?Ih44y#_4ϟK>P7? +H' h&@ 4+OH:+H& 74?@4aϟmhP4 H74v$K?Ih44y$@_}4ϟ K>P94 H 4|$pK?Ih44y$_4ϟK>44@77?Q"''D6`1, 8$04,0NX0N 1 7Z1!'9DG'F4v@V"6t@T"4@]"+PIH9 +H5 h&@ _ K>+ XH?0+H9 +~@H8 4+_H7  @+H9 +~@H8+H7 _14JH9 +~@ 4H8+H7 _Z@"4v hK>ˀK> # !2k?ok? k?Ct #7$k?!47$_4 +H?4@  J+@? > 2#;78%K?!47_ 4 +@: xz j+t4? #+7%! Zh?4X04w_4 4+@3 >+H?s 4$ "4%A604 _4wH+t49 6k?) ?4X@h :449$4%_4 h44|K>K?K? @O??4+t744 4`huK?)"h@K?)74%a4_7 h` 4|`04?K?)4%4_U4w4| {h44$4x%_4 m4 # !2k?7+H=  _ +H4 H3h3H7B? 6h5B H?#[7Y%#h?470_4ό@K?Yˀ0K?Yˀ K?YH6h64K?Y@7? # !2k?7+H3 *+H4Ȉ +x@5!"+H6"Z_-k? z"z#;46x079&_-4+r#H:P97&1+48h= _K?"A+H?+4h7؇!* ҇  J!*++r"H:Pa6&q`++rH: ;P)49&(++r [H:4Y'1P@++r#H:P7'++r#H:Py7'x++r#H:PA7(A@++rH:+#;h P79(Q+4h: K?Y@7?k?ok? k?7C@ 7DO4z` 7+@= x % :4@4?T  %4 4 r7|@r׀4K>K?K? @O?ˀK>ˀK>ˀK>ˀK>7?D Ck?!78?k?)4zk?1_I7?K?1< ˀ%K>K?!K?)04 w # !2 " . " ""k?/,ok>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>yk>0H "+ {60k>4y(H7 _4 _@Bz (4 ,R+H6 ,:+H<H,"+H8 K>4_4 4*+H9 **H K>9_-4 X5<`04  7?16--"   7?1 1@+H9 (1jK>44y,_M448 ĕZ212A444x.4@4?+H' Z+H+ B+H7H *+H8 4w/4_4J4 A@@7?5<+ H= 4'+xh:4(@4?H7+H" Xk>+{h7+`h? 4++q04% h? +H? P+@? >+t4* 44y(4 _5X+t@8 #rALI H4 5W7 7 "5).? +@9 xI^ E58+H7 K>74_4y(K>44y)_5W_@:+H9 Y "+h* +4 h- x+t` I+rH04  h5+xH"4I h7+H4 +h) +6h4 C5?'b7?  7 7   7  l  : 4  4 6Һ:7=? I Ӷӝ&A444x*4@4?+H* Z+H?  B+H5H *+H8 4w*4_4J4 +H* +H7 HK>4y)1_-4 +H7XK>4y)Q_4 +H7@K>4y)q_4 Tm@0H +H, H B+H7X *K>4y)_e4 +h X+H= XHIk?+H8X+ @! xIk?7?T57+H7 7 R4 B+H?@ * +4h7 x+h? +H- K>4y)4 _%57T7>"z0.6z/QK>4y)0N4 0%A_ A {IK>4y*!4 _}57@L4?aJ= +4h?+H7K>4y*Q_4 +K>H7(4y*q_4 +H! +H6(04 ?5<K=K>K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>O>@/0,+H5 +H? j+H: @3@+H=H3@+xH8K>4_444x*4@X4?+H< h S4"m4 6? 6?5,? њ+ Z S4,6-?I ѡ W0  ͦ it `K>4y+_]4 @,444x+A4@04?+H) Z+H1  B+H4H *+H8 4w+a4_4J4 +H= 4 5?io 4,4 +H/4P?h  87Is 4  7@K>H @ 4~@K>4y+_4 @t4+H3 "H 44x+@`4+H( Z+H0  B+H3H *+H8 4w+4_4J%4 I+ H0 50 "+H. z48 jK>574_M4y,!@4H 44x,A@ 4F]4 49 4:!bIu I 4 7?iy +H54, BK>4y,a_ u4 K>4y,4 _ M5I H+{ h= Ib J8 n@K>4y,5w_ 4 @4H 44x,@ 44 47 J I| I 6?]7?  mis I מ]+Ȏ@C?1I K 5?7^5Y|(bI I44y-5_ e4 K>4y-14 _ =5wI 5Y^ 5zK>4y-Q7_ 4 @444x-q4@ 4?+H& Z+H/  B+H=H *+H8 4w-4_ e4J4 C?1C?3I7\?5?ӎv6 K^ M&4= zI5p v  / PI  I ^]5z&"I6 ? b  I I44y-7_ 4 K>4y-4 _5I K^m4K>4y-7_4 @d444x-4@h4?+H% Z+H.  B+H:H *+H8 4w-4_4J-4 C?1C?3C?56?5?I7:?֘< O VӍ7 K^ Q<$ 41 I5x q 7 I K  I b I^4:#zI5k? a I I44y-6_]4 K>4y.4 _55I K^e4K>4y.17_4 @444x.Q4@4?+H$ Z+H- B+H9H *+H8 4w.q4_]4J4 C?1C?35?ҝ6v?I7?֐5?6 K^ m4N!r4) zI5o t - OI  I^ =7!I5? 4y.K>5_4 @ 444x.4@4?+H" Z+H, B+H8H *+H8 4w-4_m4J4 K>H 4y/!_4 H +x4(  _ +H1 xK>6"h" x4y/Q_4 H 44x/q@4@ T5ZH J06j0+H5 H`2T @H +{4. +{H H   i(H i HH" +H7-5<+H?H4 4"@49 +H! ȋ!"@U5<k?ok? k?+k?I6H9k?A "pk?QK?I@a T 7?a7?A :'E4$,8$K?A0N K?I04/9G'D4 O k?O y474U}4 @+Ph T 7?A Z&E4E,8$K?A0N7?a4/0Ҹ9G&D4O | O iK?Q7K?Q4xUe4 @+8h 4/4 U%4` +h K>K?K? @O? # !2 " !k?/,ok?k?! Z+ {4X0H7Pk?Y4y/_u4 +xH7 8K?Y4y0_E4 +xH? 8$J+4$,7?QK?Y0'!+H?P!+h?(4y0!_4 ,+4$ ,@146&T 97?+H7Ȃ :+H:@ "K?Y44_7+H?ȃ :+H9 "K?44y0a_4 +xH? 8eA+H4Ȁ J+H5 2+d`H=K?Y4y0 _54 +H%Ȁ B+H8 *+rH7K?Y4y0_4 +H3Ȁ B+H5 *+rH7K?Y4y1_u4 +H=Ȁ B+H4 *+tH7K?Y4y1Q_4 +d`H7+xH8 8+ "H?Ȁ j+H= R+4!,!7?QK?Y0$14y1 1_]4 +H8Ȁ"Z+H:"B+H7pK?Y4y1_4 +Ti@+Tah<(+4$ , 4,,7?QK?Y0 4y0A0$ ,,0'II_4 +r46&,,00n 1 0$ E+Eh3h Z+H< B,7?QK?Y0$Y4y1 Y_U4 +H7Ȁ R+H9 :7?Q1K?Y$4y1 _4 +H3Ȃ` :+H4 "K?Y44_7K>K?!K?O?@/0,k?7T@+480/"z60./+dP470 &0$ 0H/01n0 0$ + h?h+04:'A+04=pK?Y'+49/!@7? # !2 " !k?7+rH?+dPH9+H8+r  h7"ڰ#[607Y2k?_M4 +"H7K?621_4 +#H8 472Q_4 +H"@ +H? +H7 +H< +H! @:@ j+H8ȃ R+H9 :+dP""zH762q6x0_4 K?Y@7?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ? # !2 ! *k?ok/ k/k/k/!k/)7&7E7 6#7p 44 4_E4@!J+f 4& 44ЈC#b_@+f 4%4@74O4p e b+f 4%4P4OA4( e4O4 f4?5K.K/)K/!K/K/K/ @O/WE47/74PA4N=4`j7? 4^? J 7 f @444 _%4K. b4k?444U M777744 4 _444@4 _4 X4 4`X474`4p4 _5= @+f 4& 44@4 O4= f40T]4m5T-4<@+f 4'44Xq4<@ gk?7#74@ h4@7?#'7/@0 #@470n4<' F+4h9 8 0N1 'IP@4@` 4<`4+h? +h7 OQ4+H3 K?Yh3 @7? # !2 ! *2k?/,ok?k?!k?)k?1k?9 {7D7&4xpk?q4yp4 _]4K?q4y4 _544CC+H7 4%Oy4$h44H 78`H+H8 4%O4#h44H 78H+H9  *O4+h< #B+H:@ 4%P@h@ 4PK?q4y4 _e4K?q4y4 _=4 *K?q44y0_ 4O4 h@#7- 44y`K?q4 _4 X0@7?a'E00N0'O4?eh@4yK?q4 _47?a"'6/@ 0 ! 1Vn ''/P10 1&N 9aG0N1:W'F`ן4?K>K?9K?1K?)K?!K?O?@/0,_4z4_4zE4ϟuK>ϟeK>H@+K?qh<+4?h74y_%4 H@+7W?K?qh7+ $ h%4y_4 ˀK> # !2k?ok? k?k? ۠7k?A7D7%4pk?94 4 _u4K?9404 _M4K?94P4 _%4@4@a*a" T ` ϝK>7?A"{'6z/@0 0n'01N 1! 'J`K?A4?70j?4@j?n8 `_| @4?K>K?K?K? @O? # !2k?7+H9+H8+H7k?+o_Eh Pk?#7p@(7pK?_U4 K?YK?_-4 +dp4?+{47 4?4?"_+{ 4?4?_K?+oh7P+h `K?YK?@7? # !2k?7+H9+H8+H7k?+d`_h  k?#7@(7pK?_U4 K?YK?_-4 +x4?4?4?_+b4?4?_K?+d`h7 +h `K?YK?@7? # !2k?o"7C66p4 _4wb`*4@`_4z@"ן4?K?Y@O?_4z@ ϟK?Y+H?+ @hh# +H9 @`@ˀeK?Y # !2k?ok? k?@a7C4~a@ 4pk?!44 _}4w+oH8P `+H? 4`2+{ 49= @ 7_= +oh P4?4|K>K?K? @O?"66p4w_4 y4|4|}}4|+4?7? +o  = 4h<P V+dpKK?! 44 K4 u 45j(+{46 K = b 4@K } k K t j0K 3_7+h%  2K?!44@_4{4|+H44 =4|+H3 `+H7 h4?6x+h8 ` hk hE4| # !2k?o+d`H7 4?`+H7 4`2+b48 b4c_ k 4?4|K?Y@O?4|}4|+H7  4 y #7pK 7p6w?k _4 +H?ǿ4|+H5 `+H: h4?6+h7 ` Whk h4| # !2k?o#7C7pk?74 _4w`a4~ca+dp4? A+H8 aj+oH=P 7h5P+H9+{ 43 w 4 #4? +H4 `6?h< `+ H:  W4@ `4H4 j(H: H9 j H8 k@0K?Y@O?ϟK?Y#K?7_4 ϟK?Y # !2k?ok? k?@b87D+H8 B+ H% e H%(#[7Xp7Y k?!4 _=4@24`"+x47 4?+b4?  +d`H8 + H7+d`7Ƿ h= +H4 `6?h5 `+d` H7 K?!4 0_54 +H?4? k(4@H"4b @H9y j H"b k 0K>K?K? @O?"۠66p4_]4 ϟK> # !2k?7k?#7W7 `7p_4 K?+x47 _@ _@K?Y@7? # !2k?ok? k?k? ۠77C7$4pk?!4 4 _}4wK?!4 4 _U4K?!4 4 _-4``4~```  4` w`@@ d```@ꀃ@7@4?K>K?K?K? @O?ϝK>ˀK>ˀK>ςK>6?y`d` ˀuK>وx` ς]K>ϟMK>ς=K>و_'4?_4?ς K>k?ok? k?k?k?!k?)k?1k?9k?A+H64#" 4 T4b4 T4c +H5 4b4&+{ 4'+x04pk?Y4(+4 k?Q4)4 I8  X KKK K(K0k?5 k?4 pk?5zk?4k?yNmk?q4T5yaI9 Y KZ rN@!PK?QI"@K?Y B K4 N5z 5y4 N5z5yT4aBH 4^U5J8+oH8P+xH7+x04%4 @N44T4@h`@h`4K>K?AK?9K?1K?)K?!K?K?K? @O?h`h`4 NE5z5yMh`k?ok? k?k?k?!k?)k?1k?9k?Ak?I+H=4#" 4 pT4bz4 T4b+H: 4a4&+b4'+x04pk?Y4(+4 k?Q4)4 4 I" K b KKK K(K0k?5 k?4 pk?5k?4k?yN=k?q4T 5aI?NI!4 \` +K?Q@K?YN55T 54a"H 4^5k8+d`H8 +xH7+x04%4 @N544T 4@h`@h`4K>K?IK?AK?9K?1K?)K?!K?K?K? @O?h`}h`mh` # !2k?ok? k?k?k?!k?)k?1 7&7G4pk?A4 4 _m44 4+f D9@ &* +f 4?4?C_dXI@+f 4:+`V h<K?A74 4 _7e+`H7K?A4 _m4 +H?؀ *+f RW6h?h8]@e+H6 4%J+f 4?G847%"J`+`H:7D+H9 4\34J`H" 5@ H4J``JJhH4 8  7J`4Jh4\6? U4 @7?  T4@ +H4؀ +f H54'@+H< ؋(R+H= )+H! *+H" h@++H( X-B+H) .+xH5  +oH60+H< Ȁ0+f 4'D,0z+}p4( Na5+`H47P+H3 4V 4?K 47B= 47+xH8 .K 4 I64 4 04_M4K?A4 @4 _%4K?A4 `4 _4w 0+f 4?G +`H<&`+H< 4 v4H6 4@ 4H7 4  4g/Bˀ(K>ˀK>׀4?K>K?1K?)K?!K?K?K? @O?4c+H( +!H?P+f 47F!+`H( *a+H) 4D  4H= 4D = T78H: 4  7H= 4p = 7&H: 4F : v75H9 4 6H8 4 6H8 4 <64D6? S4a@4c+H( 9@9@+f 4(E ( 9@+H? +`H" &`+H= 4T 4H: 4B  F7H) 4 64e(b@+v X4" I 0K?AN A5:X_4T+`H87U`+H? 4T 4H= 7B] 4ZH" 4 B 7F`8H8 "7 _44 T5:?  S4et@bU@+H4؊7+4G 7w+HHWW++`H<6U@+H< 4F :4H: 6@ ]4`@6HH= 8 7  V44F5? ]4M@bE+4E 6?++H? 4H4) N}4 I? N7Z+`H37?`bI9 4B &  84I6 7@ S4 E DI" 4cF `4ED5++H7 4H4) NE4 I4 N4:+`H77?`bI6 4b 4I4 7@ <4 %eDI( 4c  4G0 3+H@H@S++H3؊`3++`H664@+H5 4X b4H9 6@ 4`@6HHH: x 7  44X4X? Z4Y@b+4G4@2+HPHP R++H=؋2g++`H56|`+H4 4Z 4H) 6@ 4`@6HXH9  7 "44Z47? Y4]8@bU++H801O+x4D 1/+x+H3؊`1+x+H? 4 ? 4(N4 I N6+`H)7`bI 4P& 4I 7@ h )4 d I 4c f  K 4 6A J+}p47 K   4"@?K 4V5? X4 @H= 4c  @+H! $0_4 +f 4?G,074 +`H:p4c+H8 4V \4H7 4B 4H) 4 4g,4e6+H: 4% F  4 H8 4w_ 4MH +H H9 7]Q4UK>+H6H7\ "@694y #@7pC4@ҿ`r+H8`7?ӷ+(h?H+t4:p@\ ;4<@ # !2 " "" " !k?ok? k?k?7DCW {4y4_u4@4"+H= !4b!4 :4xp7S?ek?!4y04 _4`04 ? Y 9 7?  K?!4yP4 _}4`+h&+H7K?!4yp_54 +H:`W@az+H?H Z+H< B+H!  *+H8 K?!4_4+4vph6h4K>K?K?K? @O?_4+h<h44y7_4 +H"Ȁ B+H$ *+H8h44y_4 ϟ%K>ˀK> " ! # !2 ! *2k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+7#H9X+{4-7H4@ @k>A+`H0 "+~`@+` 42k>A+f 4%+H/4k>I4q6g4 +H+x 4)NA4i<x-RI0x44 I*x @I6xhlhv :Q %4@k>4k>4k>a+f k> 40k>94/@k>14.k>)+v4-k>!47k>i4@k>Q!5k>+`4)+v49k>y4k>+dp48@k>q+f 4?k>42@+4*k>+534k>4+k>Y+r4,7?1!۠4066?K>@4?B 36t?@Ґ@K>AUQ? J +rH:4B 4?@ `4+H6Ȃ B+H! *#477p_4HwD+h7 4?+H=$&0K>I4 $\ %K>IM=hzeh|"6K>I4_]44K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=IYx N4ʃ5i\x4a245I\x4 7`5IVx3 7S`5IUx= 7=`5ITx: 7Z`H5ISx9 7 Y`5^I\xIRx @  ( +H7 i`P?IBxh4hbI\xC4B44244"I "44?+H2Ȁ3+H7355p_4 44F4R+H:4:I ">4?+H!Ȁ>+H4>j455p_u4@ :ISp NQ46Hi\p4a45IZp9 _ 7 9a5IYp2 ? 7a`5IRp1 _ 7a(5IQp" ? 7`5IBp!_ 7`5IAp<? 7|`5I\p6 7`H5IVp5 7U`5^?IZpI]p @ ( +H4 ;IPphhpa45K>)96"ax526"aP5"6"a(5!6"a5<6"`566"`556"`546"``536"`85=6"5@ H +H3 K>a 9K>ahw5hx_4 @4?+4*K>a450_}4 +H:9"I "94?+H3Ȁ8+H6845p5p_4 :#_7I0xah44@57?1575"a(5474"a5373"`5=7="`5:7:"`5272"``5171"`85"7""`5^5 @  ( O5 |a45K>46"a`536"a85=6"a5:6"`596"`526"`5"6"`p5!6"`H5<6"` 566"5K>Q w @  H +H: 4K>Q w5 x_ 4+5pH7P54 _ 6@@4 4 4? I "44?+H8Ȁ3+H9345 6_ 4 :Hq4B? B+h P45@6_ 4@ :43"+4h7P56_ -4  :ah4K>4@5!7!"a@5<7<"a5676"`5575"`5474"`5373"`x5=7="`P5:7:"`(5^!@   +H= K>Y 1K>Y ha +H7X0K>A4U 4ypI " R+H"Ȁ :+H$ "455p_4̟P :ah44@57?1:7:"a(5272"a5171"`5"7""`5!7!"`5<7<"``5676"`85575"`5^: @   +H0 .Oa5ph|h+Xh +H:4`JK>!N0MK> "+H66R_N05p54 6_6W+H=] K> 45@_4 +H=-ZI "-@4?+H?Ȁ-"+H8- 456_4 :K>i R T +h754 _6+H754 _6+H= x+H?@Z@RK>q `:4X`*+h756_4 +H:+ K>yH! a +x `h5 P_5 44,O4+H9 ,/4I "*4?+H"Ȁ*+H5*455p_4 :4&*jTK>AK>Ai|P5P4_m7IrP@`i`PIqPj+H5X4h<X+ h5Pa45K>997"a`527"a8517"a5"7"`5!7"`5<7"`567"`p557"`H547"` 537"5K>_ @ H +H= 'K>hh|_5p 4ah44@57?1575"a(5474"a5373"`5=7="`5:7:"`5272"``5171"`85"7""`5^5 @  O5h|545_7 :c45K>197"c527"ch517"c@5"7"c5!7"b5<7"b567"b557"bx547"bP537"b(5=7"b5:7"a597"a527"a517"a`5"7"a85!7"a5<7"`567"`557"`547"`p537"`H5=7"` 5:7"5K> ? @   +H5 p!K>hpha4`a P6?( "45a4_7` 5 05a0 "5a" !5a! <5a<u7+H5 `a  :K>h|A? 4hv@  :Q ;6+H5 AIM4P+H7PK>I4`_44?+H8P+4h 4 M e444bM`7@`4K>I4_)44+H1:[K>I#K>IM}7K>I4?Mahzh|+@H?P+ h)H+4 9h*+h?X+4?h/P # !2k?ok?4?kW#W7pD+@7CkD @kDk@kDk@kDk@kDk@kD0k@(kD@k@8kDPk@HkD`k@XkWhkDxk@pH9 +h$+H847_4 +H:hzM AH:hd7hdؗh}4hdh`h`h`K?YK?@O? # !2k?ok?+H?7X#7# 44_4 4pHwk?4P_]4 HxHw4p_54Hx Hw4_ 4Hx0Hw(4_4Hx@Hw84_4HxPHwH4_4Hx`HwX4_m4HwhK?4 _E4 HxxHwp4@_4HxHw4P_4HxHw4p_4HxHw4_4HxHw4_}4HxHw4_U4HxHw4_-4HxHw4_4HwK?4 _4 Hx440_4 4K?YK?@O? # !2 " "" " ! ! *k?ok? k?k?k?!7E7$ {44y@4 _U4+4xpk?14yPH7_4 4_4+H68+dP4!h +f 48`4@4܊4%+~`@3 +~`4%+H=X "+{4:+~`M u49+H6$+H< $+H!H $j444_4@H(+H4 (+H5H(444w_]4p++H?0+f h?`4&+H<+H5(hh+H= hp+H8h+H7hx+H?PK?1h+H7h4yp_U4 +H7K?14y_%4 +H7pK?14y_4 +H8 B+H9 *+H:p 4(h+H=X04h4yHK?1_E4 hhH`2H4y_4HC:G J+H3 2+H4 +H<p HK?14y 4 _m4;4+H4X +`H5  +~pH9 +~`4'T4@B44y@4_4 +4|ph<+~pH844y_u4 H4y4_M44`4@4#7M4 87+{4:4V4 4+H5Ȁ :+H6 "44y4 _4+4:N4 Ni4+H7P+ PH?Ȁ!+H6!K?14y _4 + :+H: "K?144y@_4+H?ȏ@4X?`r+H"Ȁ Z+H% B+v S4! "44y`_4 +H?@z@r+H'Ȁ Z+H7 B+v T4" _44y_]4 HH4y_4+H8 B +H!!+H" !+H#H!K?14_44_@+h<7C r+H? Z+H$ 7m@+H'H7M@44_4+H=Ȁ :+H3 "44y4_4 +H$Ȁ B+H% 0+H844y0_=4 +H844y@_4 4K>K?!K?K?K? @O? # !2k?7Tk?"6`K?k?4_7K?+P4K?Yh?@7? # !2k?7CY+4 0h?CU+40h4+H? +H! +4h3#7+7pH7k?_ 4 +#H7K?7_4 +H"@ 2+H7 4K?Y@7?ςK?Y # !2 " ! ! *k?o k7 k7k7+H" +}p @7DH3 `" {44y4 _E4+q04fpH7 4y4 _ 4+q0H? 4y0444 _4+H= j+H3X R+H4 8 :77qS4K7qL4 K7q+H58!4S4P4k7!+ (h:+H: 4yNQ4K7!4y4_4+H<+4ςh=+H&Ȁ :+H7 (44x 4 _444y@4_4 +H: 4ypN I44K6K7K7K7 @O7+H6؀ +4ςh:4R 4k7)4y44_7K7) +4ς%h9+H8p4k?+H7X4S774R 77k714y4 77_-7K71 +4ςeh8_ @2D4d0+H: 4N Y4+H%Ȁ :+H? (44 77_m444yP77_54 44yp4_ 4 +4Uh  # !2 " !k?ok? k?k?+H?k?)7C"87 444 _]4x+H! "+H"@"j+H&"R+4pH78k?!4_4 +H484"2+H5 44@x4x 2U 4zC 7M4z+H6 R+H<X :7?qS }4zK?qL 4z!K?qK?)44R 4yBX+4h:444x_e4 b4| 4pK?)44R 4P4+h?7444 _7H4|444p_4b4|+H9 S%4P4+h77K?!4 4 _74|+H7Ȁ :+H8 "44@4 _4y4x44p_4 44|K>K?K?K? @O?h 444x_4 `4| # !2k?o+rh #;+dP79p7Xk?4h R4#[7YK?74 _U7`@*+h P+4h?@4K?Y4|@O? # !2 " ""k?7+H7 +rh +dPh #77pk?+4h?_]4 +H9 Z+H: @ B+H=H *+H8 K?4_4K?Y4@7? # !2 " "" " (k?ok> k>] +4pk>!4 H7_m4 +H44'+}pH< % h +H5!rK>!4@4 _4w+H7xK>!4`_4 +H7 K>!4_4 +H7 K>!4_]4 +dPH7K>!4_-4 +H7K>!4_4 +H7K>!4_4 +H7K>!4 _4 +H? +H! +H7#J+H8 +H%$2+H9 %R+H"@%:%2+H6%+H? +dP H% +H: E K>!44 _e4]@+H? +aH7 R+H=  :+H3H "K>!44 _4+H%Ȁ#+H?#+H8 +H:+H9+H7P4k?4_Uk?x+ R+H6  :+H<H "K>!44_4 +H!Ȁ "+H"@"K>!+H8 +H:k?+H9+H7P_Uk?x+Ru4|++H< R+H!  :+H"H "K>!44 _4+H=Ȁ!+H4!+H:+H9+H8 +H7P4k?4@_k?@++H7 Z+H8  B+H9H *+H7h44 _4 +H:Ȁ +H3 +H8h4`M7>+H:+H9+H8 +H7P7>k?4_k?+h +h +h 4|K=K>K> @O> # !2 " ! " "" " (k?ok? k?]%7E 4pk?!44 _]4+H7K?!4_-4 +H7xK?!4 _4 +H7K?!4 _4 +H?P4 "+h?X+4?h<P+H6!+H<؋!R4C7+H4Ȁ B+H< *+{4484 @_4+H" R+H7  :+H9H "44 p4 _4+H"Ȁ z+H7 b+H:+H9+H8 +H7P4k?4 p_k?+H5!A!K?!44!_}4]i@+H<!B+H! !*+H:@!+H"@ +H4 R+H5  :+H6H "K?!44_4 +H=ȃ r+H3` ZK?!+H:+H9k?+H8 +H7P_=k?+h +h P+h 4|K>K?K? @O?=++H? "r+H8P"Z+{@= 0+H:Ǻ+{S 94:+H?=?+=/+K?!44 _4+H!Ȁ :+H" "K?!44 _}4+H9 <++H:@y4?"6 @+oH7p46?h9p+dp54H3p6u@h5p+oH<p47?h7p+dp4H:p7S@h3p+oH6p46?h?p+dp4H9p7=@h=p+oH5p46?h<p+dp4H8p7@h:p+oH3p46u?h5p+dp4H?p7@h8p+oH=p47?h4p+dp4H6p6@h7p+oH?p47?h8p+dp4H=p7@h4p+oH4p46?h6p+dp4H7p6@h9p+v4! p@ ? 4_"j4삟!4!4̂!j4 4 4 j4"Z+oH<p7?h7p4+dpH9p47=@h=p@4+oH?p47?h8p4+dpH:p7S@h3p+oH7p46?h9p+dp54H=p7@h4p+oH8p47?h:p+dpW4H3p6u@h5p@4+oH9p47=?h=p+dp4H4p6@h6p+oH:p47S?h3p+dpv4H5p6@h?p+v4< p@ +v49 p@? @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @\7?K4?#<7= +oH3p46s?h3p+dpv4H:p7X@h8p+oH=p47?h=p+dp4H9p77@h7p+oH:p47Z?h:p+dpT4H8p7@h?p+oH9p479?h9p+dp34H7p6@h6p+oH8p47?h8p+dp4H?p7@h5p+oH7p46?h7p+dp4H6p6@h4p+oH?p47?h?p+dp4H5p6h3p@@ @K?@ @\4 4N@4 4 4@ 4z 04~@+oH:p47_?h?p+dp4H7p6@h8p@4~@4@4D@4~@4~@ @K?@ @\7?K4?"|6t +oH?p47?h4p+dp4H3p6}@h=p+oH<p47?h3p+dp4H=p7@h:p+oH6p46?h=p+dp4H:p7Y@h9p+oH5p46?h:p+dp\4H9p78@h8p@4+oH4p46?h9p+dp64H8p7@h7p+oH3p46x?h8p+dp4H7p6@h?p+oH=p47?h7p+dp4H?p7@h6p+oH:p47_?h?p+dp4H6p6h5p@@ @K?@ @\4 4D@4 4 z4@ J4* 04@@4~@4@4~@4@4@4@ @K?@ @\7?4?#7 @4@4@4@4@4@4@4@4@44@@ @K?@ @\7?K4?#7 @4~@4@4@4@4@4@44@@ @K?@ @k?7+H?+v49P6Z 4ԃ R4S @@+v4: pәY K?Y@7?+oH7p46?h8p+dp4H3p6uh5p+oH?p47?h7p+dp4H=p7-h4p@ @K?@ @\4Z Z+oH6p46?h9p+dp:4H4p6h7p@4r! 4@ 4j?@+oH3p46?h?p+dp4H:p7U@h5p@4+oH4p46?h7p+dp4H=p7@h6p+oH5p46?h8p+dp4H3p6@h?p@4@ @K?@ @\4 4@4z b4@ 24 84@@4@4@4@4@ @K?@ @\4 4@4z b4@ 24 84B@@4@4~@4~@4@ @K?@ @\7?4?"|6t  @4+oH?p47?h4p+dp4H3p6}@h=p+oH<p47?h3p+dp4H=p7@h:p+oH6p46?h=p+dp4H:p7Y@h9p+oH5p46?h:p+dp\4H9p78@h8p@4+oH4p46?h9p+dp64H8p7@h7p+oH3p46x?h8p+dp4H7p6@h?p+oH=p47?h7p+dp4H?p7@h6p+oH:p47_?h?p+dp4H6p6h5p@@ @K?@ @\7? I4?"6  @4@4@4@4@4@4@4@4+oH4p46?h8p+dp4H3p6@h?p+oH3p46w?h7p+dp4H=p7@h6p+oH=p47?h?p+dp4H:p7U@h5p4@@ @K?@ @\7?4?#7 @4@4@4@4@4@4@4@44D@@ @K?@ @+H?+v49Pן<_ 4 *4 z+v4= p@ +oH:p47X?h8p+dp4H4p6@h6p+oH9p477?h7p+dp4H3p6u@h5p@ @K?@ @_7>_4?#<7< @4@4x@4|@4@4+H:+v44P: Z+oH4p46?h7p+dp4H6p6@h7p@4+H9+v43P Z+oH3p46?h?p+dp4H5p6@h?p@4@4~+u46 p +v45 p@ @ @K?@ @_4? 4_ z4؃ Z4ւ :4| 4^ Z@4@4@4@4@4Z@4T+v48p +v47 p@ @ @K?@ @\0F4F@@ @K?@ @_4F @4F+v47 p@ @ @K?@ @+u4? pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+H?+v49Pן<_ 4ԃ *4 z+u4=p@ +oH:p47X?h8p+dp4H4p6@h6p+oH9p477?h7p+dp4H3p6u@h5p@ @K?@ @_4 Z4ԃ? :4z_ Z4x :+u47p@ @4x@4z@4@4@ @K?@ @+u4?pW@ @ @K?@ @_4 Z4ԃ? :4z_ 4x :@4@4@4x@4z+u47p@ @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @_4 Z4? :4z_ 4x :@4@4@4x@4z+u47p@ @ @K?@ @+u4?pW@ @ @K?@ @+H?+v49Pן<_ 4 *4 z+u4=p@ +oH:p47X?h8p+dp4H4p6@h6p+oH9p477?h7p+dp4H3p6u@h5p@ @K?@ @_4 Z4? :4z_ Z4x :+u47p@ @4x@4z@4@4@ @K?@ @+H?+v49Pן<_ 4 *4 z+u4= p@ +oH:p47X?h8p+dp4H4p6@h6p+oH9p477?h7p+dp4H3p6u@h5p@ @K?@ @+v4?pW@ @ @K?@ @+v4?pW@ @ @K?@ @k?7+H?+v48P׿!_!چ!҆ Z!Ž#4 +v46 p U i444 4 4ȃ? 4_ 4 Z4 *4 U 4P4U 404U 44U y44U Y44U 944U 44+v45 pp 7>y4?"|6y7 U 44U 44U a44U A44U !44U 4x4U 4X4U 484+v44 p +v4< p K?Y@7?@ @K?@ @+v4?pW@ @ @K?@ @+v4? pW@ @ @K?@ @+v4?pW@ @ @K?@ @+v4? pW@ @ @K?@ @k?7+v4?pW_  K?Y@7?@ @K?@ @k?7+v4? pW^m K?Y@7?@ @K?@ @+H?+v49Pן<_ 4 *4 z+u4=p@ +oH:p47X?h8p+dp4H4p6@h6p+oH9p477?h7p+dp4H3p6u@h5p@ @K?@ @k?7+H?+v49Pן<_ 4 B4 +u49p^%? K?Y@7?+oH8p47?h8p+dp4H4p6h6p+oH7p46?h7p+dp4H3p6u-h5p@ @K?@ @+u4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4? pW@ @ @K?@ @+t47pX +t49 p@? @ @K?@ @+t47 pX +t49p@? @ @K?@ @k?7+t4? pWA K?Y@7?@ @K?@ @+t4?pW@ @ @K?@ @+t4? pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t47pX +t49p@? @ @K?@ @+t47pX +t49p@? @ @K?@ @+t47pX +t49p@? @ @K?@ @+t47pX +t49p@? @ @K?@ @k?7_4 4HK?Y@7?+t47p@, K?Y@ @K?@ @+t47pX +t49p@? @ @K?@ @+t47pX +t49p@? @ @K?@ @k?7Z4HW 4K?Y@7?A8@+t4?p @ @K?@ @k?7AZ+t4? pK?Y @7?@ @K?@ @k?7_EZ+t4?pK?Y @7?@ @K?@ @_4? 4_ 4 4z 4n z4f Z4d :4F 4D? @4@4@4@4@4@4@4 @4@4+t48p +u47p@ @ @K?@ @+v47pX +t49p@? @ @K?@ @+v47 pX +t49p@? @ @K?@ @+t47pX +u49p@? @ @K?@ @+t47pX +u49 p@? @ @K?@ @k?oCQ]4z K?Y|@O?Q4z|K?Y@ @K?@ @_4!24Ѓ!4̃ 4J 4 4 r4 R4 2+u48p +t47p@ @4@4D@4@4z@4d@4n@4@4F@4f@ @K?@ @+v47pX +t49p@? @ @K?@ @+v47 pX +t49p@? @ @K?@ @_4? :4_ 4 *@4D@4@4z+u48p +t47p@ @ @K?@ @+u47 pX +t49p@? k?oCQ=4z K?Y|@O?Q4z|K?Y_4 4? 4ȃ_ 4 z4 Z4 :4 4N z@4@4@4@4@4@4@4@4+t47p@ @ @K?@ @\4 4 4@ 4 z4@ J4* 04N@@4@4@4@4@4@4_4!4? 4҃_ 4ƒ 4 4 z4 Z4 :4z 4H? @4H@4@4@4@4@4@4@4@4@4+t47p@ @ @K?@ @\4 4z@4 4 4 4@ j4J 24 0H4H@@4@4@4@4@4@4@4@4@ @K?@ @_4؃? 4֋_ @4R@4r+v48p +t47p@ @ @K?@ @_4r? 4R_ @4@4+t48p +v47p@ @ @K?@ @4 _P7?@@ @K?@ @+u4? pW@ @ @K?@ @+u4? pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+u4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+H?+v47P?\ +t4:p@\ P4~@@ @K?@ @+u4?pW@ @ @K?@ @+t4?pW@ @ @K?@ @+t4? pW@ @ @K?@ @+t4? pW@ @ @K?@ @+t4? pW@ @ @K?@ @+t4?pW@ +H?+v47P׿\ "+t49pӓ@3 P4~@@ @K?@ @+H?+v47P׿\< 2+u43p| +t44p@ P4~@@ @K?@ @+H?+v47P׿\< 2+t43p| +t44p@ P4~@@ @K?@ @+H?+v47P׿\< 2+t43 p| +t44p@ P4~@@ @K?@ @\P4~@@ @K?@ @+H?+v47P׿\< 2+t43 p| +t44p@ P4~@@ @K?@ @k?7_Z_uӚK?Y@7?@ @K?@ @+H?+v47P?+t\4:p0\ @@ @K?@ @k?7+H?+v47P?Z \K?Y@7?_E@+u48 pӓ @ @K?@ @k?7+H?+v47P?Z \K?Y@7?_e@+u48 pӓ @ @K?@ @k?7+H?+v47P?Z \K?Y@7?_@+u48pӓ @ @K?@ @k?7+H?+v47P?Z \K?Y@7?_@+u48pӓ @ @K?@ @\4 "`7?`@@4~@ @K?@ @k?7^Z_UӚK?Y@7?@ @K?@ @k?7Z4_ r4 Z4t :4T: @44|`B \4޴T4tK?Y@7?^a@\@@ @K?@ @k?7_Z_ӚK?Y@7?@ @K?@ @k?7_Z_EӚK?Y@7?@ @K?@ @\P4~@@ @K?@ @\4t 4T @4@4Q|4~@@ @K?@ @+t4?pW@ @ @K?@ @k?7_Z_uӚK?Y@7?@ @K?@ @+t4? pW@ @ @K?@ @\4` `4~@@ @K?@ @+t4?pW@ @ @K?@ @k?7_Z_ӚK?Y@7?@ @K?@ @k?7_Z_ӚK?Y@7?@ @K?@ @+t4? pW@ @ @K?@ @\4`7?`@@ @K?@ @k?7^ QZ_eӚK?Y@7?@ @K?@ @\4@`: 24P "4Z 4\ (4~@@ @K?@ @\4@`R7>4?#7h @@44~@k?7_Z_ӚK?Y@7?k?7_ Z_ӚK?Y@7?@ @K?@ @\P4~@@ @K?@ @k?7Z@1شj_-@K?Y@7?@ @K?@ @+t4?pW@ @ @K?@ @k?7_eZ_uӚK?Y@7?@ @K?@ @+t4?pW@ @ @K?@ @\4` `4~@@ @K?@ @+t4?pW@ @ @K?@ @k?7_Z_ӚK?Y@7?k?7_5Z_ӚK?Y@7?@ @K?@ @+t4?pW@ +H?48 +`H? * j:48@4:46:4P=43@4:@4:@4+H748 X44<  ? 47 ? _@7+`H7  j ? ? 467 7 4P6 ? 4w7 ? 47 ?A@7+H8KSK]4: @ӷ48 ?7@4>67?ӳ6Q>7?p64@7+`H:B 4 * 8 8 47 8 46|7 : 4H7X 8 47 87 ! @4<+`h 4@h k?ok?+H748 k?+f049 _U47?`Z`R+f04# hK?7`2_ h4K?YK?@O?ϟK?Yk?ok? k?k?+`H?k?!44!4#@+f0_%49 "+f049 _=64`j`R+f04% K?!Zm7aB_ hdh`4K>K?K?K? @O?W4@@ 4` *7hs4} +f0_49 4w 4Ht7>mh|+f0Hz_E49 ̂e@ϟK>+`h 04h (@h  @4k?ok>k>k>k>k>k>k>k>k>k>k>k>+H?4:!k>48$:K> 7K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>h` }7oK>YH($+f04$ 4@464H4P4 4 4 4 4 44dDHw0#Z# 77 74ht(+`H?(4# B7?Hz hf(+f04" Z 7H hh K>7h` 4 @h`(4>`4aj4aZK>k?7k?}wK>YK?4>`7?k?7>k?4Y4\K>Yh` +f0h< 4hb(4+`H?(4#7?Hy he(+f04! 9 7'mhg K>7hz(ן 57['K>YHx(77hz( @7hy( hw( H(;@4 H}(hl +f04< K7?=hd( :K>hm07wH(K>Y :K>h`07/H(K>Y>7K>7hx( <m7Y_K>YHu(6hb( \ K>7YK>YHt(6ha( | >/H(K>hl0h`(h` 7}H(uK>Y K>U7XGK>YHs(6vhv( < =oH(K>h`0h`(h` 7}/H(K>Y=H(K>h`(h` }7|H(]K>Y@ @K?@ @_4| Z4r? *4\_ *4R :@4L@4P@4h@4p+t47p@ @ @K?@ @@\@ @K?@ @k?7\4`7>4?#7` p4~`4P4@404 44^7K?Y@7?@ @K?@ @k?7\4`7>4?#7@ 4~p4`4P4@404 44]e7K?Y@7?@ @K?@ @k?7\4`7>4?#7  4~p4R`4rP4\@4^04 44^7K?Y@7?@ @K?@ @_4H @44 N+H+l`B+H< *"\46Yp6XO4+H? +H#(`* +H.(B"Y6@_ @+H(!+H$؈!4.TE@aT M4+H3H9+K$h30+h9`+h'+h +h7+h  +h p+4h9@X!ܠ7?K$45@_ 4w@@ 4 Ch4+H?@ Tִ K$ ?U@6?K$o4? vn6>F+ZH: A*!Ya5#@_ 5@+H2@!+H-؉!48T@aTK$+H&H#+h&0+h#`+4h<+h +h++h  +h p+4 h-@U@+` h<H+`H?H Ze4\@+`@h<H+4h"UK$+4h8@2HsH`<@+ZH: A"#Y7#@_@+H) !+H(؉!T@arTK$+H6H<+h60+h<`+4h4+h +h,+h  +h p+4 h+@U u@h|H HH Z4\]@@h|H+4h%UK$+4h:@"*:BR+{4:+{ U)49+`@h<HTV21A2!\Y5Z$_m@+H9 +H1؊ 43T!@`T-4 +H*H'+h*0+h'`+4K$h3+h +h'+h  +h p+h)@a*#Y97_ @+H? +H=؋ T@`TK$+H'H$+h'0+h$`+4h8+h +h)+h  +h p+4 h+@f~a*#Y7_@+H/ +H7؊ Tq@`T}K$+H#H6+h#0+h6`+4h3+h +h-+h  +h p+4-h/@&.>C\7?"4J Z  +H= ] 4yX7a2X@_@+H) !+H&؈ 40T@`T@+H5H=+K$h50+h=`+4h%+h +h2+h  +h p+4mh7@>V^f_@+H< +H&؈ Ty@`T4+H3H9+K$h30+h9`+h1+h +h?+h  +h p+45h8@_@+H6 +H%؈ TI@`TQ@+H=H8+K$h=0+h8`+4h?+h +h7+h  +h p+4h9@_Q@+H5 +H$؈ T@`T@+H:H7+K$h:0+h7`+4h7+h +h8+h  +h p+4h:@_@+H4 +H#؈` T@`T@+H9H?+h90+h?`+4h9+K$h +h9+h  +h p+4h=@_@+H3` +H"؈@ T@`T@+H8H2+K$h80+h2`+4h3+h +h:+h  +h p+4Uh3@_@+H= +H!؈ Ti@`Tq@+H7H1+K$h70+h1`+4h5+h +h=+h  +h p+4 h4@_q@+H:@ +H<؋ T 1@`T9@+H?H0+K$h?0+h0`+4h6+h +h3+h  +h p+4 h5@_9@+H9 +H6؊ T @`T@+H2H/+K$h20+h/`+4h<+h +h4+h  +h p+4 h6@&0+H? +H8f +H5PF!Y5@_@+H8 +H5؊ T Q@`TY4+H0H-+K$h00+h-`+h#+h +h6+h  +h p+4 h"@&+@' b+#@7K$7`_4 +H:H9YyH87U+YH:+_h x+H7 +H4؊ Ty@`T4+H/H,+K$h/0+h,`+h$+h +h<+h  +h p+45h#@#K$47_4Y@+`K$"|h<H6y4 _7+`H?HA2+Y H:+_h x+H. +H+؉` T@`T4+H=H3+K$h=0+h3`+h%+h +h"+h  +h p+4h$@+@& *+H:H9Y H87U+XeH:+_)h x+H? +H3؊` T@`T4+H.H++K$h.0+h+`+h&+h +h#+h  +h p+4h%@>FV4D@4A_@+H2@ +H=؋ T@`T 4+H,H)+K$h,0+h)`+h(+h +h%+h  +h p+4Uh'@+H0 !Z+H3 !B!X5 _Y@+H1 +H:؋@ T@`T !4 +H+H(+K$h+0+h(`+h)+h +h&+h  +h p+4h(@&.>+H? +H/Hb +H*HAB"X6_ @+H0 +H9؋ T@`T 4 +H*H'+K$h*0+h'`+h++h +h(+h  +h p+4 9h*@4D 4A_ q@+H/ +H8؋ S5@`T 94 +H)H&+K$h)0+h&`+h*+h +h'+h  +h p+4 h)@+H/`+4 h90+4 h,`+H+  !Z+H= !B"<X6: _ @+H. +H7؊ Sm@`Tq4 +H(H%+K$h(0+h%`+h-+h +h)+h  +h p+4 !h+@.6F4D4A_Y@+H- +H?؋ S@`T!4+H'H$+K$h'0+h$`+h.+h +h*+h  +h p+4 h,@N&+H.`+4 h=0+4h/`+H2 +4"h:p+H: ""\X6Z _y@+H, +H2؊@ S=@`TA4+H&H#+K$h&0+h#`+h0+h +h++h  +h p+4 h-@&.>CU K$k.XMK._@+H3` +H!؈ S@`T4+H-H*+K$h-0+h*`+h0+h +h#+h  +h p+4h%@+H? +H.H䊈 +H)HDj#X7_@+H+` +H1؊ SE@`TI4+H%H"+K$h%0+h"`+h2+h +h-+h  +h p+4h/@fn~CV K$k.XUK._!@+H8 +H4؊ S@`SK$+H)H&+h)0+h&`+4h8+h +h'+h  +h p+4 h)@*2B+!\H7K$5Y`_y4 +H? !Z+K$!<h x459_4 +H$`B+H% *!45p5N4+H%4h?+`\h%H\Y4M}@+Muh<(+`H0H+H<x+h0+45 p.&4Ct4A^ @+H*@ +H0؊ S@`S4+H$H<+K$h$0+h<`+h1+h +h,+h  +h p+4h.@ ^  & 64C4A^@+H) +H/؉ Su@`S}K$+H"H5+h"0+h5`+4h7+h +h/+h  +h p+4)h1@  v ~ 4C4+`7A@h<H <K$49`^4 ^@+H( +H.؉ S@`SK$+H6H3+h60+h3`+4h9+h +h1+h  +h p+4h?@    4C,4+`7AHh<H K$4@^E4 ^@+H' +H-؉ SE@`SM@+H4H:+K$h40+h:`+4h=+h +h?+h  +h p+4 h8@  f n ~#X]7^-@+H& +H,؉ S @`S@+H=H8+h=0+h8`+4K$h4+h +h8+h  +h p+4 h:@  & 6+H? +H"j +H,AJ"ܠX6@^@+H% +H+؉` S M@`SU@+H9H?+K$h90+h?`+4h"+h +h3+h  +h p+4 h5@   +H- !2"XU6p^%@+H$ +H*؉@ S @`S@+H8H2+K$h80+h2`+4h6+h +h:+h  +h p+4h3@!X5$0^@+H= +H7؊ 46S@`SK$+H-H*+h-0+h*`+4h9+h +h$+h  +h p+49h&@ j r z!<X5:$`^}@+H3` +H?؋ 45S5@`S=K$+H,H)+h,0+h)`+4h:+h +h%+h  +h p+4h'@JRZ+H% Z+H/  B+H2H *!445$^4^@+H:@ +H2؊@ 44S@`SK$+H+H(+h+0+h(`+4h=+h +h&+h  +h p+49h(@"X6^}@+H#` +H)؉ S=@`SE@+H7H1+K$h70+h1`+4h<+h +h=+h  +h p+4h4@ <XY4:^-@+H#` +H'؈ S@`S 4+H2H/+K$h20+h/`+h$+h +h5+h  +h p+4h<@V^n4Jp *4rq  \4Z X@^ @+H! +H&؈ S}@`S 4+H1H.+K$h10+h.`+h%+h +h6+h  +h p+41h"@&6 4K$4 ^ 4y+H5`B+H< * 44p4xN 4+H9Ȁ J+H6 2+ H8 044^ 4 X94+4h&xM4+H% + h ^ @^ @+H< +H%؈ S@`S4 +H0H-+K$h00+h-`+h*+h +h<+h  +h p+4h#@FN^+H6`J+H1 2+H7 <49p48@N4+H? +H7Xb +H-XAB!XI5`^ @+H6 +H$؈ S@`S4+H/H,+K$h/0+h,`+h1+h +h&+h  +h p+4h(@~+H" 4ZV1@+`"h<H!X5^@+H5 +H#؈` SQ@`S]4+H.H++K$h.0+h+`+4 h++h +h"+h  +h p+ h$@.6F+H8 4.+H9p4#47`^4 O@+`73h<@"ܠ46^u4 +O-H: 3F#\7YK$4^%4+`H9@+dP4:I-4+4h/p#+H? +H: +H.T!ܠX5^@+H4 +H"؈@ Sa@`Sm4+H-H*+K$h-0+h*`+h.+h +h$+h  +h p+4h&@rzO4 2ZK$CV+ 4Xh&x+^h-x+H3` +H!؈ S@`SK$+H,H)+h,0+h)`+4 h,+h +h#+h  +h p+4h%@"*:O}42ZK$CU+ 4XYh%x+^h0x+H= +H<؋ SQ@`SY4+H+H(+K$h+0+h(`+h/+h +h%+h  +h p+4 h'@+H5`B+H0 * \44Yp4XN4+H? +H2X +H,XS"X 6`^@+H:@ J+H6؊ :SY@`*Sa@+ʈ@+4uh'@BWm@+h x^@+H9 +H5؊ Sy@`S@+H*H'+h*0+h'`+4K$h?+h +h'+h  +h p+4 -h)@bjz+H4`J+H/ 2+ |H7 4yp4xN )4+H? +H30ᒈ +H=0Ar"X 6@^@+H8 +H4؊ Sq@`SyK$+H)H&+h)0+h&`+4h9+h +h*+h  +h p+4 -h,@@+4h(@ +H1Xᚈ +H+XAz+H' 7&aO4+H& K&aHY4!""<X6:^@+H7!R+H3؊`!BSa@a2Si4 +H(H%+h(0+K$h%`+4h7+h +h(+h  +h p+h*@+H/@  +H! Vq4: H+4  h&@Zbr+H3l`J+H. 2+ H7 4p4N4+H? +H-H b +H,HAB"|Xi6z^9@+H2@ +H:؋@ S @`SK$+H&H#+h&0+h#`+4h4+h +h.+h  +h p+4 h0@ +H0XẈ +H*XA+H% 7&qO 4+H$ K&qH4"#<X7:^Y@+H1 +H9؋ S @`S!K$+H%H"+h%0+h"`+4h=+h +h,+h  +h p+4hh.@BJZ+H< Q 7!"#X7@^@+H0!R+H8؋!BS@a2SK$+H$H<+h$0+h<`+4h:+h +h++h  +h p+4 h-@+H.@ G+H6 V6 H+4 h'@+H:L`B+H, * ܠ44p4N4+H? +H6` +H8`R"X6^@+H- +H2؊@ SI@`SQK$+H<H4+h<0+h4`+4h6+h +h0+h  +h p+4h2@*+H9,`B+H+ * 44p4 M 4+H? +H<V +H9N6"ܠW60^@+H, +H1؊ SQ@`SYK$+H6H3+h60+h3`+4h<+h +h1+h  +h p+4 h?@RZj#W}7^I@+H+` +H0؊ S @`S K$+H5H=+h50+h=`+4h"+h +h2+h  +h p+4h7@+H7`J+H) 2+!<H7 59p58M4+H? +H!b +H:AB |W}4z^ I@+H*@ +H/؉ S @`S 4+H4H:+K$h40+h:`+h%+h +h8+h  +h p+4h:@  " 2+H< 7&C76?#4d I4x+H4 5?7& 6 4 I]7(7(+  H. 5 7&I 4x+H4 5?6  # 7(I4+H?7(  `+H/XẈ +H)XA7&O17&7&O7(K&H7& K&H7(!* \4ZW@^ @+H) !B+H.؉!2R@a"S4+H3H9+K$h30+h9`+h$+h +h7+h  +h p+4h9@+H-@ #7&O7( 2 <W4: " z  W@^1@+H( +H-؉ R@`S4+H=H8+K$h=0+h8`+h#+h +h?+h  +h p+4h8@rz+H?`J+H( 2+!\H7 5Yp5XPM4+H? +H"Pb +H=PAB ܠWe4p^1@+H' +H,؉ R@`S4+H:H7+K$h:0+h7`+h(+h +h=+h  +h p+4h4@+H6 7*B66?Ӄ4s 4x5?I҄+H? 7* 7 C 7,IA4+H?7,   +H.Xᲈ +H(XA7*N7*7*N7,K*G57* K*G7,!" W4^Y@+H&!B+H+؉`!2R@a"S!4+H9H?+K$h90+h?`+h'+h +h:+h  +h p+4h3@+H,@ 7*O7, 2 W%4"Wa@^@+H% +H*؉@ R@`R4+H8H2+K$h80+h2`+h&+h +h9+h  +h p+49h=@+H2L`J+H' 2+!|H7 5yp5xM=4+H? +H#N +H3R.!W 5]@+H$ J+H)؉ :R@`*R@+ W M4]@+H#` +H(؉ R@`R@+H7H1+K$h70+h1`+4 h)+h +h3+h  +h p+4h5@jr+H1,`J+H& 2+!H7 5p5PM 4+H? +H9b +H8AB!|W E5z]@+H"@ +H'؈ R@`R4 +H?H0+K$h?0+h0`+h,+h +h6+h  +h p+4h"@ +H-X ᢈ +H'XA+H# 7.Nm4z+H" K.4ZG@!"!<W ]5:]-@+H! !Z+H&؈!JR@a:R4 +H2H/+K$h20+h/`+h*+h +h4+h  +h p+4h6@+H+@`  +H$ +h PU94 2+4  1h)@!\W5Zp]u@+H< +H%؈ R 5@`R=4 +H1H.+K$h10+h.`+h++h +h5+h  +h p+4 h<@v~+H0 `J+H% 2+!H7 5p5M4+H? +H%@ +H$@Ѐ!W5]e@+H6 +H$؈ R %@`R-4+H0H-+K$h00+h-`+h1+h +h$+h  +h p+41h&@+H/`J+H$ 2+!ܠH7 5p5`M4+H? +H'8 +H&8s!W5]U@+H= +H<؋5R @uRK$+H,H)+h,0+h)`+4h9+h +h(+h  +h p+4 h*@+H.`J+H# 2+!H7 5p5M4+H7 +H)  +H(A"\W6Z ]e@+H74>+H3؊`4>R%@t>R-K$+H(H%+h(0+h%`+4h3+h +h++h  +h p+4 h-@"ܠK$46]4+{H:+4R h1+H? +1h? +4h8 +H? +`C4#804 h9H80@44hxH +H:X +H5XL"W6]@+H?2+H=؋1R@rRK$+H'H$+h'0+h$`+4h:+h +h)+h  +h p+4 Yh+@4K$N @4cpK$+plh PK$U # 8 +4 h%@"<WA6: @]@+H2@2^+H:؋@2NR@r^R K$+H&H#+h&0+h#`+4h=+h +h*+h  +h p+4 h,@+H-`J+H" 2+"H7 6p6 pM4+H? +H* Έ +H4M"WY6 ] -@+H1 1+H9؋ 1R@qR K$+H%H"+h%0+h"`+4h5+h +h-+h  +h p+4h/@N @Q7G +WH: +4 h2xW7 ] @+H02+H8؋2RY@rR eK$+H$H<+h$0+h<`+4h4+h +h,+h  +h p+4h.@+H,`J+H! 8+"<H7 69p68 M)4+H: 4C_%:+H? +H-Ѐ 솈 +H+Lf#<W7:!] @+H/3f+H7؊3VRI@sfRU4+H#H6+K$h#0+h6`+h$+h +h1+h  +h p+4h?@K$W@]]@+H.2n+H?؋2nR@rnR%K$+H"H5+h"0+h5`+4h6+h +h.+h  +h p+4h0@QAK$M+W H: +4h"x]@+H-2+H2؊@2R@rRK$+H<H4+h<0+h4`+4h<+h +h/+h  +h p+4uh1@W7!]@+H,3+H(؉242R@rR4+H6H3+K$h60+h3`+h#+h +h0+h  +h p+4Eh2@4 +H? +H.  +H,р#WY7!]-@+H*@2~+H'؈2t41R@rnR@!+"|W6z]@+H+`3+H%؈34/RI@sRU4+H4H:+K$h40+h:`+h&+h +h?+h  +h p+4h8@W@L4+H' J @+H& R+H0  :+H?H "K$44]4]4!K$45P]=4M4+H< 1]E@"WQ6"]%@+H"@4+H#؈`4 4-R@tR4+H=H8+h=0+h8`+K$h(+h +h8+h  +h p+4h:@V@+H( R+H1  :+H7H "K$44]e4+H9`]4+wH9Qi4M"ܠW I6"p]@+H&3n+H"؈@3d4,R@s^R@8+L mK$+H6Ȁ :+H'  "L4+Jh Z4+H( *+H) +4 h)x]@+H%3+4+H!؈ 3R@sR@+H:H7+K$h:0+h7`+4 h*+h +h9+h  +h p+4Eh=@+W H:]@+H'4+H<؋44*RQ@tvRY4 +H9H?+K$h90+h?`+h++h +h:+h  +h p+4 h3@+x#H7K$7"]4 +H3+h +f h `+4 h,+{R 4:.&+WH:]@+H$2+H6؊24)Rq@rRy4 +H8H2+K$h80+h2`+h-+h +h=+h  +h p+4 -h4@VMH: +{ Z 4:]@+X H: A*#WY7#@])@+H#`5+H5؊54(R @uR4+H7H1+K$h70+h1`+h.+h +h3+h  +h p+4h5@+4 h?@+4h0+Veh `+{ Z4:]I@+X %H: A* <W4:#@]a@+H"@4F+H4؊4<4'R @t.R!4+H?H0+K$h?0+h0`+h/+h +h4+h  +h p+4h6@+H!  2K$+h:8+h 0+w` +4 h,+4 Uh7@+wH9Q 4A* |W4z"p]@+H<2+H3؊`24&R 9@rRA4+H2H/+K$h20+h/`+h1+h +h5+h  +h p+4h<@+H(@ VGV@+4h3@+W1H:]@+H! 1+H=؋14%R@qR4+H1H.+K$h10+h.`+h2+h +h6+h  +h p+4uh"@Vu@S@+H6p Z+dP4#N4z+ h p4#4x7] 4]I@+H60+H:؋@04$R@pR 4+H0H-+K$h00+h-`+4h?+h +h<+h  +h p+h#@+wH9Q94N>+H704 204 +H+P 4+"h?V6"p]y@+H5.~+H9؋ .t4#R1@nfR94+H/H,+K$h/0+h,`+4h7+h +h"+h  +h p+h$@+{4:+{ Z!49+`h<HH<H *+{4:+{ R]49M+VH:]@+H4-+H8؋-|4"R@mnR K$+H.H++h.0+h+`+4h8+h +h#+h  +h p+4=h%@+H5 U 6 8CV @C+h? +H$ .+H: ( +H= -!|V%5z$] @+H8.+H0؊.4=R@n~R K$+H)H&+h)0+h&`+4h4+h +h(+h  +h p+4 ah*@+H0 k@K@C K$k@VK@] @+H7-+H/؉-4:Q=@mR AK$+H(H%+h(0+h%`+4h5+h +h)+h  +h p+4 h+@+H# +{H:+~@h#+wH9pQA4PU4+H7 +dPh B!+H* D!+H?H  R+H) :+H, " 44] !4+H8Ȁ J+H3 8+!<H8 459%`] 4 +H9 +H4:+H9 ( 8#+H-+H54XM ZL&!Vm5%]9@+H?,+H.؉+49Q@kRK$+H'H$+h'0+h$`+4h6+h +h*+h  +h p+4 h,@+H6+H/4X Z+`4# xh<H!V5%]@+H1 .6+H,؉.,47Q]@nRa4+H%H"+K$h%0+h"`+h$+h +h,+h  +h p+4h.@+H< +`h<@H:@CE K$h?@V]H:@])@+H0-+H+؉`-4?Q@mR4+H$H<+K$h$0+h<`+h'+h +h-+h  +h p+4h/@+H4.& ph`H+"H7K$6&]i4 ]@+H/-+H1؊ -Qm@mRq4+H#H6+K$h#0+h6`+h(+h +h.+h  +h p+4!h0@"<V6:'X 4+H+`+H)+ iO]9h/`+H! -+H*؉@-Q@mR4 +H<H4+K$h<0+h4`+h*+h +h0+h  +h p+4h2@+{ZH:S@+`.$h<H+`H?H.V'CXI4Z@+`@h<H+4h&+H1 +H7-F"S6% <++h? +4Qh=KU@KU@\e@+4!h<@+H( +H:T53#+4 h+@ˀ+ˀh B:Ϗˀ"+ˀh Ϗˀ+ˀh ϏRQ}@|Rq@ H+4 h=@RQ@|+4h2+4Yh?@Q@|+h 4`74h h R `  h+4 h-@K$+h-8+h 0+w` F7C+H7 k.4 B B-6 @g04c,7.ˀ+ˀh ϏQU@{+h 4`84h84h R`  h+4Ih.@Q@{:+h 4`94h=4h R`  h+4h/@ˀ+ˀh .&ϏQ@z+H, +` 4 `-4 h%ъh*4h4R4 h[+4 h0@VQ@z2+4`44`1Ri4 h +4 )h1@TK$3#+4  h,@Q ]@y+4`54`2R4 h+4 ih2@ˀ+ˀh ϏzQ @yJ+4`64`?R4 h+4 h?@V+H?+H$؀ 4#+H=H +H*H@z+H?X   J+K$h?+ \h X44Y`\4 <HwK$49\4 Q @yQ !<Hw+H3H8+h30+h8`+4K$h4+h +h8+h  +h p+4h5@59\4  hdˀ+ˀh Ϗˀ+ˀh Ϗ +4h0+H1  83+H7  (!V55 Q @xrQ @+H1H.+K$h10+h.`+4h"+h +h5+h  +h p+4h<@ˀ+ˀh 6.ϏB+{SqH: <4# +xh 4K$4 \M4y+@5+4 4 8h*QM@wR+@5+H9VҺBD4+ H84@4\}4+` ˀ ˀj@Ϗ \+x4CPh 4K$4 \4y+@( 8e4Q@x+@4+H9VҚ+BD4=` ׀j ׀׏+{H?2+C2++H$2Y@K$My4I++H1  8+H4  (!ܠV5 Qu@xBQ}4+H-H*+K$h-0+h*`+h'+h +h$+h  +h p+4)h&@׀i׀Lq@K#׏+H/  8O+H9  (/"V6 Q@{Q K$+H#H6+h#0+h6`+4h?+h +h.+h  +h p+4h0@+H.  8w+H8  (W#V7 Q@|JQ K$+H<H4+h<0+h4`+4h8+h +h0+h  +h p+4qh2@׀i׀׏+x"\H7K$6Y"\ 54 +xH2 8B +h +tPA4:+x"H7K$6#\ 4 +q0"<H7 K$69# \ 4 +H.(2 +V 1@+{ ׀i׀׏+H-  8G+H7  ('#<V!7: Q@zQK$+H5H=+h50+h=`+4h:+h +h2+h  +h p+4h7@L׀i`4׀$׏+H$ +{H:+~@h$+wH9pP4P4P4+H# @ 8+H$ +;`?+H2 ;b4_;R4 _;B4 ;2#\V7Z Q@zQ@+H3H9+K$h30+h9`+4h3+h +h7+h  +h p+4uh9@ˀK#ˀi@ϏK#ˀK#ˀi ϏK#+H,  8o+H?  (O"|VY6z Q)@zbQ5@+H:H7+K$h:0+h7`+4h5+h +h9+h  +h p+4h=@K$504 \4wa&+H4`B+H6 *!|45yp5x`L4!`P@V5+H! `04?w7%Q7"3_"7%Qq @ C! 87?7`4@`ڀ`*7%7B=_="7%  C r:7]?ӷ`R4@`B`"7%/_/"7% +!<H7 K$59\4 +H" ;447%Q\7%+K$!<h< 594 \7+H2 @; +h hˀ\K#ˀDiϏ@C'>@+{M4:+"H876&@4[7^}@+H?ȃ>]@+H:@>=@!K?Q45&p[m4 +H* @8K$+`h9@JK$+Jh<(Q.A+4mh3@+{H#4F4yM++H' 8G+H- (' <[4:'  ++dP4#L4z+!h p5'@4x7[4ˀ K#+ˀh ϏK#+H&4h7+`h&H+XEh xX4J@+J h<(+`H2H+H<x+h2+46  . 3 ' 3 . 3 #b 4 #2 " ! # !2k?ok? k?k?k?!+H9 +H:x44 0k?1+h +h +h H+H#P+h#H+H<p+h<h+H? +h? +H&`+h&4#+H"0+H6 H+H?+H8hb+H7+H9hhvx+h? +h8+" h7+h +H?04 +H: W 4Z 4 +H& 4+H'04hw+H?P!+H" !j+H7 !R+x@$ n@% l 84&@ j "4_m44` r :@ h *4_-44` p  #_7'+@?4$2@  "@! 4_4@  @! _4@p@+H3x+x@= +h3 + (h +x@K?!K?K?K? @O?4 24΂ "4悿 4Ƌ;@@  @! _M4@ ;@@! ;@4_4;e@+@<4惙;=@+H&+ h x"J=6'#7(@7 444_m4+H7Ȃ:++H8:+444_4]+4_4+x4 `' v4_U4+x4`& t:"ܠ # !2 " "" " !k?ok9 k9k9k9!k9)k91+@"c94%+H? H+H7c9 |+4x k9A4&h?x4y(_4 h+H3h4$+h x `hIM@@B+H8ȋ)b@4΋ +H?)RH"+H9 B+H: "+H: *+H5H)444w)P_4 K84?H +H8 +t4d744? d74 8g+H8 h gggg+H9 h+HH8 iH J+H) 2+H7p J@@ǼBH"4k?4479FY4y*Ѐ"R+x@< 4  +x@!!)@4抟)+H8P)@+H8+rX4' pX +H8 (+H7h+|4:Pk9I4?k9G79fK9K9IWhH4y*_4H=4?+H? <4?+H: E I7954779 =  (@ 7979 )  7979  I79+H7 J94 +H?$H0I4@4+Z+h'+H7 +K9Ah'4&4y+p_%4 +H7K9A4y+_4 K9A44y+_4H*"+H=*+H6 *+x@! *+J H:hJ4z, xHJ@Ji!=Ji@P @+H7K9A59/1_4 [ @H B+wH:+wIH9J4G@H R+H6  :+H<H "K9A44_ 4+H?h'Xk9XE4HK9+`"h? R+H'  :+H(  "JK9A =J4:/q0h4+H6 %+H&%+H?䅂;E@%jE795<=4@4%K9A4%+H3P+r%"4= +4h<xC4_ 4 4 +4h6xJ4z) K8HK9I4y)_e4H R+H9  :+H4H "444w)_ 4K8K91K9)K9!K9K9K9 @O9?K8+H8 ?K8+H3H`?wK8444w*0_M4=K8K9A44y*`_4 H >K8+H7 >K8+H=H>K8444w*_4K8H7+r4( x @ +H? "+r_4) _ 7 8/+A'8+79E59@44?< X4?+H8C +H879E]59 4y*79E5594y*EU79+H< 0H 4:++x@" l +H?+H?o+:O5:O+=+E79v5779ן43 h}+H"P (+r?44 ? _45 _  0K9AC$ 4w +t48+H8E97<44y*4 _7) 0K?@%+h'pD4Ch7@4? 5? 4 "4D#5? x" 44144_M5+"BigP T4/4?K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? = "6 E40aT5411K?441a_4ϟK>F5:K?7404 _7 +h'p߿4?6PIS`+h'0`0iG`6PF%5:K?7404 _7|6P+=h xi`P<6P4eipP4404 _58-5%4+H7 (414_U4+H+ ( +H? +H< +H,@4BV j+4h44? 4H8+h9 +h'842_e4+H88 ڈ "_E4+h< +H' +4? h 4k +H70 K տ_k 4L K +h%+h0  2K?4421_=4ς5K>+H7pK?42a_4+H<p T42ϟK>+xVIH:+xK?h 442_u4 + h +4h" O@`Z+H#@ 2+H: 8+S=H9 0+h< HˀK>ϟK>_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?oDuk?+H:0@ 7F)@c E6+h<0 rK?B RK?4@777$:@?+H<0 "ݐ6K?Y@O? : 4@ ! &Bk?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7I77'6Dm7K>K>4 4 4 &7f`4 ]4E =4&E9  k?1`K?1K> 5.54 5 F5 R  :ǿ2 5kD   \h7_o45gK?1%+H.4(E5%7I4D } 7D u4 6t 7?!#'7.05&0n7?!#]17Y@ 4 / 0N 1! 'J``4 K` &Q&QG00` 0n&Y&Y 2 1`0n 1FN2;G&HKH0N0&@F@ $5 c+4bk?94.4@5p? "]4I`*4w"7I" a4K?1K?9 44 M 'a: # 4T44P4"6 06<6?"6?4Bb6 0"6b!6 ?"6?3B< 0|"6ti56s?" Xo7 *  L  ~ Iv 7?4 "787??86ZJA4yI46?$`_@ 45}G4K?1 EK?1` E}4zK>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>_7K?1+4(!]5) 8 jI8?5Z4J4I 45m?@"_5@>K?14_ 8mK?1 ! &Bk?o k6 k6k6k6!k6)k61k69k6Ak6Ik6Qk6Yk6ak6ik6qk6y7H7&764 4Bh4`4 !5 !]5GEY  k6`K64 5L K77C7 zD777E5' \H HE9774c mh5_g 4h+H0K6k?445FK64 &Hk6+4)H!E4:&7I84D] 7DE4 7: K 76 "%6/053&`0n76#17` .@0N 1! %J 4`4   %% 00 0n%% 2 1`0n 1FN2;G%K 0N0%F  ($5 b4k64@5? "]4I3`*4"7I9" a4K6K6 44 N (a: $ 4T4TP4"6 06<6?"6?TBb6 0"6b!6 ?"6?SB< 0|"6tj56s?" Xo7 +  M  ~ I6 7?4 "787??86ZJ!4+H546?%`_@"45}?4!J5@4 EU@`:K6c @ E@b_ K6 E K6K6K5K6yK6qK6iK6aK6YK6QK6IK6AK69K61K6)K6!K6K6K6 @O6^4+4)!]77K@C7>45Z477J4I546?@_@ 4_g774uk6!Jy54?k6!ݐ5JA774?k6uk6ek6k?7D%_+ Xh<4?K?Y@7?D4+!h<ϟK?YD_+ h<ϟK?YH?"6DMk?+ h<ϟ-K?YD_+ h<ϟK?YDK?+ h<ϟK?YDK?+ h<ϟK?YDm4+>mh<ϟMK?Y+BH:ˀ%K?Yk?7@ 7Y#7+H:E]4+H?4K?Ych7@7?k?7+H7k? H7?H97?K?Ek?K?K? 8 @K?Y@7?+@?@+@H< # !2k?o+H4k? +_=H:K?+H#!H:#7Pk?7k?4 _E4w#K?K?7p_4 4K?k?7?7?4z]7@+PH#H#+@s`0H# +4E 4y+H7#]b7ZI4yKa?J 4: K>@O? # !2k?7@ 7Y+`H9`+H:E @P@+#H847_]4 K?Y@7?+`h X4?+h +h +o4?h8+H7+h k`kp@kh ! *2k?7+H8 k?_@aZ+H84?  +`h8pX:H3pK6x 7 h8pK?+H54?4H4+H6+H<+H! kkkkPkHk@_kxK?Y@7?#=_57:+ # !2 ! *2k?ok? k?+H?4@04#4?K>K?K? @O?7 =hw49048_54 +4$H!  De4 h $HbH +oH8" : +`HwH H9 pW S y+`HuH H=P5 % 4?HsH H7XԳ  WH}H H8p h8(+HzH Kh  k0HtH K`Դ j8DiH:D7#P7+H9D%4HuH ׵ k@+DH:D=7#7+H9D4HtH t a kEH+H|H ּ h@PDAH:D7"7+H9D4HsH ֓ k%X+DH:D7"h7+H9D}4H}H ֽ k`+DAH:D7"(k?!+H9DK?!HvH K?!Զ kh+D H:D 7!k?)+H9DuK?)HvH K?) jp+_eH:ˀK> _4@HbHuH ׵ HtH t a = kEHϟK>HsH ֓ =uk%XϟK>H}H ֽ =k`ϟuK>HvK?!H Զ =khϟ-K>HvK?)H  >5jpϟK> # !2k?ok?#+7H77k?4#k?_4 H@ ϟK?Y+H7 4$+oh9  K+`h: p+`Kh6PKh<XK(h"pK0h7hK8h8`K@ !JHvH 6 3 KH !HsH s y KX !HyH  HY` "BHH  Jh "H|H < 4 Jyp "4 H}K?7?K?_hwH|K?YK?@O?+H:EHaH  EQJ@H|H   5j`@+H:EHuH U ] EKZHHtH ״ k H+"H:E6H}H ֝ EIJXHzH ֺ kX+"H:E6HxH ט EH:`HwH WA 5k`+"aH:Ey6xHbH  E9JhHaH   jh+#H:E7HvH V S EKpHbH ֢ jpCY7 24@B0_?7Z@ # !2k?ok? k?k?k?!k?)7$7 6 ]4Z =4$+H54P4R444"47?y@4 4k?1744 _7B+H:k?CX ZD@`B+H9 < C? K?6k?CK?!C7?Bh7K> zK?+H7+`k?h?P48P7?4 7bB+H3k?4K?4@_M4 K?4C4`0k?K?_4 CK?!F!K?K?1 |47_4 5""U4K?k?9CH7!x5 }I 4zP5FaK? |4K?17_4 45K>K?)K?!K?K?K? @O?K?1 w4 _u4 K?@ 4?m5]5C7?^}7K?1 w4_4 K?@ 4?5FK?9K?1 |47_}4 55 # !2k?ok? k?k?k?!k?)k?1+7$76 h "}6z #7CW #]7Z 4 t47?Y@d4K?Y7404_7C2K?Y4CV6 ZC@K?Y7? 4 "  K?Y4Ik?Y4K?Y4`_%4 K?Y `4A< J5:\$@"5)A3`?5:4  K?Y+H5+`k?a׷h=P48P7?a47a7+H?k?YC0k?Y4K?Y4_4LK?YC 7CX4aj+H84k?Y4_]4 LK?Y!:K?Y44_4 LK?Y!"K?YC4@ J5K?Ya0K?Y44_4 K?Y u4K>K?1K?)K?!K?K?K? @O?@4I4}4K?YI4U4K?Y44_4 K?Y4 t44`_u4 K?YI44k?7K>k?+H=k?4k?h3k?@k?K?+K>h4@7?k?7K?k?k?k?@`k?K?Y@7?k?7K?K? k?k?k?@k?K?Y@7?k?7k?4k?7?qk?@k?K>@7?k?7K>k?4k?7?qk?@0k?K>@7? # !2k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=7&K= K=K=K=k>97k>A4k>I4k>Qk>k>) k> 4k>9 "]6FK>)+h  4K>)Ab3k>)@K>))"HpB) 6\@(6B ?6HzI40K>*ZHnA*B5\@)r5A?5 Hz04i 4I7 K>!_54 I:  I ?i +H30 I _i HzK I 7$le^IA4K>!k?45_ 7e~HIXI4Ka?J I4: 4B8@74 @H4 |HH _5K>!4 `4 _6_o4"f\J@Z@" ?74I4 K>I2EK>I6 K>1 sHzCR@32\8@K>7 |-jA-Z5\@,5A`?5 HzK>T04i I=  I ׿i +H40 I __i HzKI Hx744_7H\Z@H44_M5K>AP4':K>4@J+H:8ӽY  ҕ 79.Y &Z7H4_ 4LH<ꈀY|@RH7? @8 * 77H  IHH  V 4I44`I6HIp6h6k?7iP7?Hz5P7wC MHzIzC 57H  Ih IyC< K>1C zhHzL@C 7B4w2H4 }HHC "*4II6IZD 6HIp6\K>Ah71ip@H xIbK>k?iP7?Hz5P7{C UHzIzC =7H  Ivh vHzL@C 7B 4zH4 x4_HHxH4T  "4?4Hx_4 5/K>4-i HC4 4H4\Cv *C4^] H6R?h4T"7?4i 7X  H W `7H6 =84k>4@4_M6a*HHh 4`I69Ip"46uip 0tIp"77ip?IpIX4Z?ip44p_m4 HB$4tHH4_%4H wI؂344I44Hx44 _4 K>I: 04 i i +H40 I _i 4HzJI Hx74 47_7H4 4_5WP4B@ 04K>AK>Q4 _e4 *K>AJ +H<( K> (ڊ@+K>)*CK>Q*z K>)IqK>k?iP7?Hz5P Q7eIz zIyC6 K>1 tHzL@C 7B 4eH4 x4 _ 4 K>Q jC5HzD7k>Q%zHyDK>QK>Q44 P_ E4 LHzHx74 p4_ 7<%4LuHz R+H4$HzC4  HzC4 $I! 4 i 4i +H50 I ?_i 4HzJI \h7+*+H70+rK>I D-K>IK>*`6K>) RCK>)DQ7k>I "K>IK>)DK>Ik>) K>)44_ 4 +f04: `k>14DU4+f0` ^+h 4h 4& w+oH04 k>!A47+4'+4(+4)+4*+#4+7k>Y+`4k> 4,+44- k>K>1BT47+4 I K>I DK>I4?6K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=K>I DK>IE6K>I DK>I64 IK>I DK>I64 IK>I DMK>I6 4Hx4 4_6W7@+H! 7@Hx44 @_54 K> 4i 4i I=  I _i +H30 I ?_i HzJeI 7"74 IK>I D K>I6K>QD K>QK>I`<6D eK>I6 @= HD14 A?DK>)A?4^5 HCe4 HCMK>Q4tH44 4 P85_k>)4HhCah7K>! |A4tP ?5K>)@Q >K>)ek>)K> BK>QD K>QK>I D K>I6H 2 4 @4 p@4 IiK>QK>QD K>QK>I D K>IE6@z 4 4 p@4 IK>QK>QD K>QK>I D uK>I6B@JK>QD EK>QK>I96D K>Ie6K>AK>QJW4 _e4 JHz LHz7 J@7Hx4 5_4DMK>Q R JHyIY4 0m6gIeHzM@5u@+H3 H4 ` K>IHyH4 K>I DmK>I6HyH}4 6@RK>I D K>IH HyH4 -6K>I76DK>I6K>!4P4 _5 K>K>1B0 K>1Hm4pK>1h+oB@h K>1BH4bW4H 4K>I DK>I6I؂!44H44K>I DEK>I6H]4 K>I DK>IM6+H!؀ 4H4K>I DK>I6+H=8CKHx44 _5]HH b 4 @4 p@4 H-HK>I DK>I6+H<؀ 4H4K>I DuK>I6 4 4 p@4 HeHK>I D K>IU6H%4K>I DK>I6H4 K>I DK>I6 CyH`j"6@RH7? @8 * W7H  4pHH  H5B5HB4@:H4K>I D]K>I6 ZLIH BHHM4 0K>I DK>I=6H+oh K>Ih  qDK>I6K>9@6:K>9 K>@K> Hu@K>K>I D K>IU64@HK>I DK>I6H HH4+H8HH4Ka?4: IK>I D1K>I}6 4 @4 p@4 HHK>I DK>I6 4 4 p@4 HHK>I DaK>I6K>I D1K>I}6 # !2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y+h  }h 4s7(7K76k?a544)4y@_4 0K?a+f04& `54D4+f0` ^+oH74y`4_4+oH*`0K?aB"4A 47+H=4( 4yH8+oH7_4+4,Ka?4-+hI?H5yI9IH4zI=5 4A ,@7I?I 4y4_4K?a4y4 _5WF_4F$bB@:_ABWBҍO?O4H4z 5\ @ :I؂>44zH444zpHu4B`4i +oh 4BP4cB@5\4B 4}w+H4zO5\I4y4_]4 :4B4@Hu4zO05\I 4 4yI_4!b+H8+`k?Wh:P4y 4_}5W+`H48P7?4 7@ ]H5\+H:Bx4@HE4z@4 ?5\K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?I 4y`I4_=4HC Z4B x4@HE4zO5\HC04 ?4yp4_5W5\H4zO5\Ay :4z0H4zI9 # !2k?ok>k>k>k>k>k>k>k>k>k>k>7G7 k>"}6g #7+f04% `+h 4Da4+oH7 4)+f0` ^4k>4_4 +I"h 4&_!h +`H:h4(C zixHli pHki `Hjxi h7ix4A@7IxHIX ix4`_4K>44 _5wfFf&bbDb#2_?Ix{Cy#څo"m&Ha@I BA4|IxK>44_4K>+` w4(h x+4*H!G] I+b!+4 4-4A<@Ih7 x40H_4m!JG-@I A ?4 ++CH:菂bh+H: z4HxH_U4HcC4z7?`24@ 7 ?+A H:p5|H =4@P5|4 +4,Ka?4-+IxH4@m5|H4 5|IxK>0 e>Hc+H.շk?y4i P4Hx_4 HzK>7?y5P%7}74 ?5|K>YK>K>K>K>K>K>K>K>K>K>K>@O> eB54MhIx @ B4pH 4i 4BhUh+H4؂:?44H44BeIZIZ744D794+H9؀ "4H44 e 4pH5yB5zIi 4h4_4  4@ Hm4 H40HE4HIH%4I5 440H5y}5|k?7K?"}k?6}k?4@k?K?Y@7?k?7K?k?"}k?6}@k?K?Y@7?k?7K?"}k?6}k?4@0k?K?Y@7? # !2k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y7FK=k>7'k>6 k? ]4Qk> "]6K+*xh  H]4544 _4 K> "I؀ 4H44AX@I744_7HI 44_5Wʆ,E† zLL,b,j 7G@+H2 l:04A`@5HHK>4_4 H Aq >?K>4pHm5yA\5z4Ad5zp IHh`4h_u4K> IK>+H/wk?97?9iP5P7oA405oA5oZI7? 4B `4I74@4_u7IK? 4`_M4%K? EzErK> X Kǿ@6k? 4I_4I44_4K? 60A  V 6144_E6I1HD4 8@ǿrK? J9? Z ]D K? 7 X 44_7 X6O61K? 4 Z A 4_-5K> H@K? I! Q C I4` HI  H!@HI+H:CI 7 HhO L I؀ 944H44K> zIK>+H/֗k?97?9iP5PQ7o*4A,5oI7? 4B4/ K>C_/H40I J@@BIWCK> 1)k>_K> ) Z+H, B+H'؀ 4H4IH44?hsK> 'zgp4I4t4z X'2Y'*7  I)ZI؃7?44H 44K? 4 ) P ^YI*K? 6Jj  R 5K? 8 W J_ : 1^4  1^4)5K? K? K=K=Bk> +h 4"k>7h 4%k>44 _57+oH7K>4#4_4 Hp+w4  ` 4A5z@H44?5K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>:04A @7K>44 _]4HwK>40_54 K>4P4 _ 6HK>4p_4 G @+4(#!4 :k>+`73k>4-4 + 74.=k> 5h`H4 hpH B04A5z@HY45 H ]5K>!*IK>+H,+`k?9Wh2P48P7?97@ 5+H844_4 A+w05lI4:D4004A,5@H45K>9K>I 4^Au8K> B+H)؀ 4Hi4IHQ4 4?mh| I7? 4A44@(77M@@;5K? 4  S ]-K 4hx 4hK? c M Jmh4? Xhv+H?؀ 4H4IH4P5544_ A(@5Hy" K> 4?uhb4?]hvH4E555H45 z Z+H+ B+H&؀ 4H4IHi404?huK? K>  T Jw4p_ 4 K? 4 Z \ ]uJ5K? UK? Z+H* B+H%؀ 4Hq4IHY44?uhtk? K? K> WH  `  H K]m4 *4H 44 t(`4pH 44@`4 K?  X ]Iz 4 hx4K? J J JA hK> K? 4 s P ]MKZ j+`H7p4t6?h&p4h"p4 H9p H4phh4`+H8h4h`4_u4 -55H 454? hho+H= J+H:؀ 4H a4H Q4}5m5K>H 4`I44_e4K>K>Ik?4k?4k?]e4 `"+H/ Ѕ H q4IB jB 2K>4 C/H )8HB@"]UK>4PH 7H+H8H 4Ka?H%4: 44H 64?haCS| R+H9C=ӿ *7W8 ?804@ # !2+H59H39 k?k?ok< k<k<k4C4  4@k;Cљ-rN4 L@77444_M7@4V? 4 Z?8Z0Z4 4A?4 Z *$5)A?@?@4|   ? _Cu42C> 4`c>7>c>7>k=7>k=k=c>c>k=K=AT5Z<:K=A45: Z+w44:4A59|77=k\7A_ K< <A40BU7>Q   F B-7>Q7>AB4k;74 44_-74n@D.z@D.Z@Dq.:@DQ.@D1:-@ DZ-@ D-@D-@,4"!@D @Dq: @DQZ @D1 @D r@ D R@4t :@ *@,*4Z,4, 4!P44_ 4w@4c>7>@k=7>c>7>@k@c>c>@c>@ c>c>@ c>@c>c>A 2_ *4 ^_ 4 \ 4" "A " 5A?@444 _ =5444 _ 58+H8+w4+@7?5zA59a7K?4 s V v 4_ 5WFF%bBB"2 &L 7>A7B4A !c>Q7>SB5rLҏLA5:, UkQB540B )474P44_ E7k; K  7>A7B 4A "c>Q7>SB u57>QB U40B I474p44_e75k;Nx@C7c?17?1Cc?3Cc?5Cc?9c?7Cc?QC c?UD c?S7D q7?Q 7<8#'!D7/88'1EN0N 01! ') 9G)'1E1 ` 67?4 7>Ak?4B4A "c>Q7>SB 557>QB 40B 47444_%7k;N8@C7c?17?1Cc?3Cc?5@c?9D qc?7 7>A44Bm4A "c>Q7>SB 57>QB 40B47444_7k;4|4 C4A7  : 2? *4^_ 4 \ 4 Np@7B7>A40B7>Q   F B7>Q7>AB5:74 458_75&ek;4 @C4R7  B :? 24^? "4 \ 4 14 K47B7>A40Bu7>Q   F BM7>Q7>AB9474 `44_U7%k;40B]4+w4:B44 44_4w4|+w4:Be44!44_4w4|K;@k=k=4@% 47=4 Z4 ^4 \4 4t4444€ "_   $@ "A$mk= "5A?5k=$-@$@4 ' 5Ak=@?@4!54_4?4|K<#@$WK=4" 44 _q4?}4|4!44 _94?E4|4!44 _4? 4|4"P44 _4?4|4"44 _4?4|DA5Z7D)5:SU@SE@ k<54|4"44 _4?4|4"44 _4?4|4#44 _4?4|K<+wk?4:4#B14`E4|K K?+H'+`k?h?P48P7?y7`@404@<4`z+H:k?4_QK?@7 K?1G4(Q84(4 G}4(4?4K>K?)K?!K?K?K? @O?+w45 uk?ok?k?k?+H<X7D 4#+H!Ѐ +H94``4&HwX  "C@HxX  @4H_HwXCHzXh`X+h$4?huh4%`hu`4 B@h|X H4`2H}X 7HH}X+4h#4K?YK?K?K?@O?ςK?Y+H7؂ 2+H8Ѓ +h x4h?p@k?ok?+H#hk?``P4$HX  "K?4C )4 2_HX4K?YK?@O?HX k?ok? 7C+H#AM4z+H6k? b+H?``BO@ *"46(4G4xO@ +H<p!+H!؀ !+H?A+4$H!x !K?AH`7?hp`HXKZ C@HX 4H``BHX77 ? 6H`HX6?h`+H`H=7\h``0hh ^4Z(G1@pK?YK?BI6HhHX HXHh S @ B4yK?YK?@O? # !2k?ok? k?k?k?!k?)k?1k?9k?A +o4 ~k?Q4$H74y(_U4 +H844y)_%4 +K?Qh 4h @4'H4"!(+4(Ka?4)+4*4@@H7@ f RbAb!"@2{@y o jG4 5| BAG4z)QHIGa4H5: H?4+_uH:4 5|K>K?AK?9K?1K?)K?!K?K?K? @O?_gHHЃ *u}5|HЃ@ u]5|+H9GI4z)!o-5|>@IX؃>H4G4H+H9G4z)!o5|K?K?K?K?K?yK?qYXWSk_ k](kT0kU8@kV@ # !2k?ok>k>k>k>k>k>k>k>k>k>k>k>+`H+p4*+w4(4 ? + 4- " 6h +4%+o4$+4.k>+7C4 4/4 ސ4*_4 HyG4+1K>4+4 _E57HK>4+_4 HPK>4+_4 HHK>4+_4 H@K>4+_4 ?CjHc@h`$hЅ= 5 / ;$I 0iKpiK`iKh%hHP%:4p`HyHw0] 7?qK>74*4 _7EK>HuH}0H(HzHyk?7?qk?7?ik?]k?K>74*!4 _7K?iK>4*A_4 }K>7?qiHzHy^Hw0K>74*a4 _}7 K>HyHw0^ 7?qK>74*4 _7K>Ht0Hs(Hz8Hy HxHwk?k?^ mk?K>74*4 _7K>_@K>74*4 _=7K>Hu  K?q Ha 0 K?i 4,H|I HK>i _4 HPh+H8h4,A_M4HP K>h4,qHw_ 4 Hcl z+_eH:`5<K>4,4 _575 4 ?+H9G 4,5<K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>/?5<M+HH 4~ `H@ 46`4)K>h4 hk?qk?i_MHwHw옟K><@Hv;HzHi :GH| 9Hzi 7?iHa0HzHyk?]4i 7K>4)4 _]7K> # !2k?7+o#>#H779-7_4 +`H=X :+oH?h +`h? p+`4h:X4K?Y@7? # !2k?7+H8+o#>H779-!_4 +`H:X47@ :+H?jX+`H7 p+oh7K?Y@7? # !2 5 # # ,k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H1k?)4k?4k?!k?1k?94Pk? 4R k?4/4_67Ih+wH88_: @/hi4.IW K?_54 @ IZ K?74.4 _7K?4.4 _6I]  ?o fIs`&+H4 &/>4.: 4&rA n/2H&rK?h44/_44..>4.>4.4_4IsA nh .HK?44/!_u44. @>JAiH>2Hh^+H:؀45:G4HH2 QK?440q_67K?/: 4/Hup4k?6hypHpK?42 " H 4k?8/@44v7 4F8/H/H/Hyp4k?! K?) 4z9 4t: H}p7hxp @5:G9I]  Ka?G-4: HwhK? BU%K?9%K? 5 K?97k?9K?6 :HK?97?k?9 H7?h4 :  @4: zHpK?!27?hapHpK?!7?k?!7h4h|hh|pH/:8Hrh4~3 :H * "N @ Hȋ$r46?3$+H4؀05:G4H54.54$<8Hqp42 GAHH!? Z@5:4 H4G"_?Ka?G%4: H65? (hIs +H!  A! BQ: *i4+h 7?)+H8 hȀ ` iҎ?:'+Ka?H7K?40Q_4 Ka?H< K?14BHnxk?1ϙK>Y@AHȃ <4~Hzp4X7Vhvp]Hqp HXHh 9ZK?:HȈ::Hap46 hvpHtpHzhht`@p4j`+oh 4 hHzp @K?! @4HspHzh@hs`nhP4h4041_4 +oς0h'5:F]9Hsp4`@PHzhnZhH+o4φh#H}p4@HzhnZh@+o4τhh94k? 4k?+H+h P4$h H h @hh!=@58 ސk?4_M4-AK?K?)4-a_%4 +`H?X4#!Hz`+hzh4H84%4.!_4 Hxp44.A_4 Hxh44.a_m4 HHp7 _B+4*+4++4,+x4-4@44hCұ 4K?H2_4.@ +H9 0 2/4.4.Hxh44-_E4 H|h4@7hghC *Hvh6hehB?HvhHzh@4@Fe4-ϏK>Y+!H:Hyh4%B5AH`ZH7?  : @"H7? ? Hh`X+`H7 p+oh74-_4+oH<ύK>Y1u@hi444/Q_-44]IsK?h44/q_ 4IsA n BH 8K?44/_ 4(4K?44/_ ]4hK?440_ %67+H6 6GIs+H< 6'IsϙHK>Y+]h'+H2Hh + 4h20+`#4? @40!40A67_ 4ϙK>YK?04K?442_ 67k?q44~Q1r4?1bHȀ1RK?442_ ]67Hsp46hpy@ h20'4v @464v1K? .0-@H}pK?7hwp404 _ 6 :5:F9IZ  Ka?Ge4: HHh$7huhF40A yHzhHxh407_ 4Ϗ(K>YFU40A !HzhHxh407_ m4ϏK>YHHwpWB? ҟ 46?hwp41!BK?_Hzp@Hwp"B???4 WB?H6X B? Ha 40h0Z4K? 84K?4114 _6W@/HHȃ@/'4~HpK? C? 27h|pH7h7?h|pHrp@HHpW  4+H7؀ 5:F}443!Fe7+o4?h(4?K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>CK? b K?9@>HHupHzhhu`@ x4[@`+oh ˀhAHzhHxh41Q7_=4F41ϏK>YAHzhHxh417_4F42Ϗ=K>YAAHzhHxh4217_4F-42aϏK>Y0 4,o4*HrpH_@p@HppK? 6?hspB K?96?k?9K? K?961k?9 HthK? B_ K?9 bXh+H3؀ 5:F 4\M@+H5Hbp @HphH}pH+o4?ϟ5h'HlpH5?Hhup@@Hlp HjpH5X?jhxp\e4?+H.+o 4?Hrp@h0ehHpH+H8؀ 5:F ]4\ @+H?+o4?Hvp4?h:7?hpC4 `)`ZC4r` 4 @*4` 4 x@ 4@4r444 4 4 `@@H|pHspH6?hpCy_@CX` X_u@` 8_]@_M@ 4 `4 4 `` `z` `j@b@ @HvpH}pH7?hpCҘ?m@h7hap+o4?ϟEh&Hȃ)@+H"؀!+H2a4 7 $!rHhaHX+H=؃7H5:F4H7?hhHXHh4  HqpH6'?:Hhgp@ @Hbp @HnpH5?Nh}pHXHhA HHF42Hh7?hh+o4?ϟmh%'@+H3؂`'@+H4G@<'@HhH`6`B+H9؃ 5?H5:F4HHXhh @&HX@%H&HXHhH`6Fhh+H8؃4H5:F=4]HHppH6?Hhbp@ @Hap HmpH5?MhypHXHhAu HHF}42+o4?ϟh$+H7؂3oH5:F%4EHh 4@:xK?4K?42_67 :@6YH434_67K?0h@2wH42gHHyp76hvp51CU4 +H=4?+`H8p b7Y?7h3p7"8 "KH8p ?+`H9p4@7:h:p=H4pH3p@h3`k?ok? k?k?k?!k?)+H87H7#4P4R44+h 4&+H'@5 A4AB H4A5b ` @57?@"4@   _  7 4@A t5A?t 44z4t548686?@4  b rd  b3 Z R J_4"H6hB3t?E@ HK>K?)K?!K?K?K? @O?ϟK>ي?O_k?o 4K?Y@O?7C BE " b?? ςK?YˀK?Y@0@K?@ @ # !2k?7+@? +H3 0 #73q73_4+H?@7` !4~ @k?K?H46?h=`H97:h:C7+H6 +H<  +H" @_oKa?+H! :P4F@76K?Y@7?F4:6 # #2k?7_@K?Y@7?k?7"6YFy7K?Y@7?k?7+H? K?Y@7?"F 63K?Yk?o+H?7C #7k? K?F4K?Fq4@K?FY44@?@ 4 _H4K?F+Fy+H= Ka?G94: K?Y@O?+`@H<`k?ok? k?k?7CKD4r 64 @4җ 4@4W4 44 ! 5@pҺa87 ?@Ha*4ӗ( \ϟXK>ϟHK>4x@44?4 4ނ!"4ȃW?44>4 4w 4?o46?ҟU@ϟK>4?ϟ` v4? |ϟHK>4? "@43 W4 dK>K?K?K? @O?44n4@4Z!44`:@_@4`7?A47&&@8G&F z@ h4K?1K?)K?!K?K?K? @O?ϛK>ِ  Ww }K ϝeK>ϟUK>k?ok? k?k?k?!7k?96 k?1@K?9 7b`ʀ`p4K?1 @E@ * K?94A4 r4 4?K>K?!K?K?K? @O?ϛK>ϛK>K?1  X uK<+h:@4+@H<_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?ok? k?k?k?!k?)BI4@J+H?@2+H7@+h?+h7+H9+H? +| #k?4: 7 ]4p!74F )k?1+r4% +}@4&+4'4?  rF 4 F 4F K?1H4c6?x@_@ "4m4ςK>ˀK>و@ ˅xK>^@@R+r43 e F 4 +}@44 F 4 4K>K?)K?!K?K?K? @O?k?ok? k?k?k?!k?)k?1k?9k?A#+7 k?Q4 H7 ]i7?4C84K?C_#r4K?@m@CF q4 ϏK>C:E#44BBi@`J+H?`2+H7`+h?+h7F4Ѐ 4+w4!H"@I +w4)+4* (FQ4IT46?@_P@"4 B? ( F4 p4!2A*+r4( +}`4)p+{ 4* +4 k?Y4+   % "R E 4 !йK?YK?QF @F4 4Ix  7]?@_@!44/  4K>K?AK?9K?1K?)K?!K?K?K? @O?@4 Ѐ K?@y4  *4K?QF9@  F!4 0 % F 4 PIx E 4 =йK?Yˀ=K> # !2 "0 (k?ok? 7D#^7X ik?4y 4 _4\R_4?#7$ ^ m@|7+H$'H+H9@ *4:!Fk?k?+H:+H9k?4UH4Ȝp4+H?-z^ @[07+#H9F70++w@4:Ȝ4+w@h4:Ȝ4+w@@4:Ȝ4@4z Ȝh4@4z ȜH4@`4z Ȝ(4+@8H:@Ȝ4@4z `Ȝ4+x@p4:2Ȝ4+x@H4:9Ȝ4@4zȜp4+x@4:8Q+H8 @44 x4z ҹ4wp+|4" X F@Ȁ4+w@`4: `Ȝ4@4zȜ4+w@4: Ȝ`4+w@4:0Ȝ84@P4zȜ4+x@4:>Ȝ4+w@4: Ȝ4@4z Ȝ4@4z Ȝ4+w@4:`Ȝ`4+w@4:Ȝ84+x@4:Ȝ4@(4zȜ4@4zȜ4@4zpȜ4+w@@4:pȜ4@4z`Ȝh4@4zȜH4@`4z`Ȝ(4@@4zȜ4+w@4:`Ȝ4@4z Ȝ4@4zȜ4@4z0Ȝ4+w@4:ȜX4+x@4:6Ȝ04+x@4:8!Ȝ4@ 4zȜ4@4z Ȝ4@4z!Ȝ4 JH9@4Z"EM@+x@4:PȜX4"@h6"Ȝ04+w@4:Ȝ4+w@4:@Ȝ4+x@p4:PȜ4+x@H4:91Ȝ4#@7#AȜh4+w@4: Ȝ@4#*@P7:$Ȝ4+x@4:4Ȝ4+x@4:3Ȝ4#@7%QȜ4+x@04:+Ȝx4+x@4:*ȜP4# @`7%Ȝ(4+w@4: Ȝ4"@6&Ȝ4#J@7Z'QȜ4+x@@4:Ȝ4+w@4:@Ȝ`4+w@4:Ȝ84#@H7'Ȝ4 j@ 4z)QȜ4"@6*Ȝ4"@6+Ȝ4 J4Z,1@@Ȝh4+x@4:+QȜ@4+H9@+H= +|K?#k?4: ]7-!@47Ȝ4 j@4z-AȜ4+x@04:-QȜx4#*@7:.ȜP4+@`H:8Ȝ(4+@8H:0Ȝ4+@H:(Ȝ4+@H: Ȝ4 *@4:/aȜ4+H9h+H? +|K? k?4:0])40AK? jk?4y0a4 _7@K?Ȝ4+w@h4:Ȝ4"@ 60Ȝ4"@ 62aȜ`4"@ p63QȜ84"j@ H6z3Ȝ4# @ 74Ȝ4#@ 76Ȝ4+w@ P4: Ȝ4+w@ (4: 0Ȝp4 J4Z7a@ x@Ȝ@4+w@ 4:0Ȝ4+x@ 4:3!Ȝ4+w@ 4:Ȝ4+w@ X4:`Ȝ4+w@ 04:Ȝx4 @ 4:ȜP4+w@ 4:PȜ(4#J@ 87Z:Ȝ4+w@ 4:Ȝ4"j@ 6z:Ȝ4+w@ @4:@Ȝ4+w@ 4:PȜ`4#@ p7;Ȝ84 *@ H4:Ȝ 4"@ 06?1Ȝ4"j@ 6z?Ȝ4# @7 Ȝ4#@7`Ȝ4#J@7ZȜX4#*@h7:Ȝ04+H9 0+H7 +zk? jK?4:] 4x@7Ȝ4_@Ȝ4_@Ȝx4#@7ȜP4"@`6 Ȝ(4#@87Ȝ4+x@4:*qȜ4 @4Ȝ4 j@4z Ȝ4 J4Z @@ȜX4#@h7 Ȝ04 *@@4: Ȝ4"@6 Ȝ4#J@7Z Ȝ4#*@7: Ȝ4+x@ 4:>AȜh4# @x7 0Ȝ@4"@P6 Ȝ4+x@4:<Ȝ4+x@4:<Ȝ4+x@X4::Ȝ4"@6Ȝx4"@6ȜP4"@`6pȜ(4"j@86zȜ4#@7 Ȝ4#@7Ȝ4#J@7ZȜ4#*@7: Ȝ`4# @p7pȜ84"@H6Ȝ4"@ 6 Ȝ4#@7pȜ4"@6Ȝ4#@70Ȝp4"j@6zȜH4 @X4Ȝ 4 j@04z0Ȝ4 J4Z@@Ȝ4 *@4:Ȝ4+x@04:Ȝx4^@AP7+_mH:+H? 6??C64@ B78?+H?79?Z???:C!4@7 "79?C<?79?C84@ 79C7?79"E60+h x44K>K? @O?k?7^k?`K?Y@7?#K?EE7 ˀK?Y "0 (k?ok? k?k?^ i7FBbA@`J+H?`2+H7`+h?+h7 i4zE]k?!H4C:!+4%4 E 4z_ 4`4P7? 8 707__8 `z  8 6407507307`076H 7?@2 B ^@ j4 @"@> EK?!4K>K?K?K? @O?ˀK>k?7[ 07_+x_4:*AK?Y@7?@ ˟K?Y^ 9k?_K?7?4?#7 X +x_=4:]K?Y+x_4:5K?Y+x_4: K?Y+x_4:`K?Y+x_4:K?Y N4ZP_@K?Y+x_E4:eK?Y#_70=K?Y+x_4:K?Y+x_4:)K?Y"_%6 K?Y+x_}4:)!K?Y#_7uK?Y#N_7Z@MK?Y+w_4:%K?Y ._]4:K?Y"_56K?Y+x_4:K?Y+x_e4:0K?Y#._7:]K?Y#_7 5K?Y+x_4:@ K?Y+w_4:K?Y+w_4:K?Y+w_u4:K?Y+w_M4:0mK?Y+w_%4:pEK?Y+x_4:K?Y+x_4:K?Y+x_4:0K?Y+x_4:K?Y+x_]4:)}K?Y"_6"UK?Y+"oH9`E6z#+H4P Z+#H9`E7$ O4Z$E@#E7&!"E6&#Eq7'Q#)EY7:ˀ]K?Y+x_4:5K?Y+w_4:$ K?Y+x_4:K?Y+x_4:`K?Y"o_6z'K?Y+x_M4:(mK?Y /_4:(EK?Y"_}6)K?Y#_U7+qK?Y+x_4: K?Y+x_4: pK?Y+x_]4:}K?Y+w_54:pUK?Y+x_ 4:-K?Y+x_4:PK?Y+x_4:K?Y"_6,K?Y+x_m4:K?Y+x_E4:eK?Y+x_4:@=K?Y#_u7.1K?Y+x_4:@K?Y#O_%7Z/K?Y#/_7:0K?Y#_71quK?Y"_62MK?Y+x_4:%K?Y#_]73K?Y"_564K?Y+x_4:K?Y"_66!K?Y"_67q]K?Y"o_6z8A5K?Y O4Z9_e@K?Y#_=7;1K?Y /_4:<K?Y#_7>K?Y+w_E4: eK?Y+#OH9E)7Z?ˀ-K?Yk?ok?[ `7C oE4z?E4z@E4z4K?YK?@O?@ ˃K?Y]@_K?Y I4ZE1k?4`C4?#7  44 w 4P4`#>79 E@ 4p4444Ea@K?4 } 44`#7 E@4 44444E@E4K? oEy4z@Ei4zK? oEA4zE14z K? oE 4zE4zPK? oE4z`E4zK? oE4z 0E4z K? oEa4z EQ4z pK? oE)4z E4z PpK? oE4z E4z 8K? oE4z E4z K? oE4zPEq4zK? oEI4zE94zpK? oE4zE4zXK?`04 E4@| 44@4E@ K? oEa4zpEQ4z K? oE)4z0E4z pK? oE4z@E4z` 8K? oE4zE4z K? oE4zEq4z K? oEI4z`E94z K? oE4zpE4z XK? oE4z E4z K? oE4zpE4z K? oEi4zPEY4z K? oE14zE!4z xK? oE4zE4z @K? oE4z PE4z K? oE4z!0Ey4z! K? `0V4#a` V4#qE14"A4Xt 4#4$ ~4y0E @ @K? E 4$4Z4%u #7@7E y@ K? pE Q4z&1E A4z&E 14z'a K? pE 4z'E 4z(! PK? pE 4z(E 4z( K? pE 4z)1E 4z)qK? pE a4z)E Q4z*!K? pE )4z*E 4z+pK? pE 4z+E 4z,8K? pE 4z,E 4z-K? pE 4z-qE q4z.!K? pE I4z.E 94z/aK? pE 4z0E 4z0XK? pE 4z11E 4z1 K? pE 4z2E 4z2K? pE i4z2E Y4z41K? pE 14z4E !4z6!xK? pE 4z7!E 4z8@K? pE 4z9E 4z:!K? pE 4z;!E y4z;K? pE Q4z<E A4zQxK? pE4z>E4z@+H$(+o4%p4@4?K2YK2K2K2K2K2K2K2K2K2K2K2K2K2K2K2@O2`:73Q `@ @1 `_ `K3!D=5! ϏK2YK39D5!PϏK2YD5!`:73Q `@ @ `_ `ϏuK2Y # ,k?o qc>+H7 c?4yk>4z"c?Q[7>!BA_K>4@AK>_E7>+H7 K>4z [e7> ʀAj_5K>4@AK>_7?+H7 K>4z#[7> R@_K>4@A8K>_U7?Q]Q@@+4: 0@7>+7?@4: (+4: @i7?Q+H? 0+h  4+h7 4K>Y@O>4z"D4@ϏK>Y4z"D4@ϏK>Y4z"D4@Ϗ}K>Yk?ok? +H9h+H? +y qk?4:k?4x\ I4w0`7 B+H8 4z#k?4y#P7?[4@Z])@@BD4+K?h<p+h9h4K>K? @O?k?ok? k?k?k?!k?)k?1k?9k?A+7DH:48k?Q+}7#4:pk?Y4ZEkZ4+H:Ze4%+|4&+!14'+z4(5?k?a+57#44*Hk?iHxk?4 \ 67 @*y ʍ{  5:#K?i]5d7``Z uK?YK?Q+h94K>K?AK?9K?1K?)K?!K?K?K? @O?ȋm@K?aD@ZHZ54`>K?aIY k?5 \ y6|@Ku0aKs0i k?k?ok? k?k?+H? +H9X+y q4d4%k?44\4C+t4&+H9_ H]@C_HH44y @97!z_HH44y@7" +HH8X7?^4K?7  Z 4y$4_P7+H6X"K? 4d$0 ] 4z%D 4(+H?4% +H:!r+H8 !ZD u4z$HH+H&X H+H44% 4d$04z$D 4HHH74% "+H9  D 4z$@H+|h<x+H%X>+H34% 4z$+H< 4d$0D %4H+hh<x B+H!  *K?4z%0 B D @+h<xK>K?K?K? @O? $ / # ' $ &Rk?ok>k>k>k>k> q+4xH7k>4y%p_4 +b@6 K>4y%_4 K>+4y%H7k>_h4 +b@$ $+H"Ј +H%$+b4y%4# 44 _4xH4zJ 77?A74>_%4Hd4 `7 `@54z B  4z@ H 4z@ 4t w4 w  @  S 4@e T 4@5  7>#7`' ' 8G'F t K>4&!4 _4@_M4744&A4 _74&a4K4z4z4K444&q4 _ 4x+H<Ѐ 4EQ4y+H7K>K>_4 +H!!"4k?4&444_ 4y+H774&4x_044&44_4+H?` b`Z+b4# 44'4 _4xK>4'14xD U4+b` K>YK>K>K>K>K>@O> $ /k?o k5 k5k5k5!+H: J"rD6z'QK4K5!K5K5K5 @O5+b@9  "#D=7'K4+b7549 4"_4z+bc649 4_77774>4Q76qH 4zJk5I76174>_M4H <4k5Q4z `@ ` Z ֟k5a@ 4z E K5a 4z@ % 4t }4 } k5Y @ M  Y  ֧k5i@ 4 AK5i B 4@ K5IK5Q75Q 4p$@'K5Y8G'F  x _@4_@7 4'D1k5A4'D4yK6yD4'K6D4(K6 4476 C? !R4 4 4_ Da4)1 ? 04)q4)AD!44)D 4)DK5AUK479D4(Am 79D4(qE 79D4( 79DY4( 79D14) +H5;aH3;i k? $ /k?ok? _}@J@k?1+b4: k?4_7_K?+s4:k?_7+d`4:k?!_7+|4:Pk?)_  7:@z 4`zK?} Jdk?9K?!K?)K?9K?k? rk?4y)_-7(K? rK?1_4y*!K?44y*Q_ 4 K>K? @O? $ /k?ok? k?k?_M rJ4d*q+b4: k?A4k?!_u7_K?!+H? 7 04d*+s4:_k?)+d`4:k?1_Y7+|4:Pk?9_1  _4 7:@ E 4`zK?!k? Jk?IK?9K?1K?IK?)k?4y*k?_7 K?!K?A_4y*K?!44y*_4 K>K?K?K? @O? $ )k?77?#k?+7H7 7?[ }7`K?Y@7?WxK?K?k?_M7#2K?479+!_4 +4ςmh:x $ ) $ (k?ok?k?+#h: (7D r74y+14 4_4+H74y+Q4 _4c+H? +H? (+}46 4y+q44 _(4#H4+ h9x4 H4 +h3p+HE04h?+h:h+Hh8@+Hh=8+Hph4P+H:@$+H:+@$h +H:+@$h +H:+@$h +H:p+@$h +H:h+@$h p+H:`+@$h h+H:X+@$h `+H:@+@$h X+H:8+@$h @+H:0+@$h 8+H:(+@$h 0+H: +@$h (+H:+@$h  +H:x+@$xh +h x+H9 ` ] X@K?YK?K?@O?+H? (`"D@4z+D17+H7=+<+H0_4:+HH_4:+HP_m4:+HX_M4:+H_-4:p+H_ 4:h+H_4:`+H_4:X+Hx_4:@+H_4:8+H_m4:0+H_M4:(+H_-4: +H_ 4:+4:x_4y+e+_@+_@ +_@+_}@+_]@%+_=@-+_@5+_@=+_@E+_@M+_@U+_}@]+_]@e+_=@m+_@u+k?ok>k>k>k>k>k>+k?7?)H4k?q+k?4%H: +y47k? k?y4 rk?4x,Q4 7>\4k?+k?4 H<k?q+}k?4(H k?y5:k?4\4\7>ዀcH7+wH3H?(i&7?4?#7 4 +y4'+44(H Ik?44x,[4c"?F\E@e+H7 `+h&84y-4 ^4+H7 h4y-A4 ^l4+H6 ` ]@+H7 h4y-a4^4 04+h<+4ςh%x\@d+H3+#Xh Ph'\@dR+h#+4ς(h&x\@d  W+ h5@4 0h)@+4ςh$x\@c+h#+4ςph"x  +H9D )4z,qˇ8K>YH +yk?4: 4x,4[ 4~u7˃K>Y<@K>Y+H:P+H H9H+tH8k?[}4~-7 D!4z-˄0K>Y@4K>YH +H9k?4x-4[5@7˄K>Y+H=ȋ<@H +H9k?4x-4w.[e5|}7ˇ0K>Yh _4+4ςh#x+4:x_}4y.!K>Y_ @K>Y+X4:K>YH +yk?4:4 4[U4|u7˃ K>YD4z.a4?K>YK>K>K>K>K>K>@O>\ @K>Y+wH:(+_=h +4ςUh'x+H5Z 4`I 78[ I4k8`rK8@ b_ @@J_ 77  \_K84_E@K8>4jf'f+dH)+X 4: +4 ςh)xH +yk?4:4w 4[y4k8~K8+d`#H: 4$)71 71H +yk?4:4w 4[4~k8-:+"4:_565AK7# r744z!6>6>16=78e KH J4H 5ZM78k8`rK8@ b^ @@J_ 77  ^K84f%@K8 e,+ H'h$`h4+y4(+y4)788 '  _ G 4@k8`:78ᔄ h@ _@_ hXK8+#24:_79>(K7+H9h+H4 k?4 ?+y4k84:40[y4@7˃K7ـ Z+H? +H9`+yk?4:4@[4D(k8\ 1@k8dK8@ +h?+h#+4ςh"x+H6 +z#k?4: 77[14h}7˃PK7ـ`:79Qc @ _=@b_ K8+W4: +h<x+W4:K7+#H3 7?#k?778Y4+#K84:7W7K7+#44@4(74 j7:qi  44h$444 ^4`4+y4) +y4*7:qf H g _! G G 44 ^4@4_ ' ' 4 4 ^P44]@k8`:7:q h@ _i@_ h K8!C5P4?K7K8IK8AK89K81K8)K8!K8K8K8 @O8#Q+ r7YH7 4z/Z78@k8?OK7^}K87k8`jK84C4 J4? 4 * @4?K84k8Gg+4k8`ZK84J4  7 ) 7k8 &+4z0C4JϏK7+H= r"qk?6y#P4z0q78Y4}K7+H? 4z0k?4y178Y4}GK7\A@}'K7K8+K8h%+h7+H, Rk?4Z1!4Y178Y4+K84:P7W,4\oK7+H?P|OK7+-h H +yk?4:4w 4Z4k8{K7هK@+_+K++#4:_75uK7+ 4#4:_48k8{/K7Hz؃@-@\@-@Cq48Hv4PBw CA49!Hu49aB@0^C@Hzؓ@ _@ϏMh`+ 4#4:_q49k8zK7HzЃ@0W+\@- CQ49H|4VC C!4:1HzГ@ _@Ϗ]h`+H'\Q@k8y/K744``k8+y4)+y4*8 H ( _45@2_++Mh$+t^ H:+tH&k8\Q@k8x/K7+K8_4:+4ςh5x+H)\@k8wK744 ``k8+y4+ +y4,8  j _Y45JI@5++h$444 ^ 4wKu0Ks0 k?k?ok? k?k?k?!M d rC4z'+H? (R+}44 1+H9x4z 0HC@Cq4z+H?p1CI4z(4z0^H4 +H:p4@0HE @H7?@\ @624+H=h4z @4TCy4+H:h@0HE l@H4?@\ T@54+H3`4z ` @4TC4+H:`@0HE @H4G?@\ @54+H4X4z 0 @4TC)4+H:X@0HE @H4"?G`\ @4j4+H6H4z p @4TC4+H:P4@0HE l@H4=?@\ T@34+H5H4z @4TC4+H:H4@0HE @H7?&`\ @3*4+H<4z @4TC!4+H:@0HE @H6?@\@24+H!4z 0 @4TCy4+H:@0HEl@H6?@\T@14+H"4z p@ @4TC4+H:@0HE@H6?@\@1b4+H'4z @4TC)4+H:@0HE@H6t?@\@04+H?4z @4TC4+H:@0HEt@H7?@\\@024+H7@4z 0 @4TC4+H:@@0HxE@H7]?@\@/4+H884z p @4TC14+H:8@0HE$@H7:?@\ @/4+H=04z @4TC4+H:0@0HE|@H7?@\d@.j4+H3(4z ` @4TC4+H:(@0HE@H6?@\@-4+H44z 0 @4TC94+H:@0HE,@H7?@\@-:4+H5 4z p @4TC 4+H: @0HE@H4?@\l@,4+H64z @4TC 4+H:@0HE@H4G?@\@, 4+H<4z @4TC A@+H:ؓ@0HE4@H47?u@\@+jC 4z04K>K?!K?K?K? @O?EǥFDžFeF2EFJ%FbFzF4zC )@+H9@` H FrC 4zP+H3x4z&` X4 C @+H%P4z@0HpC q4Х_4 4zC 94C )4z+H844y ]4 +H54z@ @4TC 4+H:@0H0E@+H64z @4TC I4+H:@0HHE8@+H:+@ &4(H947:?@ 4%\@&4+H?4z @4TCa4+H:@0HPEP@H7?@\8@&R4+H74z @4TC4+H:@0HXE@H6?@\@%4+H8p4z @ @4TC@+H8p4y .44x ]4 +4FRC 4@4zC74 Ca4z@4z0 C94z4z0C4z4z0C@+H%8:]@H:E@C4zpu4zC4z@Cy4zǥ@CY4zDž@C94ze@C4zEٵ@C4z%ٝ@C4zم@C4zw4zC4zU4zCy4zp+4CQ@+H<p4zЀ 4 @4C @+H44z 4 @4C@+H!4zP 4y@4yCy@Ci4z+H?h CA4zp+ C4zH+ C4z + C4z+H"4z@ 4@4C@+MH:4zCQ7+H? 4z 4 @ 4 p@4 `C@+H&4z744 ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀuK>ˀeK>ˀUK>ˀEK>ˀ5K>ˀ%K>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>ˀK>CI4z}4+H59H39  k?+H5>AH3>I k?k?/,/-o`#7C7 Rk>4Y4 ]|4w+@Ph #7B%4y4?K>YO>/0-@/0, "+}` P+ς` K>[47^a7?a+}4:Pk>4_57?a+}` `_M7?s T 9k>_7?y S K> k>_7?K>#R K>7YPk>4] 4 #R7YK>K>] t4 K> @"#B%7ϏK>Y"6#va7>#Q'7U`. 0k?7?a0N' 0'Ghk>K>G@ K>^71"6p'0NK?08G$1H 1 +4: 2k>49^4x#7K>4] 4 #2K>479@] |4 +4ς%h3 $ ,bk?ok? k?+H8 #7k?+4 k?!4ph< 7?yY Q4+47@h +H844] \4%(*B4Ka?C}4: +H! @Ba:B54+H7 @k?yBIK?y@eL|4K?y e4%er+H" @"% b+}4:pX4XM4+XH:+oh X4` X=@K?!440Z 17?d7`?@4A w z! 7?  2@J7?  27? = H% y7K?ab@zK?6|?  Z6b?  BH<7? 7H37 K?K?aH=t  7K?aK?4]k?a >m@+tH"7 H: E 4"k?]5@#D7_ #6?7ACk?a+tH:7?aJ87?b+tH<+{ 4EH38K?yk?u  2^E@+{K?yH=8 ]-K?"r"+d`H9(K?y9 [@7ck?a+d`48+{44K(  H48 7 K(̢4+]-H:@7̽h4+H:4_4Ѓ>@̽ 4B4 Ƞ44PB4̯4B4̯4U\K?k?4k?a4C<+t4444B-4 +}X=4:p̯4K?+d`H=(K?y@ H?(K?y v]=K?^ E7+{K?yH98 ? H:8K?yT  ^K? +}X54:p44K>K?K? @O?k?o7_k>@ k>c?+H7 K>7?Y7>`h7]K>4`*#27:B 4o 4|K>C? R4|K>Y@O>#77?^7 +^IK>4| "0 ,k?ok:k:k:+H9c;Q+H? c;+zc!4:pZ k?`7+r֣43 p e4$4_7;Q`4 x40_U7;A҇ K:Y˃K:Y`?O+r 2B4: ϏPK:Y!:+ς(h#[@A 7;QU @k:U 7;k:U 7!7k?U t7>K:K:K:k?_%4z+4h6x4K:YK:K:K:@O: J4 4_E7E@4 %40_7=@?7K:Y7;Q4 E4_7=@>K:Y7;Q4 40_E7>!@>K:Yu7;Q4 4_7>}@>?K:Y7;Qk?o+H9P+H? "+y6k?4:@ZI6 0@ 74|K>@O?[Y@_K>+ςh#k?ok? + rH7 4y04z@Y7?BBJK?4@C?  279k?C??79?79+t]H:[I@B"+tH:4k?CW r7Zk?C_ "7Zk?C_?7Z "+h +4h?] @`7+H: ^e@+h ^}4+7 h<]UK?+H844y]p4 +H: rCK?@ZK?B 4zϏBB4zpϏPK>B4zϏ0K>4P4+h9xK>K? @O? $ )+H5>H3> k? 1 / # " 1 + 1 $B 1 (" $ & $ ,b & ) & ( '0 ) & /R ( !k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;4k<7Dk<7#k<4 S#k<4#4#4Z#4D#4:*4?ߍv*n#b3*V4~#J4 f*v4d#24\#*4 X$14T#4 LD(҄#)4Ԃ%4"4n"4 l"4N$0j4 h""-4"4"4 `"4<""74D "4V*&"j"j)4 Fd"Z4 4d9"4 ,"B4(.&4 *^4x"4P"4" 4Bd*4 bd:4JD!4?Ì"46!4v!4^!4R=4H$!4$>:40/4:*4.!b4!Z42D!R4?c4?#7 FNVN&  v.FvfN   BJK<I K<k?7K<K< k?+H)h+k?7=k?q!QH2 5Dk?4'k?+y4,k?y!258"4 7=[ )4k?+k?q4k?7=H,`H k?+y4,k?4 k?y4[4+w!44?54*7=[@k<59"@4 4] 7K4d,n4`e,^h+4Nn+4Jo+4Fp+4Br+4>q+4z?ӏBvb++H9+z,$4*L58#eL4 +x 45 ` $+H9+H$ +v"k?4:p6Y6ik<[@i|k<+H?`Z+v4$P K< 2+v48p5kPO 7?5kO+h++4ςh7x+H% "q+y6dk?4:6w4Y}4hdk<[@kK<++h8 +d`/DH: 4Y+d`H3 ,`+H H9+zk?4:P4PY4gk<,+H H9+zk?4:4`Y=4g$k4i_ dK4>444"4&}k< +H" +y4k?4:404Y 4~k4q_d ]4+ςqh$x, ]4+H844'4y6[4 1H449`^4 ZH44y7^4 *H44y7!^4+Y @rakk?q H' 4k?+yk?45 k?y4(4 7>AYq4wk?+k?4 H3 k?q+H.8k?+yk?4'k?y44xY4wYi7>A@@k<  +H9@M4)aeK<+wH(H-( k H4 8@4*׏+H) +t RH: 4Y+H8 +H8 \@+tH9 344:*We7< hk`*4 @A4z.]׏H 4z/Qk?47k?1]U7?1K?1] 5K?1 V 9 ] 7K?1 \ 5"] yԯ  `"+6+# d  K< @]4z;1׏X}@ h k<@* k<]=4z;׏] K<K;Y])@K;Y]@yK;Y+H? *  +H1 0 +h x ׀ ]e4<+z44#p+z 4%p+}4# p+}4% p+H7  2+H9 $ +h xI׀ 4 4>@4>A !5@5k?+H* k?7@4>+H4 !7K?K?K? @O? +|4:Pk?)[4P"K?)_4`rH7p B_@` ӆ_@p4+H8"z4"`>4+H68>4+H<>4B#Q+7XH7 k?!4Z ,4 +H5 ̂54K?!44 Z 4w+H78K?!4Z 4 +H7 K?!4Z |4 +H7K?!40Z L4 +H= +H48 *`=?4+H38d=4+H? 4=+_e@+H9p4 <@@_%4=}@+|49P_4@ 4@4[4K?!744 Z 7{4Ȁ4 ( !k?ok? k?k?k?!k?)+ s@9 :_4z+t44&44 U S 2ҹk?4<'4hk?1x5_ 44 U Sҹk?4hx5_4 rD4z_ҙ44 Z _Xk?_E5`D_%4z44 Z _Xk?_54z__K?14^4 _K?1K>K?)K?!K?K?K? @O? ( !k?ok? k?k?k?! s_4z0+t4444% p W4zp_]444 W #_7p_ 4z44 _4zp_444 _ #2_7:p_4zK>K?!K?K?K? @O?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?+H5>H3> k?k?o 4k777ak?q sk?a4z# 7?qG7?aGk?Uu4+H:K7[!4y#@+H844y#PZ,4 +H:_4y#p+H? 77ak?4z"k?7?i7?aV7Y`4K6@O7U@K?a@ @K?@ @+`4@h? "0 )2k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y+H+ %+H& 4#+xH' H+{H$ +4 h% [ 4h| ȃ$Hz [4#+H?X%+h% @H4 ZCH [ %4#Ѐ zH[ 4# Z_%H$H$+r487Ca44?4d*+4(+4)+4*+4++ S4,4M4Z4~44H4zC7#44#Z 4 H[ 4# ji% 4H#"+h%_H"7+H9`Z 4H[ %4$"HC!C2!44$ 4"Z6W6Y? a4? B6#4?`4HBt X4$Z%HB+sHZ4:4\4b*4H4?c 4Hz ZH+Hx h%P4%`4Z4 +h H "B:61R@>G4}4K>!SXD5Z#EHz _%7@+H9`4Zx7+r+r48C4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O??oK>_X4$@4=i iE %ipPX4$p4?X4$ +s+h%+h% i% I=@4@4%ei+Mh% PX4%0Hz +v Z W4? 4 9 X  ‡ ‡ ^ ‡> 4( 4V 4X z r4N r4LW b Z7 R4@@@4@4 @4@4@4 ( "B ' + 3 #b 4 #2 , -r ( ! '0 , ' #k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y+H?k? 4 +H8  4+H9$04204 +H: D 4+H(4# K?@ K?hr_ +4"H7k?4&4%Z4 +t ` +x@- J_@@24_u4 +H.ȁ'Z R+x@, :+H?'+x@'!'_4_@+x@! 7 +x@)! +H"Ȉ H| _e@@j_4%_}4&_m4&_]4&_M4'0_=4'_-4'HK?hh4(PZ4 +H* *+H+ _}@fb+H6 4(_E@fZ+H5 @4)_eҺ+{H:+{_MH9Z@+H7 K?4*4(Z4 +H7xK?4(Z4 fI_ &+H4 %+q04++4,+4-+4.+4/+r40HK?4(Z4 4)Iz IH\69 J44)0Z4 +H7p+d`H? Z K8JG 6:I6:0IW K?44)pZ4IW K?4)Z4 IW #I K?4*@Z4 IT I 04904 8@HK?4*Z@4 Hr K?@ K?h}+t h` +x@6  J+x@!! 2+H< IX  _e4_e@HK?hr74*ZH4 +H5  J_@@2I I"ZI`Z p4_@@:I7 @_I@"I`Z 4AI_ K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?+H? (@ +H?`+H84`R+}4:4= YY   B6_ Y"@6+ #@7+ 45@ ( ! ' + ' 'B ( # ' B ( & '0 " & $b+H5;H3; k? ' % ( . %  &0 *R & / ) ( % ) (0 + % #k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+k>7FH-Pk>7.k>44 4+4 h)P+H28* +H?+:4@4i 4+0_U4`4|IV0*:I H**_%@AIz_@@k? /0"K? @I  k?  *K? 4:=87k?  *K? 4Z=87k? K? _Mo_@^IzI` K>!*K> "K>=877K> "K>=877+H?,2I ,"G}4H GUH55  G4H6/ ! <4`2 *'I\0  I5'rH"S / 6Y,468Z56:_=5kRI H4 IU0 zI  I4< :B7 *6?7?_6:jI:@ _@;IV0;IV0k? K? Iz_k? jjIY0 I H I Ӝ "k? Ӛ4=87 (k? Ӛ4=87k? _]Ӛ7@j@K? ?Izk?  H9 h+_EH8 fj+H? 4 +H0  4+H1&04204 +H: F 4+H:+_H9+H8P +H?+H7 r +v  4< PB   +v4%k>   k>+H,h k>+{H9_}4+`h +t4'+4(+4)+4*+4++4,+k>44-+`H5$+dpH8p7?@dh:p+oH?p7h2pCd @+H4 +H=P$b!G_MӚc4  _4?I:@ _@IA0#I H(I P_5A`0K> "+H? 04?Y4X:4_M4!2+H8 (+H7h+|4?4&Pk? 7? _4aK? !"+H: _@]+`+{@3 p$4? pC$7G _5Ӛ =?@K>}4| s4z+p_%4`4| S4Z+_4`p4|4?+H/P9+H9 h 04_@y+!_m5+`4|!s_E5z+`4|!S_5Z,`PK>_@7{@`K>!3_5:,`K>`K>$*_6:,P_42_E@o4m@ H4?+H?( *GeH 5 :H5? 4G ӔT *G4H 5+H< ;m@4:G@H u \G]H4 5454/4H4? _6Z-`K>`K>k?  B`K>!_-5,P_54`PK> _ 4,_4`K>k? 4K>_-4_4K>+_h54|K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> _ 4,P_ 4`K> _ 4,_ 4`K>`K>9u@_ E6:,_ M4BYE@:_ @[U@Y @"3_ Iz[%k? I  ӕk? K? I _ 5@`K> ( . (0 " ( ! ) " ) ( (0 +k?ok? k?k?k?!k?)k?17Vk?A7k?I64_%6#4K?I44_4#+{H9_ 4+`k?Q4$h 4_4+v Z48 K?AK?I T  k?7_54-+v  V49 "_4-+H?؀ *+v4:h?I_4-_4. *+`h 4'+~@h +v 47 P+v 9 w 4= }  +~@h74&+`h= 4'+{H9= +{H:h +dpH7p4(6?ah?p+o4"H!p44hTp@<!z+o4)H!BH Ӛ=87H  Ӛ=87ә_4azIp7?ipazI<p7i8pC??HK?Q"K?A_=6-0`4|"sK?I_ 6z-p`x4|_ @_4,4K?Q_]4h_4_44|K>K?1K?)K?!K?K?K? @O?_-4. `]K?Q_-@k?7@a@+g4:`"sk?6y.PZ57ZK?`:+g4^`4`` bK?K?Y@7?4_K?+g4:^\ 4^??K?K?7  e ( !k?o k7 +H4 7C"k7ap#JfRf Zbb"$2#+7.7%H7 4$U!77a:+"tH7 4$6z/6y/U77aA#K7a4CU z+d`H8 $B49k7 BK7Jz *Y@`K7Kk7a+tH:ZiK7a+tH"#k7af 7#+H4 `07#H +z"k?4:60V14bk7!We@@2p#Bff#bʄb"`"Z4?K6K7 @O7#_7.`ϏK6#3+7:.H7 4$79/ U77a+#H7 4$7/A7/UA77a__@74[m77c?Y577#47:0k7Y 7 4` K7_77 +77[4+#H7 4$7077aU177O"60A_-4yϝK6"K7a_60ϏK6K7!K7a@ K7!+}h<K7a@K7!+Mh<K7a@ K7!+h<K7a@ K7!+h<K7a@K7!+h< (0 " (0 + )0 ."k?ok?7C@ k? S4C"@v ˀhK?Y44 _U4y+h<4$HB`+d`` 0HK?YK?@O? 4K?4904Y44x_4 @s4u!"#T4d7Y044 Y4@ *4@ 4@?@#447914 Yd44_4 +H7+##h<4$7"711Y4 EHK?=4+gh 4h= 4h 47 `h 4 h 4yh xh ph h_h `+ȁh<4:0Z4yH (0 + (0 " ) .B ) ' '0 ) )0 ."k?ok? k?k> k>"6"k>K>C@"b K>41QY4"+6"H7k?!4#41aY4 _4 He!K>4C= 74414 Y\4@ *4@ 4@?@4414 Y44_-4 +K?!h<414 Y7H|!bK>4C8!K>!B+gh 4h? 4h 47 h 4 h h h h _h +h<ˀpK>K> "_K>@ _K>+dp4: +4K>h7 @[4K>+ςh? HςK>44_ 4 +h<+H"ȀaRHvaH+dpK>4: [M4+H!Ȁ :Hu *+H8@441X4 +H9Ȁ :Hw *+H9hK?!4X84_7>+H8Ȁ RH} BK>K?!4X4++dp` +H<K>K?K? @O? (0 " (0 + )0 ."k?ok?7C@ k? 34#"@u ˀhK?Y44_U4y+h<4$H؂`BX+~@` 0HK?YK?@O?#K?724Y4x_4@}4!4d#44792!4 Y4@ *4@ 4@?@#72A44 Y 44_4"+6"#h<4$72a7Y4 MHK?=4+gh H4h: 84h @47 h 04h (4yh h h _h +ȁh<4:0Y4yH (0 + (0 " '0 ) )0 ."k?ok? 7D@ 7# 4"@ ˀXK>_U4@4x!4"4624 Y4x@w *4@ 4c@w?@"4624 Y`4x4y_4"+#62h<4#7"7Y4 Ha +gh 4h< 4h 47 Ph 4h x4h hh `h X_h P+a@h<444_e4+h<4#Hab+}p4Y4:+ H8@442Y4 #+7"H9hk?4Y`4+s@9P 44348PY 4 +s@:0 "443!480Y4 +s44843AY4 +s44843aY4 +s44843YP4 h`_7?K?4K?hv4Y4H|` H|K>K? @O? (0 " (0 + )0 ."k?ok?7C@ k? 34#"@u ˀhK?Y44_U4y+h<4$HЂ`BX+x0` HK?YK?@O?#K?734Y4x_4 @}4!4d#447934 Y 4@ *4@ 4@?@#7344 Y44_4"+6"#h<4$737YH4 MHK?=4+gh 4h: 4h 47 h 4h 4yh h h _h +ȁh<4: Y%4yH+H?P  *"@64#@74!#@741 ( !k?ok? k?k?k?!+H7+r4$ @ t _4z4A+H? h+r4% _M4z4_=4z4+H74y5 Y4"s+6x"k?14y5!H7 hY4 +H: 4@@+H? +y49`k?9 K?9K?1 4y5A4 Y4+H8 ` _4z5a+H? ?E@4_@_4z5K>K?!K?K?K? @O?4z5_M4+uH? ( !k?o t4z5_k?+HH:4z5_7+HH: 4z5_e7_U4z6!+H? _-4z6a@++v X43 v_4z6+HH:4z6_7_4z6+H?HB!" ƒ #7_M4z64z7A4y7_%@+H? !+H4 !P4z7H4y7"6+ _4z6p4z7A4z6_4y7H4z7A4z6_m4y7! 4z7A4z6_E4y714z7A_-@+H" D :_4z7+H58 p4z8h4y81+H= 3>u4:.Pm4y74y7_4x7}+4y8Q_]@+H`H: (4z8a_-7+H?+r49 <_4z8+HH:4z8_7_K?K?Y@O? ( ! & (Ku0Ks0  k?+H59H39 k?k?ok? k?k?k?! t_54z9+H= 4$!+H7h+|4z9A!@49P@4x9a4&H! $#H #H #H $BH $RH $b+H?$j_E4z;4z5_%4z>+H?p(J4y>_4z>A+H!p"(j+H9h(B_4z>q@+ 4"_@H +H?+|4z94y9 (48P+H6؎ 84w9+H5h 4w9a 347"_@+H3؆ _@@@7_4z41H  _e4z:++H? "6`_ _4z9H 4  _4z9eH _4z:EH _4z:1+H'4% ""_u6`H _U4z:QH ! 4y>1}4y41_m4z>+HH: 4z>_=7H RH B+H"@ *+s@3` 4z?_49H RH B+H9 *+s@$ 4z?!_m49_]K?1H +H4 40 "+H504_4z?a+H9 @4 _4z?K>K?!K?K?K? @O? ( !k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y t7D4qp4nk?4z?k?4y4x0_4wP+H/45?@W@#44k>4|`k>#k>7@k>"k>6@k>"k>6@k>"~6y@k?#7@k? "6@k?)#^K>7]@k?#>k>73@k?+xk>4& n4' l4( b4) `4* f4+ d+4,+4-k> 34"pk> ^4O@k>4bPk>"#6"7@k?! >"40@k>6@k>44444`44K>ɴ4? p4k?5_5k?+H:57V?@W@(B44E6Rp5_5+H=7?@W@%z4+H9 &4zEZER 4?5K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>@4z@`@ j@@ @K>`@ 4?O84jK> @K>_@@4zЀ@ H `@ 6_ K?) U40 fr@@ H `@ 6_ K> W40  @K>@@ H _`@ 6_ K?! 40 _r@@ H _`@ 6_ K> V40 _ @K>_@@4z@ H ?`@ 6_ K? T40 ?r@@ H ?`@ 6_ K> X40 ? @K>@@ H `@ 6_ K? B40 K>@@ H `@ 6_ K> \40 = ߚ5`@ 6_ K> ]40  K>@K>@k?@ H `@ 6_ K> Y40  K>@K>5k?5_5+@@ H `@ 6_ K? S40  K>@K>@@ H `@ 6_ K? A40 7oK>]K>ߘ}5 ( !k?ok?k?k?+H=87E t 4zp 4`@4y:Q_m@+H?b"B!"@+_4zP+x@? @4% "ₒ"J"b@ _4z@ "ʇ₢"Z"r@ _e4z+H?Z$:##8H_ 4z @ j: "ℒ$J$b@ h_4z@ h$ʇ™$Z$r@ n4z6_e4yp+4z6_=4yH+4z6_4y +4z6_4y@+H"44B?]4$WX@=4ϟK?Y_}4zp@ _]4z@ _=4z@ _4zX@ _4z8@ _4z0@ _4zP@  J@!4zp 4y@4y_m@@ _M4z@  B@!4z 4y@4y_@ _4z_4z5H47Y?&|=@WH@<4ϟK?Y4z6_e4ypH4z6_=4yHH4z6_4y H4z6_4y@H478?{@W`@;4ϟK?Y_4zp@ h_e4z@ h_E4z@ h_%4z@X@ n_4z`8@ n_4z0@ n_4zP@ n4z 4y@4y@ l 4x@4x_]4H4!?%`*W@ ϟxK?Y4+GH:P4z_7H47?@*W`@ ϟK?Y4+GH:x4z_e7H46?@*W@ ϟxK?Y4+GH:p4z@_7H46?@*W`@ ϟK?Y4_4z+H9 _]4z6XH[Q4z 7_4zH_4z>H46?@*W x@ ϟK?Y4+G4H:@4z_}7H46s?@*W @ ϟK?Y4+H94z 04y@_@H44?@"W p@0ן4K?YK?K?K?@O? ( ! 2 !k?ok? k?k?k?!k?)+H&(4$4A t+oH9p4zP 04y@_E44z_-4+H:4$7H?@W @**4+~@7 0_@+~@? #2+~4z_49  H_e4zH(4_4z+o4'p+4( 4z_4I46?@W @) 4H(4_ ]4z_4z H47?%`W p@(4+H9 Gj_4z H45?@W @("4+H9 G"_4z H44?@W@'4+H9, J_M4z @H44S?@W8@'R4+H8&_4z H44]?@W@&4+H< H4z & 349`_]4z H47'?@WH@&b4+H3 b h4%_4z5_]4FH77V?@W@%4_4z@H47?@Wp@%4+H4  j+|49P_ 4zH  B+~@3  *4z_49 _4z_4zH !z_u4zH475?@W`@$z4H <++GLH:4z P_7H47?@W@#4+GH:4z _u7H46?E`W`@#z4+H6!4z 4y Џ _4zuH _4zMH _4z@%H _u4z`H z+H?4* _-4zH0(4z (4z_@uH _4zMH _4z%H _u4z HK?)K?!K?K?K? @O?k?7+H? (@+H7 @@K?Y@7? ( !k?ok? k?k?k?!@ 7C@z@ j b=ӹ ӿ44> 4 H_E4 0p b8"_6 K>ـ`"@_4 @ b8_4 P b8?M"t_6z5K>K?!K?K?K? @O? ( !k?ok? k?k?k?!k?)+ tH90_4z `+H?04c_e4z 8+k4+y4' _4z+H:4F_ +n4+y4' _4z+H94%_ h4e5n4+y4(  _=4z+H?4_  4o4+y4(   _4z+H74_  4o4+y4(  _]4z+H84_  X4_4H7?%`V\@0r4+H9 D@+H8 _4zPH45?@V@/4_U4z +H9 C_-4z@+H9 4zp 04y@_4H4?@V<@/R4+H?#h4z`4y@@_u4z H+4<@*+}4&P  _%4z +H944$"@@4+q0H9 4z 04y@_@z_4z H4`J+q04' 44z_U4H_ _%4z P+H'X _4z p++H?` _4z H+ _4z + _u4z +H3 4z  4y>!@4y>_-4+H74$6?E`Vd@,z4+H(4z  4y@@4y>+H6Ȃ;o4x>]4x>!H9 _e4zH_E4zP+4y>+H?  " 4x>!4x0@4x>_4H4?@V@+24+H74z@ 4y@@4y>_U4+H9_54zH4T?@V|@*4+H94z 04y@_4H43?@V @*"4+H94z 04y@_U4H7?@V@)4+H94zP 04y@_@+H? (4z 4y>!4y>1@4y>_@+H' B+H84zЀ 4y@4y_%@+H94z 04y@_4H6?@V4@(J4_4zP+H? _}4zpH _U4zhH _-4z@H _4z>H_4zH46?@V$@':4_4z+H?؋4%@_e4z@+H94z 04y@_-4H6?@Vt@&4+H94zp 04y@_4H6w?@V@&4+H94z 04y@_M4H4?@V@%4+H94z 04y@_4H4?E`V$@%:4+GH: 4z`_u7H44A?%`V@$4+H94z 04y@_4H4K?)K?!K?K?K? @O?H ZDjD  *#@7>#@7"@6#T@7\>1#4@7<41 ( !k?ok?k?k? t4e5_4+H=84 4z4y81@4y8Q_]@^@4z_57+G8H:x4zP_7+H8x _4z_4+H?p #3 79 4y@4y_m4z+_H:`4zP_=7+_H:X4z_ 7+H" 4zЀ 4y@4y _@+H% 4z0 4yp@4y_}@_m4z+H? `B+H7X+{48  4_ 4e6 4y41+{4:  WW _4+H"474V?@ 4$Vd@)j4+H? 4z@4y (4y 4y0#379_4H45?@V@(4+H?@"@+y47 @4y@_U4zPH47?@V@(4+H84z04_4H6?@V@'4+H4+v W49 8_U4zH46?@V@'4_4z+@98:"4"ڀ"_4z=H47W?@V@&4+H9 4z 04y@_U4H7??@V@&"4+H9 4z 04y@_4H7?@V@%4+H94z 04y@_u4H6?E`V<@%B4+H94z@ 04y@_4H7?%`V@$4+H94z 04y@_4H4?@V\@$b4+H3 Ѐ 4z4y@4yP_4EH4y`_4H4yp_4H4y_4H4V?@Vd@#j4+H9  J_=4zPH445?@V@#4+H?+H9 4z4x@4x +H= 4w@@4w`_u4H44?@V8@"B4+H9X_4zH47?@V@!4+H9P_4zH46?@Vx@!4+H94z 04y@_E4H6?@V@!4+H94z @ 04y@_4H6?@V@ 4_4z H44?`VH@ R_E4z _54z _%4z!_4z!0#S_7Z.K?YK?K?K?@O? ( !k?ok? k?+H94%+r׹4< t4$_u4z!`H@)_U4z!+H? 0 H+H9 H+H8 8+H7 @_4z!@+H9 H+H8 8+H7 @_4z"+G8H: 4z"P_7+H7  *+H9 +H8 _=4z"+H9 +H8 _ 4z"+H9 ( _4z"+_4z# +@9 D+@8 B_4z#`+H9 8_u4z#+H8 4z#_M7+GH: 04z$_7+@9 z+@8 x_4z$0+H9 _4z$`+@9 @+@8 >_4z$+H8 Ѐ +H9 _e4z$+H9 _E4z%+H9 _%4z%@+H9  +H9 _4z%`+H9 +H8 _4z%+H9 +H8 h_4z%+H9+H8_]4z& _M4z&P+H5 _%4z7#+H< # 7.P4y7@4y7_@+H6  B+H= 4z7 4y7@4y7_e4x7#_M7.H4 pW W  S4Y"C64z&04y@_@H4 xע  #7"C54z&04y@_m@H4 a a  "6"C84z'004y@_@+d`H? +H6 (+d` @H: +H8 +H7 X4y'+d`X4y'+d`H9 C! _=4z'+H:(Z04G@4z(_7+H384z(0 4y(`@4y(_@+G0H:k?!+GH:K?!4z(_U7+H4 (4z( 4y@@4y>_ @_4z)0+H? _4z)p@++v U49 "_4z6+H9 P4z) 04y@_U@+H9 H4z) 04y@_@_ 4z)_4z*_4z _4z!_4z!0H "_4z*@H4 ִ _ 349"C74z*04y@_=@H4   #7"C?4z*04y@_@H4 ך x "6"C"4z+0@04y@_]@H4 99  "6"C!4z+ 04y@_@H4 pXX : "6"C<4z+Г04y@_}@H4 xw w  #S7Y"C34z, `04y@_ @K>K?K? @O? ( !k?7+H?#4 7:,p# 7+ +v47h_u@@@@"s_M6z.K?Y@7? ( !k?ok?+H9+v 9 ]4745 t_}4z,+H6+v D4= 4 _%4z-*24z- "4z-0_@_4z-P+H? _4z-P++v Z4843 t_]4z-+H"+y4$B Y _4z-+H<4z. A_ +H: +H3` _4z.pK?YK?@O? ( !k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y _u4/_e4/0+v4#+v4(+v4)+dp4*H+4$ 34/k?a44+"4@4 X4? H@` M90 Y M9005xCK?a05_E4H6?@V X@!4? H_4/H44K?@V @!b4_4/H45L?@V @!4+v4'+e@!34(5)"4@4 ? @@  L0 V |L0058CK?a`04_4H6?@V@ 4B? K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? ( !k?7#_70QK?Y@7? $0 !R ( ! "0 & ( & (k?ok? k?k?k?!_u7C`J+H?`2+H7`+h?+h7+ "sH7 4&6x"40W4 H db  _45H $P411p41qH9 p_u44+H9 _U45+H9 x_545Q`&4+H546?@ 4%V@+24+H5(G_47AH46?@V(@*4(+H9 +H8 _547H46?@V@*R4_48Q+H6 '*+H9 +|H8H9_48H_u49H44?`V@)+H9)+H: (+H= ((+H? 44% h$"6`("06 / /0+0NH9h4%0 9 Vז0 7?Q 0n6 ''4:A1 . 1&N0'H6 '01N 9!E'E_}+_]404+H9 41@41_ @H 4``7+H3 *+H9_414_424H  2+H9 C< _M42Q4`:++r@4  *_4: 42_74+xH8 8+d`H'42_+d`H9_43+dPH9_u43Q+rH9_U43+rH9_543+tH9_44+H9 _44Q+H9 _44+H9 p_44+H9 _45+H9 x4_m45Q4+xH< 8Y/++H! 4U|:45_7+H7 x _454+oH9`+q0H8x_46_46+H" Ѐ *+H9 _]46+_=46+H& 47 #7@7 _4++H9 h+H8 _47H_46H47B?F`U @"4+H9 ( _%48H_49H47!?&`U@""4+ S4' 4S ,.a7?Q400'W L,49A_]7H7?@U@!b4+H:@7++H= 7+`7++H8 `_@+h< +H9 W/+ !4<`6@_-49H+H9h4%_4:+H90`Hh` _4: _4;A4K>K?!K?K?K? @O? ( $Rk?7+H: @@"+g_49+h +H9 @"+gW 44: +h K?Y@7?+H5?H3? k? ' 'B ( ' ( )r '0 % ' + & / 3 #b 4 #2 '0 %r '0 & ( ! % ) ' % 5 # '0 &k?ok; k;k;k;!k;)k;1k;9k;Ak;Ik;Qk;Yk;ak;ik;qk;y+k;7CH?+h: X 47$44 (k;+H2 K 4 k;K;"+H704 k;K;J04'0k;+H8 + 4 k;4h3 hb66?0  *  1 6:_62r_6?P0 40h -+H?+H7 +H: H 7]h= 8+H= h+H:Ѐ *I K;6i +H3؀ J+H4h  *I K;6i K; 0+H4 @+H/p  *X15 XQ5Ӎ45y>5W5H4 7<4 5y?0 W50 m=M@60 0 5  ?4K;/B5y?5x?a4W 4 +5y=A5X"W 4 i+H2+_K;5L"75y=q4 5W 7hB+H0+_U@+7 u"6"4y=4 W 544y=4x=W 4 _4?4+4h? h_@745y<4 W `5_u475y?5x?a4W 75y@_U@m7+H"@>w4_@>M7#5!79=5"4 W 5_4?@ j+4 h3 h_u@e07 "368"4;4 W 4+H: +_H9 heJH@ 4 k;HK;W@`4k;K;@  `% +H6!J" 6"K;4!+|_548Pk;+4h2 h_4<k;+4hh1 hXk;+4h3 h+H! Z+H"  B+H#p *W m _=4,P_=4k;W - _4,_4h H+H? *55@+H? 5@+q0H: +5L)H8E L544+rH845y=W4 +H-p+d`H" ZZ I+rH9Dx5E5+h _K;5L"75y>4 5W7V @K;`04? bѮ4N!b"Z"ji A7 ܀ "+H8X _ Ѻ+H/Ȁ F54?5y<4 5W4+H9+ 5``- _ @k;/HK;=++4h7 4 _ -k;K;_ i +H9 H+{H8 _ 54Q4i A? n I  }i ]i 4 _ k;PK;0 4k;K;+~@5K;_ Mh. 0+h h_ @#7 P.+46 0N0&K;K:K;yK;qK;iK;aK;YK;QK;IK;AK;9K;1K;)K;!K;K;K; @O;+4 "h+ h_ 6?q_ 4_K;^@+ ( !k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i7*W 7: 7445XV7+H04 b4&+4(+4'I @Hp4 "  4 X5z"7AN5c j5JX  AmXѺ |5k B,џ? `4j+d`H,4++4-!HI @HpI ] /  l7 *X5 X15ӏ5"44P6V5 I 44?V6 I  :5) I !ZIv>HHI @ _505)? I  * 0 * 5Z_58 ʁ _5)?] I Ȁ 4_4 44K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?" I 4I @Hp ?G4`?74XQ4z4k?o+`K?7C@ @h? 2W 4z 8+`H3`׀4?K?Y@O?H?7? x 7h=  49@_4zK?Y+H5=H3= k?k?ok? k?k?k?!k?)k?1k?9k?Ak?I7E 44ғ444` ҈+{4*4)4 \5L r _44 @4 H4€ 4f Aa 4 =ӿ Ө+{4< f ` #7"K>K?IK?AK?9K?1K?)K?!K?K?K? @O?>@_ 24@  = h>@f~@ 4c H4 =+{4< +H5>aH3>i k?k?/,opk>k>k>7E@ 4"s6e"W4c"`6p4? 9_:"_ 9@ @ 4@7?1c?14@c?3@c?5@c?9c?7@c?A@ c?Ec?C@ c?Q@c?U_5c?S7>7?A' _k>k>_7?QK>я$AK>RF4 14 P.`&p7>0NK>409G$)E )  j#17 p.`&p7>0NK>09G$QE Q $4K>+{44( 4% <    x#K>k?7W4h4|4"86" 6K>7WE44K>YK>K>K>O>@/0,k?ok>k>k>k>k>7E@ 4 4"WQ4 7444V7a4pP444? 9_u:!_ 9@4c?14@4 c?37?1@c?5@c?9V c?7@4c?A4@ 4 c?C7?A@ c?GV Tc?E_7?A4܀\`74 348"k>404 V 4!+{4'Є~E@ 44_7?1RT67>ր '4@?7#07 ,$D7>0N409W'E E> 3"06 .`&p7>0N09G&qEq >= 348"4k>404 V 4+{4'044@ &a5@ aj5@ aB5@ A5F` @5&` `5@ `5@ `z5@ `R5@ f`*5@  h55K>k>4PV 4 K> 4p4 V4+g 4&K>k?4k?4WI4444 V\44TQ47W 44K>k?44W4444 V44T47W A4+g` 4K>YK>K>K>K>K>@O>k?ok? k?@ 7D#7"Vu4aj4K>K?K? @O?4? b6_!2_ b6@7?Qc?Q@c?S@c?U@c?Y_c?W@71)c?a7?a@ c?e_Ec?c@ k?17?qc?q@c?u_c?sK?17?`BK?1@4~4ϟK>ϟuK>K?14? T  47?A#3'77 .0c Z 0N S b 0'RW6#75   " K>k?7#@7> ( 45  7?!#3'D7: /@8'P75 0N.73 0 .`9$G'E73 ' 7R\7Ӗ 7B ZZ A74 @'&`.0 .1HN 1a '  Z ! 7 A RV6 7> 86?' ]}1 v +g1'N : 1A'"u9G1 4:08ࢇ6y1$Nk?A0N69F'F0' X Wk? |W K>K?A@7? #0 " )0 ." $ ,b $ 2 $ ) (0 + ) ( *0 % ( ! $ &R * B * " $ & ) .B , ' )0 ! +0 ,+H5=H3= k? * (2k?ok8 k8k8k8!k8)k81k89k8Ak8Ik8Qk8Yk8ak8ik8qk8y+k87)k86k84H90k9a4k879k9q4?k9k9٦_K8 !5"k8 u4dK8K84VH4I8444 VK8錌@ 4 k8+H6 64"h7 4y4 V4+H8 0+~p` p+z4:+~pK844 pk879qUYk9шI7+H?4:k8VK8ᄿ@(VH(!574HK8K8Wi4y``4jރJ Y6X?P XK8zK9V 4"6\YK8k9k9@!b4`444r4 7;Q4 ?K97k9C, L) @]5 ]5 \ H~@^@ Y7? Wb_OK9K;QK9K;Y6ֽk9 ҁ6QqK9C>7;QK9K8@0k9р *>*4 K9C 7k9* h ހ+&4y7@ (VK94bwH @ K9+~p` p4 K8K8рbk94 ?4 4 @4#AWIk9ak979 7<*~ *  k9@k9VK9K9B 6w7? B2?N6W7?7?  K96k9K9K9a4yV4K979B79a4q 74 694VH7K9a694 V 4jN55W4y4VK85J^'#A+H< K84 `r * 4y4Vx5W79 j 5W4y04V@K85J_ * K8`24?@W4?!35! X " K84?k9+~pl` p4&,V4$/4 -V0 24?M44%)4.E/4,34 (34?d03€(4 01n4 *)v4?V40/Ƅ)>4?ϴ4?!5& 4|pk9UK9ـ1n_K9K9RF4 K8k9K9Vi4iVQ4IzK9@ +N+4&+4'4H @Hp4  2K\5z \5z7k9q "3k *6HpH @J  Rl\55H @ (Hp\=5H @Hp7x ) "9+`?w K9qK8gK9V5p7K8 44i ph4k9َ"@ K9k9V1K9ٓ`k94 Z!K854X K8 7? k9+4%+4&H @HpK9 C 2 \M5: \e5:7@ *VHpH @ R*\5ZH @ (Hp\5ZH @Hp74)4@ ?w @k9A !+4%+H @H7p4'  R(\5Hp (H @\5HpH @7K9A )  RK\e5zH @ (Hp\m5zH @Hp7L*5A @?w HpH @A` K9C > K8K9X4K8k9K9K9#k9K84\@K9B 7K9k9q4k9@+K9C?*7k9C ?K9 K9qK8K9k9CӺ W@K9ً+@K9K9K96m5zk9k9C\Ӛ@?}@K9K8k9K8K9k9BZ \@K9ً+$@K9K9K975Yk9k9C6@?}@K9K8 0k9K9@-&44WK8BLk9V4W 7k974V7K9CX,4T4,T4+_47_477҄+v4K8`:79e @ W i4K8邅_79+H- K85?h. *NK9C)~4x)4? 4|v)~K8K8V4yK8Vk9 D+4?w‹4 /N4,4?g@4 ?!355 K9K9>ek9K84\b@K9B? 7!K8X5VK8k9a7?k9a @2K9aK8  ._K8k9aK8k9  T4 "W 942t744}74}'4K8' 4?@zK9C]0N4gTu4+_ Q4 +67?`4 `4 , 8`5?Q+4(+I @H-pK9 4) 4_94 R@JI @I3pK9  4_4?@p֬ ~Nk9K9K97=k94C"k9ѯ dK9K9р-^C:-N+q0H: +DH87mK8@K84 `jK879! 4?B4574?B4"_ k9وzk9+H7p+d`H? J JK9Gl4Y4Q@O+xH% @C4Q7+x9Eh% @+H++d`4, 5u k9ѐ 0k94b4rB+H?bF+}@ 4&p 4? k9K9CS`-k9K9B`8G4+H?8'4K84k9k84yK8V K84K9C].4TE4,^_!4K4\KK8k96)k9<K9@%k9K9V 4Nfk9K8郀N~4apk9K9K84V ik9ь07K8DNn4?K8"NvςK8vW4K84e@*K9CU F@7T4+_y4k9a4y 47U4K9akK8K9k94V 1 `74y 44Ut7"64y 44U<478 f79a' %aK9a8G%iF iK+H14 ,k8+~p` pK8ek9K84LK9 k9K8@M4vp k9K8bmfK9k94SK9k9_7K87VK8k94ZAQ34+H!4 3Mk8K8K8V-4y%4K8lK9k94S-K9k94 xCN,+H64k8 K8K8V}4yK8ek9!57@n`K8K8V%4y 4!574NK8K8V4y4K8V4y4V4y4+H! ZK84 `B + 5w4yU\4K85k_ + K84_?@J ?  C "K85?k8_K84y4 U4-244y4 U|5X ,-k9K8鎂lK9k94S9K9k94ZC7++H54/k8K8K8V4y}4ek9Uk9K8鍢pFK9k94SaK9k94ZC7++H=4.k8K8K8V4y4K9VI5:74V)K87Fov 5` ,K9V59(K8K9a,k9K9C 7k9K9B!r !j44y@4U4.6K84yVU4.. 44yp4 UT7;4`K8+H9k94 6k8K8V 4yp4VK9 <\ iK9+~p4" E k94T"+H?Bj+{4% k9ђ0k9K9K8K84yV K8k9+H. +h p+H7 pK94yU4+H- K9^4z0K94K7K8yK8qK8iK8aK8YK8QK8IK8AK89K81K8)K8!K8K8K8 @O8K84yV ik9a4+H74 41k8K8K8V 4y 4k9F44F@1@V4 4?&+~p4+ x k9K9ђ0k9A4K9+~p04` p4y K84U 5K84 44 4444404B`4A*vK8UE4yp44y 4Uh4)4K9Ta4,V^4Ka?H%h<!!SXk9qK858W7K8K9qk9Ka?qh*`4 7 h5 7?Wr1+414V44+H)4k8 *K8K8V4yK8k9р048sV4a4+H< @+H!p4 5Yk?4^577  V4K84yV4K8k9K8k9a  @+~pK97<` p4W-4K8@+H/k9404k8 K8K8V4y@4L (@ 24 (@4 (c@4ҟ@7@` 4@к Yh4 XX F 47`4K8V4y k84?+K8H1k94  -ak8K8K8VA4y 94^4K9K9k9a`k9aUk9K9a qQK84k9K9K8  k9F@`+4)+I+ @H:pK9 z 4* 4^ ]4 Z4@JI3 @I\pK9|  4^ 4?42b@+H84 +ak8K8K8VA4y  94+H94  + k8K8K8U4y 444yU5 iԬ@F@!k944y 4U 4^ 4zPP@@P@_@ k9+H24k8 K8K8U4yK8 k9ш_K8р`4K9ak9ـ`j6K9K8 Y g`:K9766Sk9BBk9ѧ_"K9a7wk9K9 F@ȼ@K84yk9Uu@i4K8K9U k9K94yU%74^5K87^47K8K8U4y 9K8k9K9C :7k9CBvӜ6? K8U54y K8k9K9U47D q4K84y U744%%7k9@@k9@@Yk94L?!7:F7:@Z+K8H7k94%k8K8U4y4K:FK:`K:+dp5?C4.K: Xk:+|4/  8W k9+K8H?k94$k8K8U4y4+K8H8k94$k8K8Um4y`a4K8UE4y94+K8H2k94@#k8K8K8U4y`4^!K85:U7K8k9@@Yk9Qk94 $zx??^!!785 'E.&8K81Nk94 08G'H 6t'00N9F8G'I$4 TK8U-4y!4)8k9+4)+4*4I< @IKpK9 ^4( 2K9K9Wi5K9 k9K9 F hk9K9!5K9WK8+p` j44y04U4444y4 U7V %7?a 7?ak?Y44@T84 K?Y+gC(4``$P4$PC*k?!4`4R4#C,4 `=T4C.`5VT` XK?Y+w @4K?Y4:4Si6@87K?Y44T 4 44zXU 4K?Y4@C4 84``y\4 CK?!`s^4``T``bK?Y+g4?b74?!_"K?!``r44 T44K>K?K? @O? '0 )k?ok? k?_7?K?!C@ +g474#7(4?:"_"C+{0@4``w4C4%`vK? 6z]4 4K? 24~`a`a#7"47?A#3'E7=/8'0N``4b0`w8G' G  4``e4|``K>K?K? @O?+H5<H3<  k?k?7_@+{4:#k?7:U7K?YK?@7? & ( ( ! '0 ) )0 , 2 ( $0 !R 2 ! ( /k?ok>k>k>k>k>k>k>k> 7D!5"Te4+H+k? 7@4 +g4(3C4: u4yU)4+q04N2-4Jn4F&484> 4 ?#37+p i +g` 4(+q04 k?4#k?)4&47?)@l7?b4?+H? (C +}46 +H?4cJ+r48  U4zȣL4+d`@$Ѐ% 4%_@i7"6:U)4zȣ4+H?] 4p+H?j+|4&` 7 \4+H?P*0*揺/҇//r#741T%4zȣ4+s@404%0)+s 4%P+H4+h p+H7)f5 4 T}440_4 $4 UQ4 +q0+H8 8+{4:04yS Q7?+4 !S 5E"4`4 4T 444?#7 @+H8 (+{H84U94zȣ4+H= X+H:p4 T4zȣ4_U7?)K?) C ȠT4C4@`4(C40``C`C `C k?``4f 7  6|_k?ȣ`_-@7T 4zȣT4_%42Y44zVI4T4z4eEk?7? 4^% K?4W +t|4% 441T 4zȣT44T m4zȣ,4+H8h+q0k?44494@ ]   ]84="76k?  ȣt 4?@Y4?#7@ z `_7?)K?) C Ƞ4VY7 BK?)  4:V!ԓ EK?) 6"V # 7:T4zȣL4+H84Tm4zȣ4+}p"H8 6:T-4zȣ4+~@"tH86y:T4zȣ4ZA@ȼt4+TH% +` 44% +H8 4T]4zȣ4 441T-4z+H&x404T4zȣ4+H'  +H(Ȁ :_E@k?)K?)0k?)K?)+H) +|4*Pk?)k?)44?締4?"s6 +H4+d`64# w 4T4+H<7 t k?)0k?)K?)#T+dP7Y:H8T4zȣ4+r#4H879:T4zȣ4h4+H8p4T4zȣ84_7?)K?) *C3 4zV!4@`ȣ4_ u!s]77>5g 'E,$8 4:1N4z08G'F 4'00N9F8G'IT% ȣ4+H% 4@4pT4zȣx4+H3p+d`H" s H H  5Y0T]4zj 5YT54zB 4T 4z 441T4zȣ4+H?\z+}@ 49p P=+H8`4T}4zȣ 44?`4?"6 +H? 4  r4ނ R4ڃ 24ʃ?  JP5Y+ @404 404@ 44941TU4zȣ4+H804T54zȣ4+"H8h6:T4zȣ4"64T4z"64!T4zW4PTe4z74`TE4z4pT%4z T4Y5T4zȣ40Z4 Z4T4z_ }@`R+H8`:+H?`"0Z74Te4zȣ4 V470441k?)5Y.PT4zȣ4+~@H8 04T4zȣp44?94?"6 +H9 *"6:QT14zȣ4+H:  5YT4z+H?  R+H( 4T4z_4Ty4z? 4TQ4z"t6y41T)4z+H% +w4%+H5+v D4= 5Y.PT4zȣ`4+r@4%+{(4% pY@ȼ4+y4%+H?Г 74+H?ؓ 74+H?ȓ 7h4+H? 784+H? 74+H? 74+s4%4?%4?"6(5 +yh4%p+yP4%p@5E+ +H? 74+H? ȿ4 I%04+H? ȿ4 I%X4+H?p ȿ`4 I%@4+H?h ȿ4 I%4+H?` ȿ4 I%4+H?X ȿ4 I%h4+H?P ȿ@4 I% 4+H?H ȿ4 I%4+H?@ ȿ4 I%x4+H?8 ȿh4 I%H4+H?0 ȿ 4 I%4+H?( ȿ4 I%4+H? ȿ4 I%p4+H?  ȿH4 I%(4+H?x ȿ4 I%4+H8 h4T4zȣ4+H?x k?)Vi4 k?)VI4k?)K?) V!4 k?)K?) 40k?)4K?)V4zk?)4@y "7k?)C?7BC?4 ^= *7k?)4^K?) ȣ844?W 4?#7 A Ka?H84T%4zȣ4Q@74V4zȣ4+H8 4T4zȣP4+H8 4Tu4zȣ4+}p4=  4T54zȣ4+} 4%P+H? 7 4+H8 4T4zȣX444T4zȣ(4+~@: @0_@+~5Y.P48 T%4zȣ4+#H87:T4zȣ4_@ȼh4+H' +{ 04%+~` 4%+x!tH8 85y:T=4zȣ4+H8@4T4zȣ4+H'  +H? @4`ȣP`+@' :`ȣ(`+H) +H? @4`ȣ`4?/4?#7 @ \  4+z@<p :Vi4@ 7+z4:pUu4+z 4%p+z@*p@ 4%p4+z@+p` 4%p4+z@=p :V4P 7+z4:pU4+z@!p(J+z84%p+z@?p 4%p4+y@7p 4%p4+H%@+H* +h%+H( +h%+H9C+ jTy4z+H3Bv R4`YY4z+H9Y94z4pT4zȣ4+H? @k?04k?4K?T4zȣX4+8H% +H84Ta4zȣ4+H?Г 74+H7+ 4H74p044zT4ȣh44? 4?"6 ! +H8 @4TQ4zȣ4+!TH8 `5Y:T4zȣ4+H8 X4T4zȣ4h4+sP4%+s84%+s 4%4>@4?#7 B @+H%p+{4% +H8 4T4zȣ4+sh4%+H8 4T4zȣ84+!S5\043 .a/7>!4059:0%@4zT @ȣ4+H? ` j+H5 R+H6  :Q74zT a704(+H) QD:74( ȣ4@ЦZ4 Z47+H7 `"+H< @ܴ4+H"  "4иTi4zZ+H!  "4иT)4z44zT6ȣ4^47T4zȣp4+H8 H4T4zȣ84+H8 @4TY4z4e4K>YK>K>K>K>K>K>K>K>@O>+H84T4zȣu4_17?)K?)?O4C?744k?4&4j 7  6_k?ȣ`+H9p4U4z` S4z`Hk?4~ 4^? "| 7 @ȣ-4+H8 p4TI4zȣ4+H8 4T4zȣ4+H8 x4T4zȣ4_4?A4>@4?!35& ӕ 44Ӗߒ 44Ӝ 4p4Ӂ% 4H4ӂE 4 4Ӆ_ 444zTy4ȣ%4+H9(` 4zU4ȣ4+H% @0@K?@ @ ( !k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+H$ k=94k=14 k=)4K 4#k>iK?k>!h7 Lk>K=9@,j,bSe K=9k>)44S7K>),jK>)`lK=9CLџ0Z+dp42+|4% +~p4'k>+{4)k>+}@k>4(pk> 4P44R4 H7?a4 4 4 X444?)*7WK>k=96CXk>K>i6?Ok>i#Hw 7"4S4 ϟh` 6U61K=96R7Tk=9K=97CS3"K=9C@" z87 87? @6Z `" M?OK=9_?K=9?/K=9,~@ K=9k>I7Pk=94k>I7>K=9C0Z 87K>Ik=96k>I7K>I@bK=9C 2 *7k=9C ?7 7k=9K>)6T]6:7/x7Hz @ T@T6:h| / R4k>I44I6k=94K>I4S7>Hx 44@S4 K>I`/"+H4 R4`@k>I4 W S84K>I6k>I7>Hw 5Y\568 k>7K>k>4"Ck> h 7K>i7X?k>inK>K>7=k>6C1k> ?K>K>i4B?k>7k>i Te6Hz )TE@ h` _a7>k>K>)j7K>k>7\Ck> h]K>i6?k>i@oZK>K>6k>6_Bk>?WK>K>i7?k>6(k>i4k>I7_7>C- *K>I77k>I6K>I@JC * "7C ?7 87k=9S]7>Te7 X77>k>S=6:k>I7>7>I_e6:T6:4404 S(7>0,U7>]k>k=97"k=94`C1k>0cZ4rCJ+H?cK> 6?  hk>CP4*4ڂ*4̂8Gk>I4*4*48k>I4LP*4L0"‚ 7Y0*B&R 7=9k>ILK>7<k>0K=9K>i6k=96y?Ek>i!3Hw 58"4S4 ϟK=Y _4#Hw 7"4PS4 K>h` 4? #S 7X"4pSH4 K>4? h` K=9K>)4S4K>h` ˀh #378"Hw 4S4 K>4? @h` K> hk>4T7% +H?DK> % k>"6"k>7>yD47>qK=9744S7b*K=94C B 86  "7k=9C?@ 7k=9K>yD K>q#7"744 6S7aK>yK>6??CK>q_ k>yZAb 44 Sh4 K>yK>q 4 4PS(4 K>y  K>q7  4S4K>q7>4 _7>i@Hw 46S4 ϟK=Y!Hw 5"4SH4 ϟK=YK>!k>iK=9C\ӟ0o4K>!5"Hk K=15e?K>he 44 K=)K>i FSxHw 4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=7_K>k=96bCYk>yK>i6?k>i~gK=9!45"40S P4 ϟK=YT6 6@K>3 k>K> "6"k>4K>4`S 4 K>7>_ 7>i}_K=9!Hw 5"4S H4 ϟK=Y7k=9#Hw 7"4S 4 K>4? ]h` "3Hw 68"4S 4 K>h` T6ϟK=Y!Hw 5"4pS 04  T6Hz  Ti@h` ϟ}K=Y!Hw 5"4S 4  T 6Hz  T@h` ϟK=YCQ&2k>I7RK>k=97CZk>K>i7?k>i@zK=9!sHw 5x"4S 4 ϟEK=Y]K>I4ڂ 40@+q0H: +H8A7>Ꮯ@8k>I+q0H9 Z : K:Uk>Ek>TI4!SHw 5X"4PS4 ϟ5K=YT4]K=9K>7k>K>i7Q?k>i yK=9!Hw 5"4S4 ϟK=Y_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?7TF+q0 h< ϟhK?YH7 4?H? H8 +{P4?@_4K?Y@7?+H?p ˀJ+d`H7 X @404?@ $ ) ) .B #0 "B & & )0 +k?/,ok%k%!k%)k%1k%9k%Ak%Ik%Qk%Y+H8 0k%41k% uU U4z +4% 4&7_4H  "U 4z 7_4H  _@ z_H 4g0 ^4g H 4y 4S7&a_-7&a@4_4H !+{4(I4@"@!  4i @4y 07.S%57_7.Pj  4y 7.S57_M7.@24  B?_  hH  4y Su7.4_7.H 44y Sh4 H  R_@4^< 2H 4y S774_577+H"P#p4&_5@#P7H4 \T A hP#H4B!5 -  !a5i`4  bc?a4y S7?a ? 4y S7?a L 4y X7?aS97?aaT 97!7a84 `jHP7?aT K9`B5`HP X T 7?a_5@4?@ ] HP S3 6   S7?HP KT   4HP K5  m6?5zS7?aHP \ 4HP `$ FHP8 0N0'(5H}O +h%H+H&  4%T4 +h 4k%4 H  `K%57k%_H H +d`h5+N h?k:T94@+d`4%+(h<T 4++h< `T4++h< XT4+*h< PT4+*h< HTi4+*h< @TA4+*h< 8T4+*h< 0T4+*h< +H4 Ȃ*!d5f T4+r*h<Ty4+t*h<TQ4+d`*h< +}p4?4?A__M@jz+H& `+ 4?H" P+ @H5 X+H6 H+H< @+H" 8+ @H) 0+ H4+H? +Hh pH'pH W w `H(pH  W +h:+|4?`4?_+H?  +H: +H: N@A@+H9 A4z0+H9 Ad4zP+H9 xAD4z`+H9 pA$4zp+H9 hA4z+{49 @AT4z@0k%+q0H: Y Y 4  P+{49 A4z@0k%+q0H9 S 3 4  P+{49 A4z@0k%+q0H8 U  4 P+{49 A44zЏ@0k%+q0H7 \ 4 P+{4hH84'7%S 5+H9  ϟh7%7%D 7%ᏟBK%K%DhzK%4yS U7%7%7%D 7%4?@ 7K%K%DZH4 a"+{04*0+{4++4,7%5S58Ib 7% I A@I  r Ƞ`4DIa 4yT )  "I| 4yT $b4H5)_7%+H,4z0 !J+r4#A4y@"+{04:0_4yAZ+h (4?+h K (H? +|h? +dp5W?h7_c%+h< +4h= 0K$K%YK%QK%IK%AK%9K%1K%)K%!K%O%@/0,+{H! AH9^++{H* +{0IY_ U4:0cX+4h9 (4?+{04,0+}h,  _ 4H 44y `R4 %H Q p4z =4Q P4z pQ 84z Q 4z Q 4z 0Q 4z pQ 4z Q 4z Q 4z0Q 4zp/Q x4zE+S4+5-h< Q 04z!dQ 4z0'Q 4zp7Q 4zM+}pQ 4zm+@2Iv 4y S5  ̂mH[_H4@RIv c%4c%4`c%4Jc%7%A( ZHIw E _  H4ᜭh: ( ) .B+H5K?K? @O?4T-4+`_H: @+tH7+H9 ؀ J+`SH: +`H: 4^CTT X 4 +H9 +`X yH: 4+tH84R 4 +tH:_4+q0%h< +tH:+}p43 +`4Rh S7+H?+|4=` 7 +tSIH9+H: +tH9T4+H8p47h%p4$+H= `+ 4 H7 PHp+ K?! HpH? X6? +HpH7 H6? |+HpH= @6|? +HpH3 87?v } +HpH4 06? +H" Hp+H?V 4R |HpHp+d`H7B U 4?HpH<+H3 9 E 3HpK Z U u +H9 +{S i4: p+{4# pR-4zzK>7?zK>4^  7"  K>و`?W++{+tH?+`h? +40H7Pk?!4@R4 +H7 K?!4`R4 +H=  R+H9 +` H: +H9 S @m4+H$P+`9]H: +S H9 4+H4P>m@P@+tH840_7+{` p7 } ( !k?ok? k?k? uk?14x0@7Dk?)77k?!4yPR4 +H74?+y48 4 !4C<!jK?1@AZK?1444P4R4X @W 784 84 W84? w84?  `@bK4  J7 zC j_G XK?)K4  J4y44 R4K?)C BK?!44yR4A@ϟK> 4 +H: *+H=` K?)_4zK?)44yR4 4K>K?K?K? @O?k?ok? k?k?+H$k?9 k?)40k?14#k?!44 R$4K?)A8K?1@7K?9D`4Hw`+4&40K?!R4 @ p4HwK?!`4`Rd4 @ L @Hw_w40K?!4R 4 +H<xK>K?K?K? @O? ( !Ku0Ks0 k?k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k> k?97'407C6k? 44 R4 6S -k?1k?444fk?A&K? 44R,4 4?K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>_61 ) 4461??@B 1 WW`*61??@ 1 __61?K? 4P4 R6768  @44p4 R58A45?ґ #hҗw  &C?#2#*7Cӡ ?ӷ+H3K?) _-586?`5/AV A :5`AJ?5A2?5 c 1 K? 4`4 R(6WT` Z]61?4458R6WK?9DAa2 E*'e"+H34f=K?K? /5)?C 5?6 0 v"4w4?84c?"%4c?AK? 44@RӷK? 44pR7K? 44RW`A05? .%" $4%$ڭK? 2? ?7?CW  B?:*7?CW  444 Rx58R 5: $bꋀCB7?C8 ! 7?( : 4X }"4?K? 44 R5K? 44R45:K?9_4  +H? 7h8 +}p4! k?)+|4< 0k?!40k?4K?A4 @4I4 v4 F4 Z4k?K? 44R4S K?Aϟm `+H7K?) 7 K62R 5:7?67404R58+H/H `4:6?+H0`96?94P+H9 SK?AϛeK>YmK?44R@4K?_m4SK?AϙK>Y44:5?:5?K?!CӘ:W5?Aҷ CT9 ?7Cx?@5?-<k?1%4c?K?1 K?14@ 0 p" `M 44404R4 SK?Aˀ}K>Y ( ! ' &r '0 , )0 * 4 #2 $ ) ' #k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+H?k>+4@h# 4k>ы.K>уK>ы@2_ @/j+H3p`/+H8+H"p4$/k>Pp@+H<@+` +0hh +H( 6R+H%x6:+H&6"+H'6 _ @5 _]4`_M4 @+ H9 4'_4 +H9 p_4 +H9 _4@H `+H9 _4 +H" *_4!!+H9 _e4!aP@@4_=7+H42 404H3` M I M]Hh +h 4K>5y'aR(4 +H?x+@(h 0+h? +4?h1x+H? (@"+h?+4?h: (M@I K>K>k?+H9k?+|4: Pk?+h N}5x'K>75y'4 R77!OQK>K>75y'4 R7P@4S94T99::9*9 4\U84FV8O8+H3 I9_e5z(I_@BK>  5z(1 0K>_ @H@:K>K> ? _ 0K>_5z(Q4?+H? `+Hph1  8r+H? `Hp Xr+H" (+@ 4Th, pWD6:+H?78JK>5y(4 R X67I8K>5y(R 04 +H8K>5y(R 4 w?@*?8B;D;9298 5$/$IWK>5y)R 4 h H @;74IWK>5y)R P4 K>ɀ4HpK>wt+@<_@R `@HK>5y%!R 4 +H7K>5y%AR 4 +H1x+h ! Hp+d`H! W 7 " J+H6 8  *_5z%aAP@Hp2"+d`H< X $ b+H< 0  B_ 5z%A @K>ɀ HpK>q+d`K>H7Hp+h9 ( Y B H@K> 7 FxA (@MHHp1+d`H: VV  2H@"K> G:z_u@+d`H" Y Y 0K>45y&R 4Hp+d`H5B Z JK>iW5y&!R4 I:+@H9C?1R %@+H=I845y&AR04 h I9_}5z(+I8h x45y(R4 +H9` Hs+H4 3_1@3RI:7S737I9R6: 2 6?Cw *?"7?C ?7?w *?"7?C# ?7? ?7 ?MaHI:R 69S6:MI I9_5z)h +H1  _]44HRP4#aH4h _4p4+H5  _44E`4X4p+H0 4 k>+H1-04 k>ѓ040k>+H5 4}k>+H4 @_Қm++dP4$_4 549P+h p47R4+ +40H744 R4K>44 R4+H744 Rh4Hp44 R@4K>4@4R4 O+H)x /++H*@/g++H+`/G+^U@/'+ _ 4`_ 4+H9 _ 4+H9 x_ 4+H9 _ }4@+H6 *_ U4`+H9 _ 54P @4_ 7+H740 4@4_ @+H3+ HH?  _ 4x+_ e4PX+`B+H< h _ %4+_ 4@+H?x4 *+H= @_ 44+H3(`:_+_ 4m+4_ ]@_ M4_ =4_ -40_ 4_ 4  +4_ @+H* :H _ 4!H _ 4"H `"+H5 ȒP_ U4"H `:+H2 B@"+H/( _ 4#+H) RH `B+H: h _4+_4@+H!( 4_e4@+H0h7++H(7+_4p@4#_@_4_40_4$A_4$_4_}4 +@=+h +h @+%Hh +|4? 0k>+|48`k>+}p49 k>+}@47pk>+q042 k>!v5r'k>+4%5q&k>+4&K>#U804k>+}p4'+7P0k>4(k>+4)k>+k>4*4 4 x44B4t4K>5y%Q$4+H! R^@ :K>р *+x@2  +x@7! Z+H< R+H8  :+x@1  "+x@?! _4+H9 "+4h<X+h +H9+h +4: +h p+_mh x+H9+_E4:+H9+_4:+H9+_4:+H6 +h +,h 0+{H:+{_H9 ˀXK=+8@<ˀ0K=ُ&++H9I:C2 *R@+H:@HK>4 _y7fh `B 5z&qK>@K>_@A@+@"@yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>_7noI8K>Ƀ?+HpK>^+ @<%4T4T+,h,4\+H='+ 2 O'+4>44>}+e4*U4 Jt6eu-'+ T]++H2 p@'K>+}h x+oH7'@OI:+H9`Q44h P 5z)! ++H= I_@BK>  5z(1 0K>_q@H@:K>K> _  0K>_!5z(QMHh ' B ' % ( # '0 " ( $Rk?ok? k?k?k?!k?)k?17C#U7$7X0 k?A4*4 Q4+H7 K?A4%4*1Q|4 R4z4*Q74QD4x`!4aH 4? 2+H9 4z_U4`+4'4hH 7 __ @`_H "_H(+4_4y +H3 H r+H4؀ 4zR4+H5Ѐ *+H= 4_E4y4+`h#4h K>K?1K?)K?!K?K?K? @O?k?7+`H?7h74H8H979Y@ h94K?Y@7?+g_=4:K?Yk?ok?7C#6#79*q704 Q 4w``+{47@ k? rH@ R-@H@ R @4H@ R@?HK?  @K?YK?@O? ( !k?ok_   E7K?74 C6@bIZ 4y*Ry6IX _u4z+QϏK7 9+H7 04? 4$4?+x@8 l"R+PH7 zp =5@H_K?b44,6XQ,4_@E 9>m@44-6XQ4_4_Ӛb* 9+H& 4+ 4,!@4,1+|_=48PˀK>_4,AˀK>Q4Hh7 4_44_484+Hh<x_4 9=@⛍ 9+H7z !j774_@_Ӛ`R@"__Ӛ`"H_ MK?z 9+H)X _E4-A4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?^@ _U4_UӚH @_ K?~+ςK> '0 , ( ! ) .Bk?ok? k?+H94 j+H: @k?_mZk?+H:k?44E<4`+H4  2+H?H`!R+H5 !:#+70H7 vk?!4y-Q4 4K>K?K? @O?H:P@P47 0K?!C7 _4z.+H6P!+s44%` _@A:4 x4z.#+70H7 vk?!4y-Qx4 >K>+H9@+H8h_4z-_ 4z-_4z-+H8>WK>+H= >7K>+H38>7+E4y.qk?4z._mk? k?+H94E444z._@K>B 2 b #@7/1@7/A #@7/Q"@6/a#@70 #0 #k?ok? k?k?7k?!7:_k?)!k?1b`4c?`4K?! RK?) K?)ZqK?104 " K?)Z9K?1 4o K?!c _ K?)ZK?1 4?4|K>K?K?K? @O?d4|}4| #0 #k?ok? k?k?7Ck?!7_7: 7`@`4 xQ@ " iK?!Z4 4 x4?4K>K?K?K? @O?۟4 ( !k?ok? k?k?k?!7%k?94QK:4@`7 4/q4Q44Q=  _7#70 k?14/4QP4 K?14/4 Q(4K?94/4Q4w@B4?4|K>K?!K?K?K? @O?RI4zk?A JK?9_ 40K?9440AQP4 ]4|K?AHC: :4 VK?A B? Q]K?AK?Ak?I40q4Q7K?Is K?9@K?A|:K?1440Q@4_404?RK?A%4| #0 # $ ) ( !k?ok>k>k>k>k>k>k>k>7Ek>у@$4Q4 v74y1!447QK>ш $4y1A4x1a4Q44"d@4J@04@$4L&J44y24 Qh4_]4+q04(+I H84$_}4@ @4gH4y24Q4I 4K hBRA4`J4G@:I  ]] R4_4G&R4y3A44Q4I  J  H` T I 7? X u6?I  H= I  G  SP_m7R5:%75zQ4I  U 9 ekRi4%H7K>QM4I K>Q%44 `bJ4rB:+H7a+}@ 4?p 4? e D404y1Q 4 +H5+|44  4_ 24QK>K>74y1A4Q 87{U@p4`4@4@g (4~_RY4>7_4z14+~p4(  $404y1Q 84 +{04!% _%44B` 4@ 04R4 R47+~p44 # d4704y2!Q P447?Y7?iBp4@ `4K?YBK?i@ 04@x4K?Y+|4?C47   Hk?Y4K>Q 4K?i  d_K?iR4?74z2A_%4H484!504y24Q 4 _4z344z3a_444z3_u4I   "R@I * `X44I <  &I 6  PH4Fh4K>YK>K>K>K>K>K>K>K>@O>k?ok? k?@!p7E 4434 Q4@4J 04@!4L?"7?y7?B4bK?y+|7?C4: _ k?y`"b+dp49? K?BJ  44"@4Q4 K?y K?RA s K?}  `ˀ(K>@w *4K>K?K? @O?+H8@p4`@R4r`B+}@  48p7?  E E ` 4B@ 4` ˀ%K>+~p46 @ 84444 Q@4xR4z441aQ4 ˀK>ϟuK>ϝeK>ϛUK>41aQ4 +q0H: 4#+H8_ 47@0k?y44!4Q@4K?yK?yHu X  2Ri@K?yHt  Y K?yHs  ] } KZ 2R@K?yH} B U  +K?yH8@ \ H| 7 A 6H} +  K3  Hz  D P7H8_H| Hy +7?h5 V 6 4H4Hb WW H?Hc Dd uPk?ok? k?k?k?!k?)k?1k?9+h +q044H9 7  H=  H:  `P7+|4% +}@4&p4'+|4( +d`444) 4 R Q4  4 4 F `   8 @7 G  4 ` 8 7 ` 8 7 ` 8 7 ` 8 7 ` 8 `7 ` 8 7 ` 8 @7 ` 8  7~57@4c]}5JP+~p4?4?_+|4? +dp47+o"p486 4?  4>7ob_nB_7K>K?9K?1K?)K?!K?K?K? @O? $ ) ' #Ku0AKs0I k? ' &r '0 ,k?ok? k?k?k?!k?)k?1k?9k?A"+ 60k?Q4#H7p44AP4 HwpfZ+{46@  RHH __e@H?H_ )Hzp+`4' +o4(+|4) +dpHp4484*4 ?    7$44BӚHp %   E ֙ % E  %  E #+H7K?Q4%44P 4 HCB+yK?Q49+ ? H+g `HaZ+}@ 4&  !*!5Y4 H44 J  Y4 zH44 )  Y4 :H44   YU4 HH+d`74&  4: _- _ H4 77@J+d`4&  *Ri@H7 `7?HgpK?Qh4?h}p44P4 H+d`7F49 & 7W45PL4+H+ HwpH w +Ch:+|4& +~@4"0 +| _ h4 +dph84?hHip"c +H* "+{H:+{_EH9  e t r44BHp ֹ %   E 74Z `2h`p+4?h8+h8+d`H* \ \ :@+H7K?Q4%44aP4 H@+q04! _ ? H+|4$`  "R@H +Hbp7?H= h4U?hup+ h%4?mh+H? +H7 (+|h? +dp%h7_@P@+H+ @_zH|p`4K>K?AK?9K?1K?)K?!K?K?K? @O?k?7_E@ _-@?@L)@@L@_@+LiH:K?Y4@7? (0 + ) ' ( !k?7P#7Y73?bJ&" $ " #+H<Ab"#46570P4+h +}p` _40K?Y+H9 @h +d`` 0_4 K?Y+H:؋@@h +~@` 0_e4K?Y 0 4k?_57bK?ς@K?Y#_ 75AˀK?Y#V_7Z5ˀK?Y#6_7:5ˀK?Y+H?Ȉ`:+H?X #_e761ˀpK?Y J+H! 2"#466q70Ox4+h +dp` _4 K?Y+H=Ј`:+H"X "_u66ˀK?Yh +x0` _4HK?Y_7(K?Y"_664K?Y@7? #@7,1"@671DRD 2 #@771"@6,1#@77A#6@7<7a ( !k?ok?k?k?7D v4z7_4+d`H3(d @+{H:8D _U4z84@`844 "4@A4@a4z8_4Е4@@ 4`"4z8_4pK?Y4z8A_}4HK?Y_]4z8q+{H48@ _-4z.K?YK?K?K?@O?4z84_4Е _4z8K?Y_4z.mK?Y ( !k?ok? k?k?k?!k?)7C b9 4@ 444@@  `"@_E49 b949!_9 b9 ?@K>K?)K?!K?K?K? @O? ( !k?o+ vH9@_4z91+}pH9 _4z9Q+H9h_}4z9q+s@8 R+s48+s47+s4?P+sk?4z9_ 49+H9H4z9C704y9_@+PH:h+H:+H9hY7 8+H9+H8h_M4z: +H9_%4z:!+PH:(+H:+H9(Y7 8+H9+H8(_4z: +H9_}4z:!+4z:!H9_Uk?+H9_5K?+H9`_K?+H9+H8_4z:1+H9_K?+H9_K?+H9_K?+H9P_eK?+H9_EK?+H9(_%K?_4z.K>@O? ( !k?ok? k?k?k?!k?)7D v7%_4z:Q!+v W _4&  _=4z:4V 4:!bJ!2!ꇄ ҇ 4d; Q4 R Q4 24z;_}4K>_]4z:K>K?)K?!K?K?K? @O?=4d:-4d:4d; 4d;14d;Q4d;q4d;4d; ( ! $0 !Rk?ok? k? v4z._k?!_4z4>!@4>1K?)_k?+H? (4d,1 4d7104d>A+H"4y>a 4w>q4,1@471K?)k?_4_@+H8+H54z>k?4y>_4w>+_uH:+H$74y> 4w?+~@4?0@49K?)_ k?_K?!+H9 @44 Y4z?! 4w?+|4? +H?+t44 _]k?+H:+_H9+_H:@4z?4y?_7K>K?K? @O? ( !k?7+H8 *+|#49P_7?#6_7:V@"6)_U7K?Y@7? $0 !R ( !k?ok? k?k?k?!k?)k?1k?9k?Ak?I_} v+4z.H&_ek?Q+H:P_44z_-7+_EH:x4z_7_K?Q4z_44sk?q+s45 k?a+sK?Q`444k?Y4}k?i44@_M4?_=4zPK?Y_54 4 > !:B4  @4 6487 ?5k?4  * @_u55j zxK?i_E@>@_%4zK?aH@>4h_4zH4K?q_ "^ D@ _K?Q4=K?Q_}@K>K?IK?AK?9K?1K?)K?!K?K?K? @O? ( !k?7+#H9 _7+_ H: "6P_7K?Y@7? ( !k?o+_ -H: v4z_7+_ H:4z_}7+H? @+H8p4z  rp4yP_%@+H9 h a+{43y _4z K?Y@O?4y`_@+H9_4zp+_H:4z_e7+H9_E4z+H7 H+H9p4z@ >4y4y_4zK?Y ( !k?/,opk>k>k>k>k>k>k> v"4604zpL=7?I@$:+tH:PK?I+tH<N k?IcK?ICT#B7?qA7?yAK?I_4zϏK>Y4= +dp48K?q `k?q %h7%_U4zK?q4`+4(+#7 4)-@ +4*  r4z_4I JI6A4I\7?'`N@ 44_o ς0K>Y+|43 |  2K?I_ 4z+4ςh6xK?y` -K?yK?q~+dpK?qPU 5='7 7>01n' I:1 1 @ @ 0N0N 1 1A 'K9$G' F  ? 4 I\+|4& +dp4484'4 *04 _=4zP4_ 4K>YK>K>K>K>K>K>K>O>@/0, ( !+H5:H3: k? ( ( )r '0 , $0 !R $ 2 )0 , & (k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=P(7Cn8:4 (l "4 &m N@Wr4`}4? 4 (_   G?gK>!4BZ R9@2K>!6RC:c?#c?!I66?Y`_5.45J5)_e7?!K>!6k>!C:@?=@_5.Iz v_4zp+H& +t4$ _4z+H64z_ +H<4z_m +H!4z@_E +H"4zp _@+H%X4z_ +H&P4z_ +H'H4z _ +H(04z 0_u +H)4z `_M +H*4z _% +H+@4z _ +H,84z _ +H-4z _ +H.4z P_ +H/4z _] +H04z _5 +H14z _ +H24z _ +H?(4z @_ +H7`4z p_ +H84z _m +H94.79?@ 4$N$@)b4+H9 P_4z H45x?@N@)4+_H:P4f 7_4+H-P "+H9H _E4H45W?@N @(j4+_H: X4z P_7H45??@N @( 4_4z +H9 0#_]4zH_=4z.H @4p4+x04(   4z @_4H44L?@N @/4H @4&_  `4K>!_]6Iz5J7S?S@2H 86?ON @.4 H 84c}i4M@n v_4zKa?_4: +H) @_:_4+H. @7_b+H94z._ $_4zςK=Y  Hh _4z$Q+H*(4z$@K" 60H/ +tH94%k>!C/#+q0H: 4&+Hx^ uh 8@!Aڇ!H B A " ! @HςK=Y+H8 (4z "60+H7 !50_=@H45?@N @#4_4z +H. @;4%_4z 4+H# p`?2#6_}7:` X4_]4zˀXK=YˀHK=YK>!_%4 ˀ K=YPyHHh+474`h0 84H  II HX54 *H   ) @LJ`H|4_}5ς8K=Y_4@Hp+44`ph7 8+q04%4H  K  + @K`Ha44ςxK=YWQ@ 84X1@ 4@ @4+H4 X+H(p!6 _5:`4ςK=YςK=YςK=YςK=YςxK=Y+H"x# 7:!7 `@7 p_@ˀK=Y_@4_Q@4+ "H7 604 L7>!G+tH:PK>!+tH:CQ U4 _@`J+H?`2+H7`+h?+h74*n v_ 4z k?+H9 04f@k?4+z"k?4:60J4w0_ -4z._ 4zP_ 4z4+H) 84 4 e4$+{4%84&04'@+t4(+4)+4+!4 V4h4"4c R 7H 8ICW * 4_ }45H 8[ m k>!_ 5 -e@K>!C J7k>!59C_ UyK>!C@?7_ %5.IzK>!59C7?!PP I7?!\ I6+4h( 8+~p4&+t44B44'! b4j 4c_ 55H5P 4H@ `4_ "#V_ 7Z4+H94$?A@ v+r4% _ ]4z H4 b+}@4'p+|4( 4i    f 05805?`"4z_4(H4z4_}7H4 F_O 04+H9 (4$_4zH (4 `+{04&0+~pH (4'4h  05 05 `*H>y 4z_u4H ( "4z4_=58H (4_W 4+h4x4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=+H74`4#+q0H" +e@48494:4]?7Qstk?+k?7>yH8 k?q+e@k? U4E0k?45 k?y44 7>1ME4k?+k?7>k?4H2 k?y7>yk?4k?qM4k?7>k?4 k?4k?4k?yM}k?qM7>1}WK=Y+wH?/+t /+tH:+PH9M %@|K=YU+t_q@K=YW@"_u6.U4 4._E4zV@_%4z+H0  N@_4z_4 _4_4z4W@}4X@]4 4._M4zN _74_7+_H:H4 _7+H2 8+H%p_E 4`_7+_iH:4_m7+H8p+H+ 0_! x 4_%7+_H:4 _7+_H:4`_7+_H:4_7_@_i@+_AH:@4_E74 _-74_4`_4z4 4._4z+H=P4 4/a@4/A_@_y4+H3 H40 4=@4=_1@_!4`+{@, p _4+4? pCY z4@47@*ҹ_4 ?_i49! ? ?@_94z+H9( _4+_4+H4 40 4`@471_@+H9 _4+_a4+_1H:040_17+_H:4`_7+H94" "60@4_@+H94" "u6x0@4_a@_Q4z54Q@4_!u5z_74+H8 @44 #7@8 7?+|4- +H=+t43} k?_9@4_A v_ 4z_@@ 7_4z`+ 4`9 "!U_5Z + 5_q4: +H?p 4j71Pk>! 4l,10k>! 4mk>!4kk>!4z_K>!+H1p" B+H9h _4z4z._y4z04z._a@W@+H2@2'4+H0 24_4zP_4z4X v+H$4z 4y0@4y@_@+H:+_H9_Q4z.54B(@4Tm@4+H?8 v (4zP 4y,14y@4y71_@+^mH:4z_i7+H9`_I4z-4+H% v 4z4y0#70+H804x@_@_4z.4+^uH:  v4z`_i7+H54z14_)4+H9_ 4z+^H: 4z0_7+^H: 4z`_7N@^u74z_q7+^EH:4z_A7+H9_!4z+H9_4z@+^H:4zp_7+^H:4z_74z_74z_q"+H9_Q4zP4z_944z_!4l+^H:@4z_7 4+H0 B+}49P+"v48_6z  u4"_i6@ M4 49HfHz^ 404Hy47_4Hc`?Hf 4T@ 4+z@8p4$ B!R 57 k>!4pQ4@p v 4z4p@4y9_@@p +z@5p4z  49p@4y9_@+z@6p4z  49p@4y9_Y@_I4z. -4+z@:p4$ B R a4 @7 k>!4pQm4@p w 4z Q4p#79_@@p +z@%p  4 49p@49_!@+y@,p4z q 49p@49_@#_7.4"6._4zV 4_q4zU4"v6c._A4zV4_!4z4+rH.  w_4z 4_4z +r4$ 4?  _4z ᤢ_ _i4z +H9Ѐ _A4z!A%4"_64_@4+H& w 4z!Q+}p49#79_ @+H'4z! +d`490#6799_ 1@+H(4z! +~@490#79_ @+H=Ȉ *+H3 @ +H5 +H?+dp4z! (49 4x"!4x"1@4x"A_ !@+H4 "+H)4z"Q_ 9_ 4z"+_ 4z"+H,4z"р +x049  49_ Y@#_ A7.%4_@4^ @4+H:h^ 4$ w4z#_ 7+^ H:P4z#1_ 7+^ H:04z#a_ Q7+H+ +H-0 "+H?0 *Hh _ 4z#)+ "4@Hh4@_ 4z#+4y%Q+H0H 4x%a"60+_ 1H7h"V_ 6Z.4+}@6 p w 4z%+}49 p"69_@+}@< p J+}@< p 4z%49 p 49_A@"6_)6:. 4#7._4z+H9 04&_4%+H9H4&! 04&_@+H9P_i4&A+H9_I4&q+H1  _!4z4+H9_4&+H9_4&+H94&ѓ 04&_@+H9_y4&+H9_Y4'!+H9 4'Q 04&_!@+H9 4'q 04&_@+H9 4' 04&_@+H9 @_4'+H9 H4'ѓ 04&_Y@+H9 _94'_)4z 4 wQe4z( k>! 49k>!_a@4z(!_7+H9 4z(a #79_q4+H9@4z( 0K>!_9@+H<P^ 4z(_7+H/P^4z)!_7+H9H4z)a v4y9_@i4W 5@I4P@)4+Eh `C@H @RX@4V@4V@4#_7)ϝK=Y ( !k?o+^-H: 0 w4z)_7+H? 0 K?Y4@O?+^H: 4z)_E7+^H: 4z*_7+^]H: 4z*1_7+^-H: 4z*a_7+^H: 4z*_7+^H: 4z*_U7+^H: 4z+_%7+^mH: 4z+!_7+^=H: p4z+Q_7-K?Y ( !k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?i7G7$ 44+4 OH444+4 O 4#X44+_4+H" 844Gh' 8OU4#04+ )70!+4&+4'Ka?4)4 P4 R4 X!4@ P84 p84?`4"R"P59!4X_55_4Z459!_5^5: 5_e4@@. 4@?4Hs 846uhu 8HH 87?_`"M@"h` 84 6>@!59!_4+H-Hk 85?5lL` hl 8Md@!h` 84K>K?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?ˀ}K>59!_}5=@H56?@b4Z_555_4^E5: H} 847ht 8~ 6HϟK>ϟK>CX7\ :? *7C ?79 7(4@+H5k>k>+`H34#B|_-Ӛ :Hz7WhwB_Ӻ?HzH 5C45 @:7D@4? 46ahaC>h`9 Hx7>77?P6?c=7>XӹD'I'A8G'QFQ ? hx44C57>_Һ 4HCPiHvB"@:Hs "6bhb4@W_5?HH} CPHuB!4Z J4E=Hs4!4ރ_!4ЋW=C>Ht4 6hb7hdC|4_ @>Hy+H4p B+H5  *Hx#C7,A_ҙHz4hf7A_haӜK>YK>K>K>@O>P1@\HsP@\%4H}47h|+H3phx4 8hx+H6   W4Z,_@474@4ˀb@ 4?Z 7?w&p&h8G&xFx@7?' '8G'F9 ?g7?7?''8G'F 9]7?k?7@P@+`@?4 b+`H8_k?+`_`<+`H9_K?+`h<K?Y@7? ( !k?/,/-ok?)k?1k?9k?Ak?Ik?Qk?Yk?a+`@*4Tj 0H?4^U 4JV 4L"j 544@+`4$+. 4%4^ 4L4 Jh_M@H`4' _h `Hj  !Z* BX@7?_'A8G'IEI 2H  h_4,@ Z7?1? '101n0N1 '9Ip97?1 &01n0N1 9$G&J  @C>'hF>hI>hH=h+`h?K>K?aK?YK?QK?IK?AK?9K?1K?)O?!/0-@/0,7B@P47?7Z?''8G'FB_@7?k?7_@_@K?Y@7?@`Z `9@!@4 !2]3 }V 2Z9W8 T?7B "  Ҁ Z@Z9 9:@7U7:6 :B " @ J ?u@@ 2 *@@ן@ : |@ : @ׁk?ok? k?k?k?!+`@3"6,k?14#_y!44@g_@Hf_M`| 4|!"4x 4Z J4V 4F j@tH| hwHa&hxHu_hHvhyHy_4Xh|HbGg@F(hzH@h}@tK?1_ ҙ>?@gK>K?!K?K?K? @O?k?7_U@_E@K?Y@7? ( !k?7_E@+`_m`<+`@?4 Z+H9p *+H:  #_U7,+`4h8+`K?YH<@7?k?7+H7 4k?@0h8 K?+K?Yh? @7?k?o #57#0+`h:_eh +}@"4#6 7O 4z+`H? #70K?Y4|@O? ( !k?7+`@?4 J+`H7h7_ @+`K?Y`<@7?4P? _ @+`_`<+`@?4R?m@+H4p 2+H<   W4Z-!_@+`4h3+H5p *+H6   7_]4:-a+`4h=k?7_%@+`@?4B :_ %@+`H:_5`<+`h<K?Y@7?k?o+`@#4Z B4 24B "_@K?Y@O?_ M@+`_`<4Zs "+`H8h94Bv (+`H704Mh?H: @ -h=k?ok? k?k?k?!_4~`7#`7@_4aB4A2+|7?C4%   +dp4?k?1 @:  O@  O K?1 @ ` Ȁ`448  # @(@4?4K>K?!K?K?K? @O?4tO ?G+dp̟4k?o #70CW ϟxK>c?7?c?4LCXc?CYc?C]c?CBc?c?@ 4pc?4 ZO @O |4c?4Lc?7?@w@046|?C0 `@46<` @x 4?K>@O? $ )k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik@4_7?Kq47_ 44775 87v  B67"79`7?@C54#b7?C4@  *7?C?7??7?C_  *7ZC_?7Z?7Z4 k=)7?k=Q7=Q[I7=)k=Q4@ "6k=QB?6# W704Y.N4 K=QCF :4?ϝx y+H3X`!ϝXK@O?ϟK>H<p+`48  +o 4:փ ? 4?6  _  ( !k?o7CCZk?@04c@k?!4J k?4L!*N4zaB@4J @t!J4L @x48!J4J!@vO 4zK? 4c?K?!c4?ς_mK?bK?K?K?! 34K? U"K?_560ϏK>#K?_70QϏ`K> w_4z0Ϗ8K> WK?4Z1_@4?K>@O?!7?7?_4z#W"7Y1Qk?)604 N7K?)@~_K?K?)= "K?_MK?=K>K?) #K?_71ϏK> 7_u4:1ϏK>ϝK>k?o4CW7# *#7X72!O7=7=7=ak?4(k?7?Z7?`7=ak?Bt c=c4`c=aM7=a K?W @H |_]@k?Mq7 BW UK? |4K<@O=ϟK<ϟK< $ &k?7k? 7?k?_k?@ ϟK>K?K? K? k?K? k?_EK?K?]74K>@7? ( ! $ )k?ok? k?k?+H74#k?A 5k?97E 480k?!421N4 K?!K?A42QN4 Hf44hwW@zK?!42qN4 H427?_h}4K>K?K?K? @O?+q0H&  UHw +yK4& +{490K+{ 7 K?944_ Hw42 k?)NP4+H:p4p7W4&h7p`RK?!43N4 Hp4316?_5hpˀ}K>+H: `+ W K?AH8 PHp+  `HpH6 X7? +HpH< H6? +HpH! @4]? = " +HpH" 87? Z \ 3+HpH7 06? \+H5 Hp+H= +d`HpH4  W 443HpH=Ht s W 4HpH5 s \ _+d`Hw4=  NHk?1K?Ay@ZHwK?1  :43N4HwK?14_M  +q0H?  E K?)4N4 +q0H= 43] +q0H4 Hs+|48  _ +dp4J`404#` 444``e2] 4z044`K?944@`4ςMK>k?ok? k?k?k?!k?)k?17$KE7C7 #H4744 N4@4@4 44@?44! 457? "bP4@ 4@?4+H8 @3 8 "46?a:4@?:"4?@!4P4R444h4b4 84 85 Z@RaR54 6?84 !6?"a(44@?-@  ! H "445)?"a 64"?4 e4? ˀK>ϟpK>ϟ`K>ϟPK> "4 "  e? ן4?K>K?1K?)K?!K?K?K? @O?ϟK> $ )k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?q047I77&6!54458N`44 4 44 (5%@4+|4- +dp@ 4?4.44H4@? 2 * " 5%!44 ` A??  ґ@ X 4 !@4 4ct`"4`a250\4f@R+H?d 4_U 5% 5%) !:A?!* ?׵)?5)#2  5%4 4 7 `!zAr#p4ct`*+dp4s``324:0\4fA0+H?b+|4&  4_# +?=@f?-@!4ct`*+dp4y``924:0\4~@+H?ab+|4=  4_ C `>@ +H74a+dph#+|4+  w +|h" +r46 +~@ _4<0 K>K?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?+dp4:0\E4' ;-@  `M 1`4 /50\4 5%+dp4:0\4 +  %+mh? ( $ )k?ok? k?k?k?!k?)k?1k?9k?A U7C 4G044!4 4Nx4w+H7 (44A4 NH4b`|04K>+{04(0+|4)H4`c?b*I+ 4_ g ` \]7?4_H4+H?4$`+r4: _ +H=H4? c?4c?4Jc?4g~c?4eA2BrHCJ+r4< Ja8+H% (44a4 4N84wH444 N4H^c?+r49 ? 444N4 c?4_}  +{04)0+~p48+|k?Q4*5 `c?4447?N 5H  @J ? ( 8`rK?Q ? _ P5I]  `IS 7?\ 5_5 `]H+{04&0+~p4(+|4)H4`@@c? `X4_  84I* 7? G @\=@4_gHH+H6 (vh$ (4K>K?AK?9K?1K?)K?!K?K?K? @O? )0 , )0 * $ ) ) .B ( ! ( $k?ok? k?k?4&\ K@@+4h= h+H"  R_@k?i+_H: "+K?i_4: +H< hK>K?K?K? @O?+H7@  wP 4z(7+H9 +H? #74k?I7?i_OK>+tH:NmK?i+tH8"wk?i46y5Nx4 K@^K>_m@K?i_ek?!!p+4#4ha hHy h4!+K?!_4: +H:P!+s44&` _@@4 +H5P Z+H6 BZ@ *_5@"6_U7MH| h+K?i_5h h+K?ih h_4#Hy hk?+ H9k?4k?B4=4?-@+k?7] @MD@+}@?p "+}I 4:p+}` p+K?Yh x@7? ( !k?ok? k?k?7% 7C#70@ !HdNi4+H7 H#57780k?! #h7 H75M|4 #W+7Y5H7K?!MD4 +H?4P h4+H8 HA"_6.+H346t?@L@!Z4"6_4+Ph& H+H& H`j#V_7Z.+H%44?@*L @ ˀK>4#6_e7:.+H<47?`*L@ ˀxK>4+h H4@ ˀ8K> V4Z_4 d4K>K?K?K? @O? $ ) $ -k?ok? k?k?+H? P4#T*+g4$`47`48_7 ht P _=45Ha P4545hu P_  H| P467ht P_ +tH:4&46!N E4 Hz PH7Vhv P_} H46AN H} PH7ha P_- H46aN Hx PH7hu P_ Hw P466ht P_ H P467hs P_} Hb P464Shs P _Ek?Ha P464=h} P_ H| P467hx P_ Hv P466hw P_ Hu P476h P_ Ht P4716hb P_U Hs P47A6aha P_% H47QN4H} PH7h| P_ H47qNM4Hv PH6h P_ H47N4Hz PH7Vhv P_5 H47NHx PH7hu P_ H47N]4Hw PH6ht P_ H47N 4H PH7hs P_E H48N4@Hb PH4]h} P _@H481Ne4lHw PH6h P_ H48QN4Ha PH48hx P_M H48qNH| PH7hw P_ H48NuHv PH6h P_ H48N%4Hu PH6hb P_] H48N4@Ht PH6ha P_  H48N4Hs PH6}h} P_ H} P497h| P_ Hz P49!7Vhv P_] Hx P4917hu P_- Hw P49A6ht P_ H P49a7k?! _hw PHz P497\h| P_ Hx P497hv P_e Hw P496hu P_5 H P497ht P_ Hb P494Xhx P _@Ha P4:43hs P_ H| P4:17h} P_m Hv P4:A6hx P_= Hu P4:a6hw P_  Ht P4:q6h P_ Hs P4:6bhb P_ H} P4:7ha P_} Hz P4:7\h| P_M Hx P4:7hv P_ H P4:7hb P_ Hw P4:6hu P_ H P4;7ht P_ Hb P4;14Shs P _U@Ha P4;A4=h} P_% H| P4;Q7hx P_ Hv P4;a6hw P_ Hu P4;q6h P_ Ht P4;6hb P_e Hs P4;6aha P_5 H P4;7ha P_ H} P4;7h| P_ Hz P4<7Vhv P_ Hx P47h} P_ Hb P4>4Xhx P _e@Hw P"6h P6 @_- Ha P4>147hw P_  H| P4>Q7h P_  Hs PK?!6h P_  Hb P4>q4Shs P _ e@Ha P4>4=h} P_ 5 H| P4>7hx P_  Hv P4>6hw P_  Hu P4>6h P_  Ht P4?6hb P_ u H P4?!7hb P_ E H} P4?A7h| P_  H4?QN4?qHs PH6vhv P_  Hw P#704?Md4 Hy P44_ }4K>K?K?K? @O? ( !k?ok? k?k?"u4k? w6x0k?!4y?4 M|4_ @+H7 PK?!4$4y?M44 +#H9@_ 7_4z?K?+H=67?4%@ k?L@,k?_4z@K?H6b7S?S@ k?LX@,bk?_-4zK?H77=?=@ k?L@,k?_4zK?H7\7?\` k?L@+k?_m4zK?H766?@ k?L8@+rk?_ 4z`K?H77?@ k?L@+"k?_4zK?H64?@ k?Lx@*k?_M4z@K?H74_?@ k?L@*k?_4zK?H44&?` k?L@*2k?_4zK?H4Z7?Z` k?LX@)k?_-4z`K?H496?9` k?L@)k?_4zK?H76?@ k?L@)Bk?_m4zK?H66?` k?L8@(k?_ 4z K?H66u?` k?L@(k?_4zpK?H67?@ k?Lx@(Rk?_M4zK?H6b7S?S@ k?L@(k?_4zK?H77=?=@ k?L@'k?_4z K?H7\7?\` k?LX@'bk?_-4zpK?H766?@ k?L@'k?_4zK?H77?@ k?L@&k?_m4z0K?H64?@ k?L8@&rk?_ 4zK?H74_?@ k?L@&"k?_4zK?H44&?` k?Lx@%k?+s@?P!4z49P77a_@K?H66u?` k?K@%k?4z4y_4x0K?H66?@ k?Kt@%Jk?4H P`J+g4&` _7?% H P4e_ 7?_K?!$ˀK>#77a_@K?H4Z7?Z` k?Kl@#k?+s@70 4z490 47a_@K?H496?9` k?K@#Bk?+s@8 4z@49 V4Y7a_]@K?H76?@ k?K,@"k?+s@9 4zp49 6497a_@K?H66?` k?K@""k?+s@=4z<#494yN 4H_7?$ˀK>ςK>ςK>ςK>ςxK>ςhK>ςXK>ςHK>ς8K>ς(K>ςK>ςK>ςK>ςK>ςK>ςK>ςK>ςK>ςK>ςK>ςxK>ςhK>ςXK>ςHK>ς8K>ς(K>ςK>ׂ4K>K?K?K? @O?ςK>ˀK>+tH:4$4yPN4H_Q7? ˀ]K>H4ypN14H_7? ˀ K>H4yN4H_7? ˀK>H4yN4H_a7? ˀmK>H4yNA4H_7? ˀK>H4yN4H_7?;HˀK>K?!_7?ˀK>_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ? '0 , ) # ( ! ) ' (0 + ( ( )rk?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y47E!044!+` w44$4z4yI 48؋ch7>HM4zC>4 *C>4 J? 4 L 84c@4J h4 L_ 2+48 p4^ 4zBh4$4%$ 4+`k>44$4I48ЋbPh+H! @4 l_:+}4:pk>Hq4E`HH7+4-+4,+4.+4/+|40+41+424$4 ?H Ii 0+H?`h+o h HaJZ I +`h `+h? H@$zJW Ik?6 K>J9xiIU6@(h臍#:#?u@KY@M@ i 0!K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>+H8 +`H9_E4+`H8!h<57M 4+`H:@a+`M1H:+`H9+h< [4zp4+#7h7x794xM (4+EH<x_E4z0Ϗ-K=KA@+`h<]K=_4`*"_6p+ˀh x+H. +`>h."w_}6z+ˀUh x_u4\4z+ˀh xh_4+h& `i 0HK>+Hh++h _4@HIIE;%@+H8 @_MH 4i 04Έ!+H6 @_M+_EH: +H3 @h_zH菟@Z)@ _4Hc?s7?qc?q[e4zh44x7M4@hHK>H`+h& `_4H+h p4+h<x+H(Lh hL4H_ zK>44Iu4Hh47M4H@H??K>L H+ h(_4H @jHaK>H *_u4+h& `4?h+H%h HC" BHK>[m4z+h +ςh&x[4zh4 4x7MP4HQK>H+h p4+5h<x ( !k?ok>k>_147E14+` w4$4z4y48+H7 !zK>YK>K>@O>h p7?H^mH8 paB+4ςh:x4IY@_]hH4O97?+H? 4z@k?4y`4H4h~K>YJ@h~K>Y4 4r>+4h9 p_4z0ϏmK>Y4zp_7?+ˀ5h x ( !k?ok>k>k>k>k>+H(h +`7C44$ Hh +w@64\V "@5 4&KhH؈#4 4w#z+ H7 44I4pha'ڀ b+H9 "+{6`k?4:I 6Pg7P4n 444I4؀B@h444 M@4H44 M4 H4Ct R7Mqh؀`0hH7?  0HCA &4n} 4h b+tH?"+`h? 6k?7?Y49 +tH4h، *^)H+tH:M}7MIHH4 @7L4H[ 4eh4&:4&*+4h:x4K>YK>K>K>K>K>@O> 444IY4hHcz7>HM14C>4 *C>4J 4L _84@4J 4L;4+4k>48 pk>^4h~K>Y4" 4Hk>40Lt4  Z+H9 +{k?4:4`I=4Pb7P4nH K>44IA4h}K>YEHHh444 L|4H44LT4 H؏;HK>K>^a4h|K>YH4S!r+^H9 parK>44@I 4h|gK>Y444 L\4H44L44 H؏;K>Y_40ϏK>Y w44z4yI14h{K>Y[M4+4ςUh4x˅MK>Y_4Ϗ-K>YϝK>Y W44Z4YIy4hzK>Y[4+4ςh3x˅K>Y[U4+4ς]h=x4ny 4 `4x 4 @4 _@+ˀh xςK>Y+H< 8 #7@@`B+H? `*4X@+k047p@ #7@7< 7<#@74X 4b 4N: 4>] 4z 4n 4 4R 4V: z4T_ j4H Z4< J4: :4`] *46 4B 4̊ C0`7@k?ok? k?+H8 k?!!0k?)K?!NIK?)+H?4 4$`J+y4% NK?) H4c_ 4K>K?K? @O?@J+y4% NiK?! :H4c_ ˀ}K>ςmK>τ]K>τMK>k?ok?+H9k? "4K?YK?@O?+q0H: +[)H8@7ˀK?Y+H$K?4^4#`ZH`"Z14H_@+d`47 7 ˀK?Y $ ,b $ ) ( !k?o k6k6k6k6k6k6k6k6k6k6k6k6k6k6k6+k04/p7 +`h84(k7+7C6 4?h6 4 4L4w+i04*p C 4 k7MK7 I؁-2 +H&04` +H%04+H9 +H8 +H*@04+H5؊ k7 4k7 4Vc8A,b+H9c754 4- ,i4P477ICR 4@ B4@7iCR?7?7 r,bU@ I5BwW"I4TiB ,IUu77k74 c84R4.78ICR  :7iCR?7?7$$bU@ I5CAA"I6iC$*,'I774.+g04"pC I4 4 l04+y40 M5+I5 +H?04` +H) 04Ik?78k?4#k?5Xk?4Mak?y+{4: 4"`58M14078i44 7;aIC_ UM BI7iB U ?II67iC U "+H3 7;a 4&4+H64o41+y42IP 4"`M7=aLm7=a`07457=a_5%BJ56_uIK7 4"`M!7=aL7=ad7457=a_5$+g07i78 77U%@778_=7I7C  :7iC?7?7k>k>k>k>7$k>@#h4?#ZL K>cH4L 4z`@7? 6ҕ@?7?!4 4^Q4z7?)4`07 @04% 000K?AK?9K?IK?)K?1k?4k?_k? `44zY4"j@>M@4$_]4 `[)4K>_57?K?_-K>K?a4 YE4#!p7K>Y4#!p7K?K>_4#K>4$_e44$k?4$k?4$k?4$`4$4$_ 44@=44?4K>YK>K>K>K>K>@O>M)4>=74_@Z+K?_}h B_eK>_=4%@4 [4 [4`>4M4z4 $ ,b ( $ ( !k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y4k>k>k>@&xk>+H(fZLK>fP7M 4&@7+q045 4& +k046p44p+4'k>+k>4(+k>4)X!W!C@0V4K?a'BCW4z 45Y%p_4 K?a45Y%_4 K?a45Y%_u4  ZK?a45Y%_E4 *K?a45Y%_4&B46ZM@  &*&" ' I< &`4 &K>5 5k?_]5xfR44 4$:+H7G" Y5Y##7_  M4z4b}@7?A44]4zK?I@?=@L@7 @K> >@K?IK>4_ 4>@K?Q@>@L@~}@M7%07K?QL6:H 46E:7?K>h  bI 8@ M!@MI6i 8&I 8L-K?I6 LK?I 2I 8K?I4_5=E@K>`$rH 44 k>`RH K>  M!@H 5k+_ K>7k>4h 4 4 4 4m+ϟ K=ϟK=ϟK=+H"+h  "K>  _E5Z%P04 5k4 `444zY 54@(4[9544G@|;5@L4zM7 76ZL u4y47?A4 ]]6ZK?I:@C4v38K?Q}@@9@6Z _4%_4&P_4& MQ4zϟK=5Z'`_M4y4LU5Z'g_5Z(_ 5Z(@4I1 $ _5Z(97?A47?A4 ]4zK?I _}4)0 MA4zϟh 74:)_544h  M4zH ZK> JK>#07 7*`K>_7* 4?K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> _4)Ѐ M4zϟ5h $ )k?7k?+k0H9pk?7?_k?+i0H9p_7?+k04:pK?_ek?444_4+i0H9p +m0` pK?_K?+i0K?_4:p4_7?4_7?+m0K?Y4<p@7?4:pNI4UK? $ ) ( ! ( '+H5?H3? k? ( )r & -B ( /k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+k>7DH7 w4y*k>4L6k> +H:+k>!4 H& 4 44 44 4 5k>UK>U5j4hk>_ / KHiGA6:K>QHJ3 Iqw 4k??iq5X5Ivhx߈ iv+H?0` ڃ K> 5@K>54A_54hx`r / K>9+ H0 h؂Y: O _]545`Hx? / Hx3+H?0s24024:24<2ʇ2ƒ2K>2K>5R+H:  r+H9 `+H9 *@2" 55K>)@K>1_@_ 56a+H? k>7?fk>_@Fh_4K>6Y?@_k>Hx7/H7/k?_M4_@k>!`r+g04,p4? 5z458_ 5W@ 4ފ425ke4?+H* #BC:4?c(4+g048p+i049p+g04:p4=p+i043x7B6E 5P55? B   ? Ҫ ( p`Z   ? " 0  / "  .__}4Ba  ֠ 6B  p ( l`J  ? Y Y P Q , - ( l`J  ? @ @ O P , 1 ( l`J  ? H H N O , 0 ( l`J  ? P P M N , /4B ~M5J ]%64ހ 2A:+H+ !"+H, ! 4ހ$ 4P4  `4+i04*p+g0!4+p50Q _  05  k?7K>!k?50_E554ހ " !50_ %4ވ*K>QKZ x*+H)(4? `+Hh 7IP44ވ0K>Q!K9 x_E50r7? 0h_m4H6??hHx6@ 44 zC,$7h4@C4#k>7hC?74H<K4n,k>!+H9 + 04yH7 K>!H4k>kH؀"RL @B87H4CH"5? 46! @5?H7=hk>Qh +H<04ޓ04 k>+H3 (bir+H5)+H4  :+H6 @"+|4:PMy4y+Ћ)4+`4& 0h I @@h844d=++H= 4z,@k?4y,p7>G4hiK>+I Mh3hh4‚%+k040p+i041p+4.+k0442I !06Hp5H4 K44` 4ދ(ҐP44ވ K> @ 4P$ "K>QJ6  K> 4ވ "iK>Q5 _JY xi+H, (+H. (+H: 8LH؈(ZH_4z.h4K>'Hؓ04xC'K>Q4z._%JY x+48h<x@ X6HpL@  L@5 ]60hH؈ I hH؃ &K>QK>Q_ %7 xJ x+H74l-h4Kl5HB2HeZ8H+H44 \k> H_4<704x 4x.H_ =4z-H54 K4g51aK>QK xgk?5/k?_ 4`4 +r4)+y4*+|4++4- L , I5k?51q_ -5 l 4? _ 51_ _ 4z$e54ނd&+H" +H? (+H8 hk>A4v_ k>I4t +h h_ 4+H5  +H6 h _ u@@7 2#072ѐ 72_ 71B#073 74!_ m73+h h4∇%jk?444zW4+h<x4'4ހ(Hx'+H?؀'"66_4K>A4k>46U+k>Q4h? @=4P+H5  _%4z*+_4z++4 h)04z+`_4y++4 h,0_4z++4 h-0444o,%k>!p44ވ _4z-*04y-0 4y-p_4z- 4 _4z.@+4h:0K>Q_H: x @_]4z.+xh x+HH8 8_4z/ 4ހ JK@+H"@+@+H- +@#+-7/q %7/+4h900w4K> :H_-5K>H+H4: 8K>Q5_K xK>Q+K>J x4: 8_4K>Q4j} 4458^%5Wo4+4h80!504ތ8511K>Q51QK xk?5/+h'x+i04)p+g04.p+k04*p+!k>94'+5/k>14++5/44,4(uk>) 04H؋ O h؉%7K>Q+H! %K>QH_544L54k>$K>Q+}41p4Fm6:F55!+FH:+H5`4? k>F4IJihJ4K>@J4554yHq4FEk>K>4K]H؇cWHF6:5+H.K>A@K>A+h1 +K>Ih( hHx4K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O= ) .B (0 + ( ! ( . $0 !R ) # $ 2 $ )k?/,/-/.o7?(b4>hd8he@hfHhgPhhXhi`hjhhkphlxhmhnhohphqhr+hz(6h`87&h`04hy7Hz?H6hz +H7PHj?hw4hx+Hk?444 @ h6 (K%5Zh|0`4 4 44 _Hz(#2"Hx(664K4?h`4_m@ "+H8 H *47A! 5RU6֠ 704gp4Gb 0 7O"g@67( 0 a 5z- _}5I?`:IU`*7?'`J@+4L 5+b54} 'Hr800N08G'H h L * K55T&E4t81n&I.I_0 0N1&E^]775z- _5>@UI?(rHm8(bIb4bHy(_4 :"Hx(466K4h`+h&+@Xh P4 @L  h|8`Hw8__@`+H7`+H?`+h7"7+h?68"hx67K4 +#H7Hx77!KX4 +49>Q+h H+hy4,h @4_ߏZ44|"' 6 +1,@ 4/>Qho1n!5 4@+H6 HHz 6h< H *Hz Hy4_4$ZI @7`i @ 94HzKec>S !87Hz5Q 4~k?i7>k?q7?q7?iWm5Z+tH9L5Z h`K?i7>]~h}0ւHs0  6]@Z+tH:K}Hy+t WH7Hz4Y"`LY686P `B߈K`+tH94  `bH7 J8u@`2  W6 0 7 + HzKu ph5p 4q% &)00N08G&1H1 Ehs@ !zHa8Hp@Hy_0 P4 !:!z+47&E4w8+&1nH?+0H8 0N1&E`6`#Hy _7- +H?`J+H5`27?@"I@544 4Hy4_M߇[+u4#Hy_7- ?4+47aHy(_Hr  J+H8 @47q "6@47_EHy +HnH+ (+H|h.P+h++4?h1 (Hb?HrHqHpHoHnHmHlxHkpHjhHi`HhXHgPHfHHe@Hd84~@O?/0./0-@/0,He@4H44b D!W$H 5I -  1+4)1n+4*!wLHz8U+k?ok?+H7 4# H 4`RH Hw   L@Hw H 4_ LHz h` h` K?YK?@O?k?ok? k?+ 4:`k?!]q49+H? 4AP4%H AH AH A+H? `B+H? XBB+H? PBjH ЇBH ȇBH "K?!]4;4cH @2 4K?K? @O? $ ) ( !k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+44?k>4 ?4 ?4 ?4#+4 ?4?4?k>4?k>4."+`4?6 (k>4?4?4?4-!@4I "w+{Hy 6qk?4:5=G}67c0iF@ӟ0t4 0z4F@ǜ Fq@ǜBIK>6?4? i JI +{Hy k?4:@5=G59i苀bjIuk> 2I 5=5G69biCI+d`H: K 74I)@ai葀Whl `Whk @Whj ?@ +h) PWhp K>@ K>hz ؑWhh @ +h& `Phe K>Whg Ȏ@K>+h4 XK>?@ K>h| АWhd `+d`H9 _ 4z +4ςXh5x>u@@K=_5=!Ϗ K=_5=q4?K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>ɀI ͂uI beI `UI @EI B5I "%I I ›I I ̦I ̤I ̢I I I I 4uk>ek>]I MI 4-k>k>_5>!ϏK= ( ! $ 2 * " $ - $ ) $ & +0 , * "b $0 !R , ' $ ) ) *0 % * (2k?/,opk)k)k)k)k)k)k)k)k)k)k)k)k)k*k* 4?k*4?k+)+k+14 k+94k+!4H6 k+I+k+A4 k+7>k>4?k>k>h6xk*k>k*k>__}c++H? 4$H H k*QGk*Qk*Y+H8+k*IWk*I@h8 (4k*Y+H. PH H H H k*aGk*ak*iGk*ik*qGk*qk*y Gk*yk*@Gk*+H? `O +h? k*q JIB +{H k?4:@4=G49tXk*q4k*i7=iH=@74>4 4KH7`qBI*-jFa@ӑ20t4 20z4F9@ǜ F@ǜPI(K*4"?@4? @I( 04244?a5G4jIA4:5x0iIC70LiIB_H3I7iC1L Y6: L y6:7IC=7=i4 C4=7=i4?_5y4?k+"JI44 X4 . Ix4_7+ 5` . ? . IU4 R N Ix4_M7+ .5` N @? N A!RKY7374A*73 KE5K*k?4735K5+H1h >_K*K73+{ 4. 7K5 4r/@73 Ku454O@"73 6:K55K* jH  ZK73H 4  7M`"73H K41K*i$Kq73H K+A]La7H H w =H H 73K H 7+7_h K*ik+I+H5H H K+IK*y_=k?H 4a+!W5I 4(-  +4)H #77:- _ K*I rH 6W?` K*a JI ^4cI06?@I @?4H 4_?H K*a?K+)B?x4`p41Q@77=iIA 4k?4?5H4c4F+44Fx. 4B}4Bz-4@k7_7=iI_-7>57=i@7'7=iIW 405G!4cI_7>4  *IW 4=5G4k4ICk*+d`H: K7=7=i@6/7=iIX !k?4?5,p5F4kI(4>4?+44<_57=iIk*_E7+K*i !5- _73K*I zC+ K*a Z+H0X4c+H/5?y@I`@94C+0zK*9r_K+!K+ _]74(k+k*h 0H CJ7CR#:B)k+)k+*k+H,(Ix44J,5 _Iz؀ KIzIx4 7?Bk*40JӷK*IxC4ӷJ|4`_@Ixk+44J<7:k*)K+iK+K*\59Iz_ 44?k++tH:"+w6 H9 M15X+tH4+`h4H 4+h+wH,=+wIy_ 544?@k+h +H H7 Xk*Gk*@k*4k*H Џ\+k*h?0 04_ @`J+H?`2+H7`+h?+h77=k?q4k?+H 4h4+k? WH3 4Fk?7=k?4*+{4"k?y 4>a4 7=iH U4k?4k?4>IY k*4>k?4k*7=k?4zk?yH k?qk?4IO k?5k?4k?4k?y4tH mk?q+w4-+`4."6 mk*k+_ 4=!4?k+_ 4=q4?k+ k*Y4 k*Y4 k*I k*I k*Q4 k*Q4 }k*a mk*a+4 Mh< + 5h k?4I\ K*K*k?4k?7=k?4k?yH k?q 7=ik?4IB K*K*k?4k?7=k?4k?yH k?q =7=iIA K*K*k?4k?7=k?4k?k?yH k?q 7=iK*q0k+4 k* }k* mk*i ]k*y4 Ek*yK*4 %hZ0K* k04 k* k* k*Pk+@k+I k*_=4?14?k+_4?14?k+_4?14?k+4?_5y4?k+_44?k+I_7> 7=iI_}7> 7=iI_U7> ]7=i_4@4?k++H9_4p+xk+ mK*+|Ӑk*4: P "`k+ hk+K+`K+ :_uIz؀ "Iy_4h4?K+4@ 4p@4 4@4_Iw4?k+K* :+d`H9 _}4 +d`JH: h K*i K*Y K+5Ke  @h +H2 _4_4@k*i4K*i4 J D4K* k*a`K*aK*a J+d`H8 Iz_5Y+d`H9 _44cK*Y k?+K*IK+h$44E 4wk++H" (+h"MrK*a "K+ `K+_44 (k+K> 4M7>+4h3_7+C+0WK*4k*4k*+s4) 4k*+s4*4K*k*+{4!k*+ WQ04k+4U . 4+4  K>K*K*K+K>K>K>k?4 k?7>k?7+k?k?y_k?q`_I7+C+_7+7447+J7+H.`4047+J5   " _7+ C+K+!5k+! K+)60k+)K+1K+961k+1 M k+9K* jK+14P4J7+K+ K+!7+_ v _7+ C+_!7+744p4J704A pK*K*Q"AA 7? V4 6? \ `@K* 7 @K*A A6? X\  A7? 4=? P74?A   Pb  4S?AAA a  PAAӶҵAAA  4"?6?6?S ӝ O A|7?  B6?Ґ r :k?B 6?7O?  ! :k? k?k?4K7>A7>Ac>A4ZA5c>C7>UAc>EAc>Ic>GAc>KA c>Oc>MA c>QA7>AK!c>SJ7>Ak+A7+_1c3k*444 J7 @K* Jk?7+k?40K*4`Ky73]+7+k?4p4`73K15+K* 7+K*k?7+k?473K5+K*K*_44?k+J-73+46&7*1\01n&A H01 1  0N0N 1 1A &QK9$G&IFIQ  4 N xE+k+K*i"K*aK* K*qdO+K*qD JK*q "K+AK*q7S0k+I4,k+I4k+IK*q䀿+K*q +K*q 4K+AK*q7]k+IH 7*1J 5$  \0%YH 1n0Ig 0N0 9$G%@J @  4 JM@5&E \8%HI1n0 0N1 %PI P x%I0pk+41aK+1 047aK+9K+)K+1k?` 47ak?_k?+H?x@"+h? +4?h#x+H? (@"+h?+4?h$ (_)@K+ `+4 h,xK+K)YK* K*K)K)K)K)K)K)K)K)K)K)K)K)K)O)@/0, +0 'k?7+H5"P"4  84: X4Z+H7 +`"w6yF%48+`ah<+d`H: +`"H9L 6 +d`H: +`Hh:+`a(h<+tH?+`#h? Ma7@ 7+H8+`H: +`#8H7K Y79P+t#H847`JX4 +t_H:+`h<蓜p4+h<x_@K?Y@7? ( !k?7 4?#7 8 +H<+H6Ģ+`h:+H5  @#+(h:+H4  @#+h:+h: +h:(+h:0+h:H+h:P+h:X+h:+h:+h:+h:+h:+h:+h:+H?+h:+h:+h:8+h:@+h:`+ h:+h:+h:+ph:+Xh:+@h:P+H7 +!h:X! +h X+h `+h:H+h:0+h:(+h: +H3 j+Xh:+@h:+(h:+h:+h:4K?Y@7?+h:+h:+h:+h:+mh:H"_M6pϏUK?Y#_%7pϏ-K?Y+h:@+h:8+h:` X4Z_@ϏK?YϝK?Yk?ok?+#4:`7k? \k?K?\4+H? 4@+H? 8@+H? @@+H? 0A+H? (A:`!xK?\K?K?YK?@O? 4 @40\K?b-+ 4:@4:\qK?b+ 4@@4P\1K?b+ 4;!@4;A\K?b+ 4:Q@4:a\K?4c`>K?\4<mK? ( !k?ok>k>k>k>k>k>k>k>k>k>k>k>+{4(+4)+4*+`4?4?4?#74?4?4+7, !!@4I_ I9 k?5P5=FU5a`i|E@ӟ0t4 0z4Ei@ǜ EI@ǜAIw4? H @`i|@ +h' (@ +h& 8@ +h% 0@ +h$ @@ +h# +4ςXh:x?=@@K>Y_5=!Ϗ K>Y_5=q4?K>YK>K>K>K>K>K>K>K>K>K>K>K>@O>I_ uI_ ̢eI_ ̂UI_ EI_ 5I_ Ȁ%I_ ̂I_ bI_ `I_ _5>!ϏK>Y $ ) ) .B ( ! * " $ ) ' * "b $ - +0 ,k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y4?k=4?k>4?k=4k>4k=4k>4 k>4?k=7>k>4?_+H4 +H3+H? @+h4x+h3 (W7+H? 8K+H? 0+Wk=H? (K+H? +H+ +k?4k?7>ik?q"H" 6k?4*+{k?W74/P k?y4>a4 7>!HY5k?7>iIV k?4`k?4k?5k?yHk?q&+w4++`#4,7 44"_7>7>!H@fH7Ip &:Ea@ӟ0t4 0z4E9@ǜ E@ǜIIr(Ip(@4?  JJIX J%4 `JJ4 ,j IZ _@#p7 K ``5)IY _4 I576?@ 5H @+4 IZ _5@IZ CB@&€>@K>K=K=K>K>K>k?7>k?k?k?k?y_k?q~M@_?IZ IY _U4 @I57\?~5H |@*ɀIZ Ђ <7>!IV 4k?4?5G5f 4 'r<_I؎!I_=7>=7>! !IW 405F5eI_7>4 ;7>!IU 7k?4?49,p5E4gI(4'4 _;O7>!I-k=H2_]IZ _ IZ Ј@z K \5)IY _4 I57?|5H @(*ɀeIZ ix\OIZ IY _e4 I56?|5H@'ɀIZ IY _4 I57?l{IZ H$@'Bɀ}IZ Ў#+wH8&"+d`H: 4*+w!$H9 LI58 G@e+H0  +H1  %7> K>4M@7>IX 44 I4 K=IY +`4 4 4 4 `0h9ؐ`04 _=4 5_e@+h< p+H:8+H!4k?4_7+H5 peK=+44.`h7x#_m7$+4/+t0 40K=d `"w_6z$+H-55?@H<@$Zk?`047a4 ` 047a`04 #k?4 k?4 59_=k?+ k=!jk=+h? +h?  +H9_4k=_}4=!4?k=_U4=q4?k=_-4+I_7>7>!I_7>7>!+h. +h _4@+4Mk=”E7>!57>!+h.+h 7>!“7>!k=Ik=“4̢7>!Ƞ7>!+H9_}44?k=_U4 04?pk=`k=_4 4 ?8k=TIZ _EIZ Ѓ85IY _4 I5Ek?`IY _u4 +H?x@"+h? +4?h"x+H? (@"+h?+4?h# (K=@`+H%xk=K=KK?K? @O?_40ϏK>ϝK>_4 ˀK>_m4 `+ˀeh x ( !k?ok? k?k?k?!k?)+` 448k?14k?94#F 4gxh|+Hz48 p[!4yGh|+tH:+` h: 4%Ja4 +tJ)H:H Hw h 4Bk?I 6ht7Hf4hz@h  HHvH 6hh6hBh ?uH 4@7B?h 4Xh + F4 H8 K?1k?7?qE4h|e2K?qK?14 I4 +H:Jhz؏c"K?q+d`4H: k?AJ}4(I H hv6h}7:Bh  H!HtH 6hx6Bh ?H K?16?h 44h 4 &+H= 7?yk?EI4h|dK?yK?14@I t4 +H:Ihz؏aI K?yJK?AI H hu6hz7Bh  HHsH 6whw7Buh ?H +7?h 7h 4`4`H" 7?k?E4h|bK?K?14I 4 +H:I]hz؇`_4@ϝK>I K?JIK?AI H h|7hw6Ch  HHuH 6hg7Bh ?H 6?h 7<h &K?H aZ7h 4|4H K?17K?9h 4F @8h|IHz؇`ϝK>ٓ74?K>K?)K?!K?K?K? @O??K>_40ϏK>ٓ74?}K>ٓ74?]K>7h 4x+tH H'#$78  x7X?K?9[14 @_4 ˀK>+q0H: +4H8X4@h|+{49 @X4+q0H: +H8X4@(h|_4+ˀh x+tH844 I4 +H?p+d`H( ]  JHzK?I[ +=h<x ( !k?ok?k?+H? "6 7 x_4z_}4z 4z4_]44z4_=4_-4z`_4z_ 4z`+H=47?4$@ 4H @"4_4z_4zH46?@H @"4_E4zH46y?@H @@"J4_4z_4zPH47?@H @!4_4zH47W?@H @!4_E4z@H47??@H @@!z4_4zH47?E`H@!:4_4zH46?%`H@ 4_U4zH46?|`HP@ _ 4z04K?YK?K?@O?ˀK?YˀK?YˀK?YˀK?YˀK?YˀK?YˀuK?YˀeK?YˀUK?Yk?ok?k?k?7F4 4#7@##X7Y44 I4@R Һ" 6@7?R  * 8 Y 9   4%?@4t"b4@R E"Z 8@7$?R  * ? BB  7D?4xda@4t 4@R ! =@ӳ6c?R UҺ * 7 Cc : 6?4xaj@4@ҷ`4|!B  B  <    #778"64 I4w4|K?YK?K?K?@O?{4|4|?' B4|4|u4|e4|U4|E4| ( ' ( / '0 ) ( ! '0 " ( )rk?ok>k>k>k>k>k>k>k>k>k>4|+47D4 ?$xh# +H8 4(k?+` #4&7`447D4 hG1@exh?@ )$h4$$4, +H:@%+4'+4(H _@%hh :I p *_@ebI p %b]q4H5?h`__H |\i\ pI I k?5z04Fa5>ehIS pK>Y+H4 4(+`k?4&44 47Dm4h+HAph #J+d`H! D4U k?!7?k?7?! +U=H:+d`_H: Ћa77?1k?q_7?qK?qK 6K?q K  K 6 LK?q J 6"J K M@ ?`"k6w#  H4 `h耊 ʀ 4, ϝK>Y4,= +H= 4(#W+`7Y`k?4&4`47D 4h_-40ϏK>YG@{]hK>Y+h p4*+{4++4,=!_4Ϗ`K>YH ` Z T T  _U@+h#x4K>YK>K>K>K>K>K>K>K>K>K>@O>]yH+ςuh#x_4 B+Xh x+ˀ-h x+ςh#xH+u04h5xH<x +0 * ) .B ( ! * .r '0 ,k?ok>k>k>k>+H$ +k?4k?7?)k?q H4 +{k?4&k?y4k? 4@4 4G!7>k?+k?7?)H= k?4k?4k?y4Gk?q+w4&+`444'7>G@bH""H 4h+wH?(C+t4%+`HH9Im4&I=HH+ 6H7 h44/D4؋bHIHG @hAH44I4 H44I4 _H"*_HЏ@z+H<  b+H? +H5H!+H!H+H" @! HH_4pH_HЋa+H7 @_ _4+4h:x4K>YK>K>K>K>@O>ϝK>YH( "   b4<+w7>_4pϏEK>Y?7K>Y_4@ϏK>Y_u4ϏK>Y_U4ϏK>Y@" j@ @‡ HH_4+H= @_ӺϏUK>YH_4+H_4+_e4m+_E40M+_%4-+ ( ! * *bk?ok>k>k>k>+H5 +k?4k?7?)k?q#H3 7k?+{k?4<k?y 4@4 7>GA4k?+k?7?)H= k?4k?4k?y4Gk?q+w4&+`444'7>G!@aH!!H 4h+wH'(b"#_7pϏpK>YH:IH9G!@+`a(h<+t XH844Y`I p4 +` H844I 84  8+tH9+`H8 8_4:p+tH:+`_H9ЈA+tH9+`"H8_6׏4?K>YK>K>K>K>@O>H( "   b4=+w}7>+tH:+`I uH9+tI9H:+tH8+H7 +`6"h?648D4}O+`>K>Y"x_6z ϏK>Y "_6+4ς=h:x ( ! $ )k?ok? k?k?k?!k?)k?1+H97D e4#+tH%#D+`h% 7Uk?49 7?U4@:+tH$#84794 I4HcZ+}@ 4%  #*+H9p4&+d`H3 9 ]} 4'"!50k?AQ4 Ha5@!  QU4 zH|5P  Q4 :Hv5`  Q4!!74Hx5p   I4 @4X @X @Hw558Ip4 HAB  @!"HpH 9 S K?AQ4>4Hu5@  Qu4>4Ha5P!  Q-4>g4Hw5`  Q4>4XY!8#Hw759I4 IY4aHk?JQ7Hs+d`4& 6  07J@Hg4  Jk? "_U6+ˀh x4I4Hx!7 E4 5I4 PK?Hw+d`4? 6  4_ K?+ 4h<xK>K?1K?)K?!K?K?K? @O? ) ' ( ! )0 ." ( . (0 "k?ok? k?k?+H9 +H? 4$#+{ x7k?4:`4xE 4`X7FB"C(Z_4fZ_4z ϝK>ل!ˆK>4z!k?4y! 7?yD4eK?y`_U4z!0ϏK>F5@er+K?yH: +@ J h8 +H! J 4:+!hh< _4z!pϏK>F@dk?y+tH9_m4+ 8h<x+H$X +tH9_ 4z# +@H<x_4z Ϗ(K>ـ _4z ϝK>+tH:IK?+tIH:}H ϝK>+tH9_U4+hh<x+H5 "_4z!+ˀ(h x_4c_4z ϝK>+tH:IK?+tIH:cϝK>+tH9_E4+hh<x+H4 "_4z"`+ˀ(h x_4c_4z"ϝK>+tH:IK?+tIH:|@ϝK>ُ "K?_-4z#ϏpK>_4`_4z$ ϝ8K>K?+m0h +tH:+m0h h h h h xh ph Ih&+tI H:` ϝK>F-@@hk?y+tH9+m0447p_4+h<x_4z$p4?K>K?K?K? @O?H 4z `k?7?4D 7?y{oK?y?K>_4z ϏeK>H 4z!7?E4|5k?y?K>_4z"0ϏK>F@k?y~K>+H" @<+t+H< J7+;h< _4z!pϏ]K>H 4z"7?E4|-k?y>K>_4z"0ϏK>H 4z#p7?De4|@=K>_E4z#ϏK> ( ! +0 , , $ ) &0 *R )0 , )0 *k?ok; k;k;k;!k;)k;1k;9k;Ak;Ik;Qk;Yk;ak;ik;qk;y"k;!8k;7W659$k;4 H4xk;+4?h? +h? 4445$$7<7<4?7<7<"K;4$/"K;4v2K;42"K;4 :1K;4܀Y0K;4 2x0K;Z0Z59%`44H,459%4 4xH4+ bIx +H9 k?+{4:`57+pE4xi\h Q \7>qF-@h59'@4 4xH<7H@hI,jDI@0t4 0z4D)@ǜ" D @ǜT*I(59'`4 4xHt6766K; 4?V +H! 3+H" H@3 K;k>yk=k< Q U@>O7>qIw 5:04E 94ysh @ I@IH4shI7  < @=7>qIH Q ]@=W7>q345:*04E 94yfTh@HhI7\h @ I@HI6z   @qIH Q E59*`4 4xH6W@<7>q45:*4E 4y@h菛%h@HhI7h4h`JH  7  7h 1  Q ߀ I@  IH؋ZhI7  Ճ: IHu7>q44E i4yph  I@  @HhI7YhI7   @97>qIH Q mI} H9 +{k?4: 057+`E4xbdh Q @87>q+I H9+zk?4:p58+E94w@h菛!h+H8H59+H 4H Q р8=?877>q_5:+4 ?LhK=`4k=+h10+H7+K=yh70+H6 +h6(+H3 +h3 +H= +h=+H: +h:+H9 +h9+H8 +h8+H2x+h2+H+X+H*p+H<`+H"X+h++h*+h<+Ah"+r?4< ( ? 48+7_Th?7 8YT 7 0T 7 @TB7 HTB7 PTB7 XTB7 ` 9TB7 hTB5904 H 4xH44 H l5+H-8+H,P+Ko4(+"&)_5:,4 ?xh5$%P59%`44H4459%4 4xHT44+H! ##k?+H? +k?4k?7>k?q4+H0 +{k?4? Pk?y58&7>q4 F4w‰Y@+4ᖸ`45$$459%`44H$459%4 4xH45$$59%`44H4459%4 4xH4E+5$$59%`44HT4459%4 4x4H4 k<k=i4k<5$%59%`44H4459%4 4xH4E+4k=Y5$% 459%`44H<4459%4 4xH 44k=Y5$%@59%`44H4459%4 4xH4E+5:%_ 4ϏpK:+H? +k?4k?7>k?q4+H0 +{k?4? k?y58&7>q4 F4w ʀ 58&@58'k?+H?k? k? I I k?y7?k?7>k?q4F)4wpk?k?7?k?58' Ip k?7>k?4k?y4wFk?qk?5.)0k?4k?4 k?4xk?y4wFQk?qk;+`"w6o pk;4$+w4,5/(k;5!(P4 0444 k;_5:=!4?8h_5:=q4?h_m5:'4?h_E5:'4?hk< Q k=Ik=k= E3z_5:@4?Xh_5:(4?0h@)7>q-/gK;K;Iw U4؏2 0059)" 059)_6- 4?h_5:)4?ph_5:*4 ?Hh@/+ Q n+wH9(_m5:,P4?h+t!H:IY J 5 H459-H4 K;59- 4 H4xH@ ,K=YK;a(h459-@4HH4x45:-p4D4y@h菛0ʇ3H"I HJ 6 4k;2+t!I IY J 55 HI ЋR44k;3?H45:-4Da4yHh59.7H4H@/2H!I HJ E5 F@O8h4k;59. HK;H84K;H@5(.`Hh459.@H4 H44 H5HC] K;z BK;4܀? *K;4\ K;4 $L J_u5:.4 ? h!J 5 HK=Y `4?HhC _5:. x7<+H+ _5:' @7<+H, H _}5:/ 7<+4 h+8+!9H7859/4 H4xK=i`:K=` 4k;K<` 4k;K<`"+tK<49K4 B4Xt4 "_Y5:/4 ? hK=y@+H7 * "J_K= *GK=*7K=HB@*K=_5:014? (h+ h: + h? +H* +@+h? +h? + h? + h? + h?x+ h?X+ h?p+ h?`+ h?XK=I `b+h P+4h78+h 591!4 H4xp+K= `R+h +4h78+h7P591Q4 Hp4x+H7P5914 H@4x+H7 5914 4xHK=ـ`+K=H1 H+ h1+Ph HH=5ZIA7+7 h< HH5YK> a+H6  (K>_Y5:14?hH5Z7_)5Z!Iy5 75zH]5Y5? b 4^ "  _5 l  4 5 s _q5zhIy5zH @*5:2!_5Y4?h+4:_ 5YK>`+H5  (K>_5:2Q4?h@04zCN "_Q5:24?h@@+4:_9745924 H4xK>)`+4h8+K= H2H+ `h2+h H+H7H5934 H4xK=@B+H+ph7p+h+59314 H4xK=@B+H"Xh7X+h"593Q4 Hh4xK;"+Kk>k>k>k>k>k>k>k>k>k>k>k>k>k>F7C+`Dh<4d#j+ "H74%446H (4 HBd+}@464'p+{414<4Jc?+~p4 `4(c?+{4)+{4*+4++4,+4-+4.c?+4/k?+40k?+k? 44144`c?d "H#  C% _E@H7?6?7   VhH7hI: @_IY HIt XIp 6x? I HIp 7? I @Ip 7B? 9I 8Ip 7? ZJ 0Ip 7 6?< J" Ip _ 7?V @4!+ "H74%446H4 }H47c+~@420W +dph, _ +|4.  W +r47  +|h& 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ϝmK>Y+ˀMh xK? 6  V-7?H@"K?K? _ _  4{4`>HA+~@4' 4,0+dph- +|4+  48 +d` 4#  4% +r4/ +|h<    7b_u 4+ˀh x+d`H9 4# +H$ +|h$ +H4 (+dph4+|4: +~@4)0+r _  ? 74+  _}h 4+ˀh x+H59H39 k? $ ,b ( ! $ 2k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=+H$k>1#14k>) k>9 4K>1444 H4+H7p444 H4+H7454 H4+H74514H4 K>)445QH`4 HK>)K>)7@4t Z`(4K>) ?K>)4 %  @ K>)454G4K>)4\B$b4@$R$J+H?p$`4(g+q049 +}p4: +y47+}@48 k>+{420k>!+4)k> +tk>4*+xk>4+4 B4 X4d+d`H= R :K>14^|#x+H:K>p &K>14^X @4I0K>_E I"K>!  I!K> GvAIZ"U6 !I"K>!IZ Jp6qC_  *7ZC_?7Z?7Z iz4CV7_ J`:7i6Cҗ?@@4 X6K>)_4' :`4467>4_6'I:K> Gy/IZIp'rIp 74748G\4 `'V@#K>)_4715K>)_45+h x_45+h xH9K>  4H 5646a45GT6`4A4#K>96Rk>9 DX6XK>)4_7> b :@`44647>_E6X 4610-50$#Ip477G44 `$b+H?aK>  !zIp+d`H2 \\ !J"60PU4!+H5K> ! q5@P4 +H4K> X 4YPP4 R+H3K> s  8_49`PM4 _ M4V@V@"IpX+d`K>)_475K>979?0k>9 K>9@]_61 E61=761='61 61<61A7>46 X56]@86RC,` :@?2"46K>)4G44647>G6W`;44bk?7?k?7?7?TA7>4b7>J7?IpK>)+H3 @c?c4u _7>045K>)_]4715447a4 Gd5+H4+y4& 545K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O=e5k?7 7_"p6C4] Rk?H7K?7? 4  `7K?Y7@7? $ &Rk?ok? k?k?7C 4#77#@w!"Ȁ4 4"k?464_=4y 7#747:k?4_4y B̂@4N4 4J 44K>K?K?K? @O?4?4@w?4?M4̂}4N=4ܟ=4L z@u45 B#477k?44y_47P444H_ "4 4=4@}0P4DP4]4 $ ,b *0 % "0 )2 ) .B $ 2 ( ! +0 * +0 , ' + ) ' ) !k?ok:k:k:k:k:k:k:k:k:k:k:k:k:k:k:+h x+h p"k;A6k;4$+m0k;q4%+{k;4=+rk;)43 +k;14&+x 4'+tk;Q4(+`4)6 k;Y+x4*#7k;I+4+7pk;i+d`4,+m04!k;9#7!#W7.P7Yk;!59k; 59a4446k;H K;!5:AD7;7}0k;_K;k;G7K;Qk;თ]IK;H i: H K;!5:DI7;7|k;_%K;k;G7K;K;Y 6k;銑|I5 K; 6H iZ+H= @ItpI:  IY_M4?H @4 G $67?AH6P4K;!5>!4 G6H p7h pX@7F7k;+oH6>I "_]6@O6\H K;!7>C7;7cHk;_ K;ZK;iY "+H8.H p4<‹R.+H:ГP 4uH p 4?k;K;+wH7(h @]h6\H0( 4 j]86\](6\]6\]6\]6\B@?4BT  0H p4B "4B "H p6}h pK;!58a4 G86H p7h p4b= "58a4 G4H p44_h pH5xK;! 458q4 G6H p42 h pH6xK;!04584 G 6H p6X @h p@74?6\K:YK:K:K:K:K:K:K:K:K:K:K:K:K:K:K:@O:+q0H: +UH8W4K;594G6H p6h pG84 H @+H?`  4H p04H p6uh pIbpH9 XK;A " J66?04P42 2+IpH1 X ? J}7t59AK;!4 G6H p7h p_E59O}6\eK; XK;_@W4K;!594 G6EH p_@K;!75:4 G70H pIK;QK;i! 59 k?!S]7?!I_5k;K;!75:!4 G7]H p[<6\_5:O6\_5:]6\[;6\_a5:O6\_A5:]}6\K;0K;PP4K;!5;4 G6H p7!(h p_5;qO6\I: 45;_!4&I: +}p=H1 FI: 3UI: P@<H ]E6\_5;qO%6\]6\IZ45;_Q4 +}pMH2 IZ45;_ 4 "+H!K;1 FIZ#IZP@\H @]%6\H @045< Q(42 H @P0T45< Qx42@H @0064O5< Q842 H @045< QH42`H @0845< Qh4Qb5AG `4 +}41P45>q4 G (68+4045>4 G6+H7`J+}@8P4`V`"+@94`?@ 4`K;!Du4I G 7I 69k;4 OI K;!75>4 G7 zI ]e77I6K;a H4?K;!k;a5>4 GX6I В0p45?K;!4 G6G_@W4H p_6ZP4uH p4`K;!5?aC7;7.k;+oH2B.I_5?O=6\UH0X-4`4` 4`4`4`4`H0 `_a59O6\K;4J B+4K;_Yh0+W4h H p6:=h pH"K;!P 4504 G6H p7h pu4b4`4`H90 4]U6\_5PO56\ $ ,b ( !k?ok? k?k?k?!k?)k?1k?9#7E y74y4 4G`4_474y4 4G 7c4Z zE=@04C 24@  0??@044@E"r4%$*4(r"4?K>K?9K?1K?)K?!K?K?K? @O?4y4G4K?y4@C "7k?yC?7+H8p4&+H3 `+ x  4H4 PHp _K?yC:%j%7?7?4?K?y75k?yC!_"44y_4#:ϝEK>H# P+H6p#8v 7: p 47?YC4}K>ˇK>DU@]K>+ˇh'x+H& `+H6p4 4y 4 4Fl4>+H7 P+H"p+ H:_@B4+H=@:44y@4F4BQ4Z+BH:"_}6$+H5` +B H: ˀK>44zp7?YC4{K>+tK?YH*4%+`h* 4yk?y4F4+`!D4) 5X7?yX59{oHϝK>K?y44yF,4 K?yC "7k?yC?74 R+d`H: G4y0+d`H8 4k?y4y@F4 H+`h7 5X7?yX59@ ϝK>K?yC "7k?yC?7 ϝK>H44ypF4 xH H+HpH9 `4  ? 4y44F,4 H@G!+q0H: "x+6g0H8UU4@7+{49 UE4+q0H: +H8U4@"_]4z+ˀh xHp+d`H) H ( JHXq4ˀK>+H?+ok?a4@` C 7k?aC?7k?aC?7+q04&+o4%h 4yG4G H H K?a h 4C b Z7H k?a7Ch K?aC ?74u H k?a6k?a5 Bh  H K?aH 6k?a4Bh ? 44yP4 F444zp7?YC4u7K>K?Y+tH=k?a4$+`"h= 49 6X7?a@ ϝK>H44ypF4 H@&!+q0H: +4gH8U4@7+{49 U4+q0H: +H8U4@"_ 4z+ˀh xGq4HGY7 HY6 74G94HL9444y4 FL4+H*p+d`H( J _  Jx44XqHQ4ˀK>_4z+ˀeh x ( $ ( !k?ok? k?+k?17X#H7p4#7`F4"K?1Tq6#+H64$6h:+q04%   _K?1"K?146Fl4 +Hh x7?h4K>K?K? @O?H+}p4< Hwp  "w6hwp6x#9k?!79F4 #Y7YHK?!Fl4 Hup4p@#7K?!4F$4HHsp77? h6t?Uhtp"_=6+ˀ}h xH+|43`y  (k?)GK?)H GK?1G7HK?)7  GK?1+H" `Hwp+W @H< PHep+  4HspH= X6w? +H}pH3 H7? } +HzpH4 @7E? ?+HypH5 87"? W+HxpH6 07? +H% Hxp+H! +d`HzpH" Z XX 4THupH4H X HvpH?6?! B ] KV ev_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?o+H? "k?+y6 k?4:6 CY4@ 74|K>@O?Dm@_K>K?ςk?o+H? "k?+{6 k?4: @6PC4@ 74|K>@O?D@_K>K?ς ( !k?ok? k?k?k?! k?177%64 4 4 4xF |4 R j@ڌ@`D@`7K?1€_40π4+oH?+ 4H84`_4yπ(44_}44?4K>K?!K?K?K? @O? ( !k?ok? k?k?k?!+H% +7_7#4 k?4h= 7?q7B 14+7@h #+H:F4%7?!:P6?4@HX   ?_7?` H8    7?H8    7?H8    @7?H8 w   =7?aZK?q4>` 48"JD@a7K?q4 zD@a7 g4!C<!C&M4 M474|'4GD)@`74 t€ tHC??4C4?44>羵@4'>@4_4π(4H_44?4K>K?!K?K?K? @O?_M4@ϟ4_-4`ϟ4 ( ! $ -k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y+k?4k?7> k?q4?k> k>4 k=4(k?4k=4 H.+{k?4?k?yD7=k?7>Qk?7> k?40k?y4k?q4?K=4?Dk?k?7>QK=k?4 k?6k?4?k?y7>DAk?q+`4'+w4)+4*;4 t!4444B=5d`i^Hh5z7H4>A5o!*7?17>4?5 "5A?@@ "5i 5ShW}67h "C? 6H4Ey6#O 6A <B_5@47=D@hbI4!bA@ӗ0t4 0z4 I30Ǔ*I7(2=@₲ r" ?/4IX +yk?4:K=4 C 4aiܞ7=":I] 4k?44B14iaRHe6?+wH9,"&!+tH:+wH9 $H48 +tH/K=DIh`hH7>W7>K>hWk>K>HWk>وAjH_ 4 Ϗ(K<_4P׏4?Kш@ 4 k>K>و@ +dp4+ w k>+dp4* W K>ق` K>_4!0ϏK< 84W` _4!ϏK<ِ`4``4@"+H< @+H0p 6k?4_%4w+4ςh7xk?ok? k?k?k?!7$7E4   Y4E @ !zF M4ar7? 44!b7? b@OӺ B44?(4?@O]?4` 4g@4 @?4\U 4?#  7$@F4O4zK>K?!K?K?K? @O?ϟK>ϟK>ϟK>ϟK>ϟK>ϟuK>k?ok? k?+ y4:`k?!XA4y$P+H?4@4%HЇ@HAHAJHAH؇A!K?!X4y K>K?K? @O? 44y$`@4y$pXIK?!-HЀ 44y$@4y$XK?!H+d`H: 4y$G 4x$+d`H9 XK?!4 44y$@4y$XaK?!uH 44y%@4y% XK?!=H؀ 44y%@@4y%PXK?!> K?!X4y%`K?! ( !k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+4'+4 ?4?4?4?4?4?#4)7!4 4t4@z4I? +{Hk?4:@5%Ci5 ahA@0t4720z4A@ǜ Ae@ǜB:H 4? y @ k?I BI8 5&@k?57?IA%4ha"K?I@` ~I? 5&_M4@ϏK>YD y@+``h<@WhWhWhؐWh`WhȐWh+4ς8h3x?M@ K>Y_e5%4?K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>_5%Ϗ]K>YI? I? œI? I? ̢I? b}I? `mI? ̂]I? ȀMI? _ 5&ϏK>Y $ ,b ( ! $ ) * B $ ) ' $ - * "k?ok+ k+k+k+!k+)k+1k+9k+Ak+Ik+Qk+Yk+ak+ik+qk+y+k+4?k+4?k+4 k+4k+4?k+4 k>4k?4 H?k? W7H?k?W7k?4 H?k+ѓW7k+44 47-4?7?!4?_H9+H< k?+H6+H5 7,k?q4.k?+h<x+h6 (4k?+{43@k?y 4 k+4' k?4 D7,IK+k?7,I k?7,k?4k?6k?yDak?qK+k?7,k?4 k?6k?k?yD k?q+w4/"y+`6uHk+407,IDI@m2I/A@ӒQ0t4 Q0z4Ay@ǜ҈ AY@ǜLI(K+4?_ @I(`"7-a_]7.G7 `47- _ `R77-K+*4 `>7,IH+tK,@*K,K+ 7- OK+ 2 fK-a47._76&ZK+  5e7- 4*`476F 67EI]87-a_ `<@ `.ˀ bIT84*_  :I46?@D|@)45_GI]8 RI8I I F4)I F4 ($ `#R4-2I84)- I I 4'k?4'7-YA 4jI(*4* zI K+4'B6gJ_-7? (4I K+k?44'PC56g 4 =44 :)<:<)R:(J_7>K+_U584+tH:_M4"k7 f4 +4,+4-+d`4.4)4)4=M@I8K?K+K+ K>K?K? k?7?!k?k?k?k?y_ek?q|@aI84)`_  I449?@D @%:Ȁ5)I8_ \@K+7k+ bI84)_E )  :I47?@D @$45)i^%@`+ Z R4*_76I47]?@D \@#4 `K+7-_5K+#K-a76H7.K-a76  5l@X+H,+k?4H:844*_5y4`B4 5"?k,0k+4)k+4*k++4- 6-k+4*k+5x?k+_57.Ꮒ` 7C. K+ 4k+6@K?K+K+K>K?K? k?4k?7?!k?7.k?k?y_5k?qv @^54)`_7.I440?}5Dt@! Ȁ54tY k-a4zZ BI 4&@k?47-aA4k-YaK-a ` 4@8B4&_4@4 ?@k+ه"*(k+ه# k+4?k++H?x@"+h? +4?h<x+H? (@"+h?+4?h" (K+ي eK+ 2` 4*4+k+K+_K+K+@E 4k+k+_]4%4 ?k+_54%4 ?k+k+̢Ƞ 43}@+t4k+`4B@@@_ u4'p4 ?k+J_ U7?WJ_ 57? 7J_ 7?uk+K-Yk+K-Yk++h- +h _ }4'4?k+4mk++H9_ -4( 4 ?k+ُ1@4 +t (H:+wH8 F]4(` F)4( "C@@ k++H3  "_ U4(4?k+و@ +H(K+T+tK++`H94}4)u4)@5_ @K+6R6k+Oiw+;+_ e4*+IB8 N _ u@K+7`k+ ZIY84)@. K+ K+@K+_ @K+61k+K+@4k++K+h?xK+K*K+yK+qK+iK+aK+YK+QK+IK+AK+9K+1K+)K+!K+K+K+ @O+k?ok? +H9 +H? #7 +{k?4: k?B7+0a 7+H8 +{k?"yK?4: p6wB4`7C@@d J+H4 F4z+h$@+tH<+h#H+4h6x4K>K? @O?˃K>˄K>+4ςh5x ( ! $ & , ' $ )k?o k7 k7k7k7!k7)k71k79k7Ak7I+{7F*4)+H9 +4'H! y4d k?5:4x+pB4+74%Jh<1"_4z+5+H H9 +{k?4:`4x-@B4w+`7ph<C @+`7pph<+`*pH?+H7+h?p+h?h+r46 X  +4 h*x_m4H +`k?4z-477AI47ophC @+`7o@h<+`)H:+h:(+4 h)x4: +H9 H 4x-k?B4w+`7nh<C @7nph+`H:+h:P+)(h:H+4h(x504+h%+{H:@ F]@FH+{h<+H+h3+4hh"x+H H9+vk?4:4x,BQ4w`+`7mh<Cu@+`7lh<+H<+`H?+ Ph?ȏ@B4X`2+e@47 @@ +h?+4 (h,xH H@k?+`h$4%4w+{h4:B4x-7khC%@7hkH+`48+4 Ph+x+H H9 +{k?4: 4x.B94w +`7jh<C]@7jh+H*  %_-4z.@5H +yk?4:4wP4By47j0hC@+`7jh<&H&p4y.4x'+_4:x+`7ih<+4xh<xC@7iPh+`H?"+4h6+_q4:+`7hh<+H4% + h X#$H8 K7i_=79 87H "E @` Hk7i4K7i4y/E <4 +tH:FK7i+tH3C]k7ig7+tEeH:+H:  7F@+ Hh  F%4z+7 h< +tF H9+4h#x+4%+H4 y4d k?4'Hh5:`4x+B47hFzH#94?78 ` +4h:+4h?x_@5_}4y-p74D4+`<ӈ_%@4y-74D4+`<8ӈ67+{H`55:_@4y-74D84+`<ӈ+H8+`H:+r46 P+xh:X x  X _@4y.74Dx4+`<ӈ +4 h+@0h +4h'x4h&X+4ph%x 4x@4x.4D4+`<ӈH+h=+4h$xH Q@5+h404+h"_ 4z0a4E4?++`4&+t44 4+7777H 4z'4B4h`ZIzFH]mIzh ( _M75H_oH H C@h@4+s4$ +s4'4 *H@2H # K8 _@FM # 4cHH4*: *+s4,4_% "+s4? 4_ H"_ 604?5K6K7IK7AK79K71K7)K7!K7K7K7 @O7H +`k?4z,4y,@47A47Eh+`H?5@5@_ 4z,P5H 4z.77iAI4@7>5 zK7i44y/!E4 5+d`_ 4z/AU5H zHXk?5:4x/B94+`74$}h<  zH 4z0k?4y014AY47}hH"`_ 4z0A]5C@7}-hH7?OH.@/+{ ( !k?7#_70"_61+K?Yh x4@7? ( !k?ok? k?k?+H9 +H? 4$ +{4 k?4: 4B 4+4#KXh<4? 945 +H9h`+`4@`h%+H7+vHx4= Z )787hx+`H H7+v Zk?4:4X2B @j0h|C@+`h<jHc+h#+4ςh?xh%+H94@`h`+H7+vHx4= Z (*787hx+`H H7+v k?4:B q42hh|C@+`hh<+`H?+Hfh?+h&+4ςhh7x+H H9+v"zk?4:6x2aB4+`hh<4>+`C@+`gh<+h +h +4ςh8x+H H9+v#k?4:72aB4+`gh<4\$C@+`fh<+H9+h9+4ςh&x+H H9+y#k?4:P72B73+`f8h<C@fh|+`H7+h7 H+4ςh$x+H H9 P+{k?4:4B 4+`exh<C1@eXh|+`H?+ς0h?H +{k?4:044Bi4+`dh<C@dh|+`H&+h&+4ςxh#xH +`"k?63q6347@=4d h|C@dh|+`H%+h%+4h<xςK>H +`"k?636347@}4c`h|C@c@h|+`H$+h$+4ςh6x+^ 4:+`bh<+4ςh5xCi@bh|+`H? +4h:C@+`b0h<+`H8+h8+4ςh%x "+h +4h4+4ςh9x+^ E4: pK>+^ 4: 0XK>_@8K>hx47 +`h6hx48 +`Eh%Hb+h" +4ςh"x+^=4:+``hh<+4Hh=x+H44:+`^h4h|@4?K>K?K?K? @O? :H 4:2+`k?4,@47@4h|K>+`H?<@<@_4,P+ˀh xH +{k?#73!4: 4AM4h|~K>C q@+`h<~K>+H? *=Hb+H3 d=Hb+ˀ-h x+`"H 64!48A4h|}K>+`H:+r49 H44ςK>k?7+H9 +H? +{#"k?4:74A6 @ 2 C@@+hh +H7 +`#Z#9487Z5Au79 @+4h=4K>@7? ( ! $ ,b $ & 1 #" & ( $ ) >0 # >0 #k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>7E4@+tH:7+4,90 E45A"K? I8 4wk?4@4if i HrQ  _@0j4G R]@ 8i0Q +h%(?-i %K?F417+t4( p4? p4>5xl_ d+4.+`4-42"Hj+R04h2(+4ςh4xI) H9 +{k?4: 4A4h|H|uC@+`uxh<.xH+H:+r43 h+׺h?X  p I, +`k?4%4<4'47@E4H h|4514^m7h|tzH+h? +4ςHh#xI- +yk?4:4P4A4sh|C!@+`sh<4>/pH+hh?+`46^-49sph|+`H?4 >e_]46Ϗ8K>YI0 +`k?4&4:4'47@ e4Hh|47^4h|rH*+ h? +`4'^49rHh|+`*xH?+ p`? B!⏝+€ F95z+H844&4=E 4 H44_4 H44=A_4 ZH44=Q_]4 *H44=a_-4*B%@iph`4  W@0j47Fh4 @L +h 0+@0h (+ς(h%xBU@pi B+t4? p4>5xc_dF5z+ςh%x+H: H@9F@+h HI+ +`k?4&4?4@47@ 4Hh|47^4?nh|4>*HH+ @h? PH9 p+H5 4) +{I4 k?4:A54+4#N(h<!Hj5 x5A? 4? @`? :+4ςh&x_46QϏK>Y +`? >+`? @+H| Ph<xT`_U48AϏ0K>Y R_M@4874C4+`< Ӝ +4H8 hh+H_H9 Hh| Z+Qh< Ȉ :+H)X "+HyH8 _48+H?+rֿHw40 ( 74+@h7 + h8 +h7 H= A4W hh+H8+HH9 +_Eh: +H1 < hh|QU@ J+H(X 2+HyH8 _49@h+H?  RH4  :4 *_549_%49aϏK>YHy+h9 +h9 +h9 +4h4 +r  4& 8  4% 0 Y+H3` ʈ Q@ H4`Z+H-h B+H,X *+H. `Q_4:+H+ `_@+h< +H|Xh<x+x@2 + `? z+x@, V4+H|h<x+h? +H|h<x+`? D+H|h<x+h: @+4ςXh%x1W++I* H9 +{k?4: 04PA 4Eh|+H"+r49 ` Y  +h?`+4ςh$x_ 4Y_ m4=qϏHK>YF y5z I_ -4=F I5zϏK>Y4>.4>1] 9@iE7 h|4i`ZI44  7 " 7i  _ %4?qϏK>Y *+I_ =4: P(++I_ 4: H+4h<xςK>Y+h? H+4ςHh6x+h?+4ςh5x_ %4pϏK>Y+`I7 4'448@ 4@h|#IEH]IBhc`hH4>% C?+ @4: _ @+H_ e4:4_ E4+4_ %4:4+ @4:_@+H_4:84_4+4_4:4+ςh3x+`44'4`48@ 4@h|!IE!H]IBhahhH4> C?+ @4:_@+H_m4:4_M4+4_-4:4+ @4:_@+H_4:84_4+4_4:4+h=xׂ4?K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>E45`0++H9 x+H6 4) +{I4 k?4:PA4+4#ph<>K>Y_45ϏK>YI? 46k?4w4@4+`h<~OK>YB m@+`h<~K>YH` 4~@*4P@4p@/++`? Y+H?/H+rԿ48  _47q_47ϏK>Y+^AH7 h||_K>YHp+_E48AϏ%K>YI9 +`k?4&447+4h' 4:q_E4h|+Hh 47^Q4h|{oK>Y2H+5`? x!_]4I9 +`k?4%4;477_U4Hh|47^4h|zK>Y`2H_@4;A74C `4+`<-Ӝk?a+`I7 k?i4%k?4;474_M4 0h|+h 04Bhh|H|yK>YH@_q4;QϏUK>YI1 +{k?4: 4P4A4hxK>Y I* 4;k?47?a_)4h|xK>YK?a`"H_4;QϏmK>YI2 4;k?4'7?i_4h|xK>YB=@h|wK>YHH+h? (4H1 (h+h: 0+h8 8+0h8 HK?a+K?ih* +h7 4>+`44(48AQ4h|vK>YICT1@'/++H: P@'+E@+h P+4ςeh"x ( ! >0 #k?ok? k?+H9 +H4 4%4 +{k?!4: k?A6+4#@Ph<:$Rr"B: BR!!4?K>K?K? @O?+`#H K?!7A)48h|_K>+`DH:4d|`*"6p_-4dϝ=K>+`H9+{E 4: p+4ςh=xH +`"k?64'47_4h|+`H94:7]4h|^_K>+`H%+h%(+4ςh:x+]e4: K>+]=4:K>H +`"k?6 647_u4h|+`H94:7]]4h|]7K>+`H$+h$+4ςh9x+]=4:0K>H +`k?#74'47_u4h|+`H94:7]]4h|\7K>+`H#+h#+4ςh8x :H 4:`+`k?447_4h|+`H94:7]4h|[_K>+`H"+h"+4ςh7x ( !k?7+H?` "_6K?Y@7? ) ! $ ) ( !k?ok? +H7 +h  Y+4Y zk?4zh xAq7?C +H:h EE@+h h+H7K?4yD4 K?44yDl4 +H7K?4yD<4 K?B"R4| 4#6k? 2B "6k?+4h4p4@K?CSw x 27Zk?CY7?8?7Z"b _}@b+4h6+044:h+K?_-h=x+H: +H7K?4yD4 +H7pK?4yDT4 +H7xK?4y0D$4 +H8h44yPD4 4K>K? @O?+H= +H? Z4" J40 : 2 *4&   4$? *+H9_4zϏ-K>ςK>_]4zPϏK>و 4zp4y@4y_@ϏK>K?_4zϏK> ) ! $ ) ( !k?ok? k?k?k?!+7CH:h+h +h x+ h pE @+h hHd #97$ @#D47?4?@X4?44|4 W * ߀ :87_ @dR4?+4W4@(h8`@+h8x4 4| "73  +h8p+H=p $ 4 @4@ X *4@%?8?4$J _-4dz+4:h_44?RC ӗ 27?"C??7?\ 4 |+H87 +H7 948 zk?14yDp4 +H7pK?14yD@4 +H7xK?14yD4 +H8h44y0D4 44yP4D4 4K>K?!K?K?K? @O?+H# +H? Z4"_ J40 : 2 *4&   4$ b+#H9_7+H"  _U4pϏK>ςK>+H7 +H? Z4"_ J40 : 2 *4&   4$ b+"H9_}6+H!  _M4pϏK>\ 4 |ςK># 7p7@7_@Ϗ]K>"6_4Ϗ-K> ' + ( ! > /B '0 , > $" > > # > / &0 *Rk?ok? k?k?k?!k?)k?1k?9+H=4444"4?+H3  _@b+H7 +`#7 k?A48!k?I4)@57@i<[!D I:+ch<E}7"7_5O*I9DE4_5 +H8 @__4+_H: 4?i9_@K?AK?I4@e7:`i<?@D UI:E]7$`7_5+}_4:pD҈`$$%_E*5\K>K?9K?1K?)K?!K?K?K? @O?]5\"_6pO}5\I9D]4+H7 K?AK?I@5@7[#DI:+a h<E7 7_M5O@I9D4+H7 K?AK?I@U5 @7["DI:+`Xh<E 7 7_5O@I9D4z_K?IB@7!+H%h +}4:pk?Q_U4K?Q45 D4 _5 @+H7 @4__4+_H: 4?i:4 ?_@K?AK?I4@M7:i<DMI:+` h<_5 `+}E7:7_5+}I9D4_]5 B i@@@7444B4w+`<4 ;5@+}+`;h%E4z;@E4:@E4_Z5\+H4 _@5\ &0 *R ( ! >0 / ? *k?ok: k:+h +h x+7D@j`h p+*Xh$44?"6  @+H? ȃ.+H7 0.+H# "k?+6 h%+ h%4 7:Y4_7:in(7+tH:DK:i+H7 +}p` 4 04@M7:iB7_ 7:iB7+}p4# K:iD54zD4z4Mz+tH=+h=+H7+4?h# +x4h? +4 `9+h?`x+"y+H7 6d c=q4 4@7:iq7K:i4F7;q+H7 44@7:iqX7+d`H: DK:i_U@@7+H! _@+d`H8 7;q4B4+`<7+H? `W_E@4|K9K:K: @O:#+H7 7 c?4`4@E7:ip7K:i4F!7=+H7 44@7:io7+d`H: D K:i_@~7+H< _@+d`H8 7=4B4+|5`<#Y+ 7Y H7 4 P@ 7:ifH7_7:i}7+H$ _ @K:i@4+|m`<+H%':+##H7 7 p7 @ 7:i}57_7:i}7DK:i|k:Y+tH:D K:i+tH6+_h6+4`<U4#+ 7 H7 4 @ 7:i|57_7:i|7DK:if +tH:D K:i+tH5+h5+4`"_4]++ yH7 4y 4@ 7:i{57DK:ig*_7:iz7_@K:i@ 4+|`< 0,4+ ,4 "H7 6 @7:ikX7_57:iz57+H#` _M@0,4K:i@ y+|`<d4|+H9 h+H= #+{7 k?4:@6@@7{9G4|"k:Y_m6 o4|k:Y4zF}4|4|#+ 7 H7 4 4@%7:ix7_e7:ixe7K:i4 4wDX4c:q44 04 D(7:qK:i7:q4BD4+``<{74|_4 o4|#9+"7$ H7 6 4@7:iwE7_%7:iw%7+H% _=@_@K:i44B 4+|}`<_9@v7#7 477B78+``<_@v%7+#ZH9_M7Z @}4|{54|_4 o4|_44|4|_)@u}7#Y7Y 477B78+`<+4`h""z_U6z @}4|{44|_%4 o4|_4 o4| +"4 H7 6 4@7:itM7_)7:it-7K:i44B`4+|`<_-4Po4| Y+"z4D H7 6z4@7:isu7_Q7:isU7K:i44B4+|`<_@r7#979 477B 78+`}`<+H? +H9H"+{6 k?4:P4@ }47r5k:Y `044` 4 u +H7 @44@U7:iq7_7:iq7K:i_ 4c:+w` 48K:YK:i+h88+h 0Ӆc:+4h3 47:B@4+|`< 9 4% 44p4_ 7:i7puk:YK:iD)7:+H7 44@7:ip7_7:io7K:i47:B04+|`<{/4|_ 4`o4|{/4|_ 4oe4|{/W4|_ 4`o54|{/'4|_ ]4`o4|{.4|_ -4po4|_Y@n7#7 477B78+`5`<_@nE7+#H9_ m7}4| ( !k?7CWk? (7?#:_7:ˀpK?Y#7K?k?C4#Y7W K?K?B6K?Y@7? ( !k?ok? k?k?+H9 `+H= 4 +{7E zk?!4:k?@4x+Dh< ڇ"Z"R+H4 K?!+yk?4:4@%6+`4&DPh<AE@D0h+H!#43?`4?7  ] 7?+`ch<$K?H<+h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? +h? x+h? p+h? h+h? `+`h? XA U@+`b8h<+H"+_04"h? 0"x4yp4"H+h5 X+h5 `+h5 h+h5 p"H+h8 +Hh8 Ј"H+h7 +h7 #*H+h? +h? #ZH+h& +h& #H+h% +hh% #H+h$ +0h$ #H+h# +h# 4K>K?K?K? @O?#H+h" x+h" _4z@ϏK>4'K?!B84+`<=Ӝ+4ςh9xH4y 4@4'K?!B4+`<ӜH4y 4@4'K?!BH4+`<MӜH4y 4@4'K?!B 4+`<ӜH4y 4@4'K?!B x4+`<}ӜH4yЀ 4@4'K?!B 4+`<ӜH4y 4@4'K?!B 4+`<ӜH4y 4@4'K?!B @4+`<EӜH4y 4@4'K?!B 4+`<ӜH4y 4@4'K?!B p4+`<uӜ_4z ϝ]K> >0 # $ &k?ok? k?+H9 X+H= "y4#6w +{k?!4:k?@Y6+@Ph<%ʇ%*#ꇆ"‡ ʃ *4K>K?K? @O?Hu +`K?! k?474@_4+`H9h<+4:7]14MK>Ht K?!+{k?4:4@6+`h<^K>A@+`h<^K>+H#p+H8 H+`H!  A+4ςUh9xHu K?!+{k?4:p4@6+`h<]K>A%@+`h<]K>+H"p+H9 @+`H< " +4ςeh8x+\}4:EK>Hv +`K?!#k?477`_4+`H9h<+4:7\4?K>_4 Hs +` k?4#4477_54h|\7K>A]@+h<\K>+H: 4$+4% (h D@h +d`h Hb4ZD@ h|ˀeK>H|Hwh+d`Hh74h @Hh`H  HH7h_H +4ςh7x+\4:K>+\4:]K>k?ok? k?k?k?!k?)k?1k?9k?A+H:4@! +H94$ @+|4%+y4&+r4'" @ D @ D  4 ? I@ De@ H b_ IH4c__ K>K?AK?9K?1K?)K?!K?K?K? @O?+H?7 h7+o4?p4?_+y4?+r47+|48"4 4?7`_ y B_7@ $ )k?o#k?F77?_7K?@%R+o448pU4@+o47p4@4$47?79$7?79$7?79$j7?79$B7?79$7?79#7?79#7?79#7?79#z7?79#R7?79#*7?79#7?79"7?79"7?79"7?79"b7?79":7?79"7?79!7?79!7?79!7?79!r7?79!J7?79!"7?79 7?79 7?79 7?79 7?79 Z7?79 27?79 7?+h?(K?Y@O? $ ,b $ ) ( $ ( !k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H%k?+44#@$h +H<(cK?@L:#K?4T@#4\#CK?d7ϟxK>Y#247?a4Uy4K?i"K?q"K?y"CA4v""C@b7B "K?iK?4_4"ZHxK?K?y_e X HwK? K?q_= HK?K?_  HvK?_  HuK?_ 5 HtK?_ T Hr46RchrB jI DU@iDu6:i#ICUK?i6/CK?i *IK?i4_5 "_4h`+h 444+H9(.B n P M5 !7_E n 5?+ ן4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>D4 7ϟMK>Y+y4:+r4=+|43+~4(+`P4)+bP4*k?+ok? 4+p+k?4,!  n _505 444P=6z@R64"6P6Y_44hb D4Hh " !ZK?_5Z}H|!:_}5: D54ϟ=h` &0 *R ( ! % ) & (k?o"k?+6 #k?7`H7C4 +H<4 K?"4_@P@+H"  *+H#X "_6_44C@+H? (+@Ph +H74?@+h7 (h (4?k+H3 ` h +H?x@"+h? H+4?h:x+H9`+|C4:P+H7P+ h7+h +4?h9 +H?`@+h?hH4=@4? :K?494 Cp4w`K?Y+4_h8+5h< 4h6hA@K?Y4|@O? $ ) ? * > r > ( ! %  ?0 ,B & ( ( / '0 " ?0 "+H5?H3? k? ( $k?ok;k;k;k;k;k;k;k;k;k;k;k;k;k;k;7 k4&+4'HH+`4% h24_4Ku@> =>@k<4k< 4k<7=A @K<h4y04 C7H@6‡"II*"F("Iz C%IY Ix 4h4yC@4 4+H7 (K<4y0C4 _4bHB"4?h4x%H4%k?_5YI*4 `+r4++y4,+|4-+4. 60 q Ik?4z%6_E 4? O _4z&"_ O"9_6:I*6 W 4 @04  p+y4/+rkH44y`C4 HC$44yCX4 +H? HhPB44t *6hB 4b8?64J7>H4~7EQhZB44t *6hB 48?647>H4~79EhJ b+H1( Vj+h Hvj+H7H4yC4+d`!DH: HE5X +d`H8 +h4y0H7 (C 4_ 4u4 HC]5+H84?@h+H! (k+ h- (+H2 Hh HhxK>gH+sI 494z_ %4@'CiH4~NH_ 4=H+H0+4t$7h4(A@4_ ]7Ka?HH7+h8(4y$@B4+H2 O@"zCQH"76 4ȊvH_4z$ +K< /ςpK;YHCJ9 J)H$)h 04 4K<4z0_4@h$HC5=@7>E 14~+H?4$:.J4 ."-.2-҇."#7I +{Hp"k?4:_M6%7zh[-@@hzHK;Y+4h"Hh+H<x;zH@ +h?+|4&PI (+Hh (+h0 4%Ci444y+4B4 H K<4y+Bl4 H  _@+h< +H7K<4y+B 4 H  K<4y+4 B4 *+t4d4+Hh4h   "+4h3 H+h3h+H7hK<4y,B$4 A4+H/+h# K<  K< K4yC7>+4kPh+(_4zϏK;Y.HH4TBW2I ZI 4z04yp_q4hrH7OK;YeH XI 4z4y_ 4hrH6K;YH4z04y _4hqH6K;YH"9-674w0 4wP4wp4w"Y6W ˊK;Y+4yh9(_4zϏK;YH4+h<x_ H h+4x`Hh8(_y4zϏ=K;Y+ˀh x+H"`K K<)  :4~D7>44y'P7>B4  B6Y4~DU7>44y'7>B|4 C> rHKH44y'B4 HIH, HK 64HK4H_ 4z+5k+44?h/x 4?#7p +4 h)+4 h*+4h'+4 }h++4]h'+H,P+H9`+|4:P+C!h,_ @+I (h< +h +@@h +H?@ i (@i (4?h8ˀK;YH4+h<x (0 + (0 " '0 ) ) . ) k?o k6k6k6k6k6k6k6k6k6k6k6k6k6k6k67C7$_ 4 +nh 4h64h 47h 4yh 4h h h _h "444y_e4#_]77a z4y, _M4K7a_E44y,`_-44y,_4 949 k7_4+{44%4Z4X44 4 v4 ~4 \4 N44^4FH8d !B E474y,77CQ44_77aH84@D  `b4`R J B :? 2_ * "    :4y,C 774_57786R4y-C A774_776RQ~H8K7_4`4+d`H4(  24y-4C 7777_m444]H8K7_544y-@_4_4+4h<xς K6Y+h x4K6YK6K6K6K6K6K6K6K6K6K6K6K6K6K6K6@O6 >0 ) ( ! , ' ?0 ,B !@ 'k?7!k?y#:+7:-PH7 79-_]7?ya *"K?y_=6-ϏK>+d`#H8 K?y_ 7k? BK?K *B@`K?Jk?y+tH:BK?y+tH8+H? k?y"+z6-k?4:6._=4@k? K? _@@zK?y_K? `K>_@@:+"zH9_}6z. +h x4K>@7? > / > /B '0 , > $" > > # ?0 "k?ok? k?+k?94?H9k?1+}k?!4:pk?A4k?)_ k_ K?1+H= @_Ӻ_4+H3`` +_H: _ +`4#4 44x_7Y_74 HyK?9DK?AK?AK?96?  K?!K?)+_h74K>K?K? @O? > / > /B '0 , > $" > > # ?0 " ( !k?ok? k?+k?94?H9k?1+}k?!4:pk?A4k?)_k_K?1+H= @_Ӻ_4+H3`` +_H: _ +`4#4 44x_7Y_74 HyK?9DK?AK?AK?96?  K?!+"h7_6 _K?)4K>K?K? @O? > / , . ' + ' 'B > /B '0 , > $" > > # ?0 " ( ! , *"k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+k>7J7,64444 h #7 "Y6L +!H75.P4B5X+H-h +H'h 4&AAk> A b` Z+}4)p4_u5:5845.p4 B 4 k>A\ 2 #Ƞx4IYB]4z4j_5Z"6 !;k>7590Q4 B H7A' '_@Ar+4++4,+{4.+x4/444_5@K>759/4 B 7I   II TZK>7590q4 B 7A!K>590B 4 @gZL'RH%2D&@0i_%@^45 BU7?_ 7?+H+ @_z_4+H,` +_H: _@+`4++4,4K>5x_7:%7A@&_e@4_e5 BIzC7$7_%5K>_5 @+H0 @4 __4"+x6 k>4-@7!5.B 4 _@Ab+4.+4/+{40!;44_@K>759/4 B7I  2 IJ T (ZK>759/14 B7A!K>59/aB`4 @cʆL#†H!zD!’@0i_@^4+H/` +_H: _!;+`4*+4-4K>5:/_m5X!7_]5:0!h4B4A"_@w4BIZC79-7_5HK>A! >@ K>A!:@K>=i?A44K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>i_5:0!h4B4AIyB44 h_-5K>75915B4 `:+H1  "+4h6+h6P+s4:BE5Y5K>K>+h.؀ Hh+}4&p_4459114B4  =4 CQ4z=4C14=m4C4M4k?74A4K?Y4@7?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ? $ ) (0 +k?ok?k?k?+H9+_4: +H9+_m4:+H9+_E4:+H9+_4:+h +H?`+h +4?h# +h# +h# +Dh# +H4+$h X+H6 $+H? D+H? D+H?D+H?ЇD+H9X $+H?HE*+H?PE2+H?E:+H?8EB+H?EJ+H?xER+H? (EZ+H?0Eb+H?(Ej+H7 Er+H7E+H7E+H?F+H?F"+H?F*+H?F2+H?F:+H?FJ+H?FR+H?FZ+H?+FXh 0+H?ȇFb+H?Fj+H?Fr+H<&+H! &+xh  +oh +}p` +h p+t` p+t` @+t4$+t4%4? @ C@ @ Ci _ +h#+h# 4+,A4%P+,4&@,K?YK?K?K?@O?+Eh?h+h +4=h5X_4+4_}4: +h# + h? h# +h?h#+h?h#+h?+y4:pD 4+4_4:X+h#H+h?h#P+h?h#+h?Ph#8+h?8h#+h?xh#x+h? h# (+h?h#0+}h?h#(+uh? #[+7Y `7X h7 A4 +=h# #+7 h7 7 AT4 +h#+#h7 7 7 A4 +h#h#+h? h#+h? h#+h?xh#+h?X+h#+h?ph#+h?`h#+h?Xh#+h?(+h#+h?Hh#+}h?`h#+uh?X+h#+eh?p+H: P@ C@+H=h +%h= P+H: H@ CA@+H3h +h3 HKa?H?Ka?H7@#;@7< Ka?48@ _4 4ރ R4ڃ? Z4ʃ_  r#@7 "@6 `"@6 p"@6 #@7 "{@6| k?o {+4x H7 `k?4y A4 +H< `!+H7K?4y A4 +H7 K?4y A4 +K?H74y 0Al4 +H5 +H6 +H? +H?8 2+H7 (+}497 J+H=h _+4h3 h+H8+y4:`X +K?h7 h4y PA44 K?Y@O?4h4 h+H7 hK?4y pA4 K?Yk?o+r47 +r4_48  C:     C r  KA49YC6 R [X4Y 4 A4w8K?Y  4cp 4?K?Y4|@O? ( / ( !k?ok?_@@7 {@R{ " ǣ4 4 #_e7 K?Y"_=6 0`K?Y#_7 8K?Y4 _@4 04 @4 _@4 4 @4 _}@ǃ4 4 @4 _E@c4 4 @4 _ @C4p4 @4 _@K?YK?@O?k?o+{ {7WH84yA4+4x H7 k?4yA4 +H7 HK?4yAT4 +H7 K?4yA$4 +@7 DK?4yA 4 +@7 @K?4y A 4 +@7 K?4yPA 4 +@7 K?K? @O?#B57+? h<"_]6+"?6 "`>6 "{6c _u4@7>4_E47@|>4_4zu4 "@ 'k?ok? k?k?k?!k?)k?1k?9k?A +7H4@k?Q4H70A5+H:؀ 4B @A-5B 57+"h<+H8+t4%5C4+H&k?y  +AH&4@ 4 25k?yA?5?5A%5@K?y7? ?   jK?y7  @@BK?y6? ?K?y6? ?K?y+~@4(p4)pf4 !Z `"4w '4K?QA4K?y4C!04c "7k?yC%?74K?yC?=@_u7?y@B |"44P4 A4`4|K?y47k?y7k?yC= t" "4K?y7S k?y44 4 4A4w+`h( x  4|K>K?AK?9K?1K?)K?!K?K?K? @O?+`4<W 7474@`:44 7"@4 *44~"+H5:H3:  k?k?o7C#k?D7 "+h +4h?7?)_M `@K?7?;C ]4z@w :#[D7Z 7K?C 4zK?K>78?  `@O? '0 , ( ! ( )rk?ok? k?k?k?!k?)k?1k?9k?Ak?I+H?!2bx4|H8 @4?_5Ka?4$ 4444 4 4 4 @4_@Q 4 _4ӟ !! ? _  j b Z_]4`g4P4|+H7 >+b 4|_444|K>K?IK?AK?9K?1K?)K?!K?K?K? @O?_}4`4|@@K?@ @ (0 + ( ! ( (+H5;1H3;9 k?k?o {k?7W4x k?4y`A4 +H?+h +h +h x4 +4h9 2K?K?4yA4 @K?Y+H3 h +4h= h_i@+H7H+H8h+h7P+h8p+h _4_4+@H:+H? (@"+h?+4?h5 (P 4z+H:+h  K?44yA4+H6 R+H<  :+H!H "K?44@4_4z _4z0_@+|4: _4K?Y@O? '0 )k?7_7?K? #h7 B H+n4? 64?9_"+n` +n4< K?Y@7?@@K?@ @ ( ! > ( "B ( ! ' # ( '0 ,k?o {4x 7Wk?4y@A4 +H:@ _%4zp+H?4@ J+_H: +oH5 +H9_4zK?Y@O?_@Ka?Q)4: +_H:@@ _E4z+|H:+|_]H9K?44yA4+H?4@ b4 ?!*+H= @_ӺK?44y0A4K?Y+H7`K?4y`A4 +H3 @_}z+H6`>WK?Y+_H: +oH4>K?Y+H9_4zK?YK?44yA4+H< @_ӚK?Y ) k?ok? k?+H?k?14#k?)+n47 07!k?!N:N%JJ#ʇFF"BB!:@ R K?!K?1B4K?!_4 a:0h`A%K?)7A 4 74X`*"K?!B6@K?!K?!K?)K?1#;k?B79K?!_4 @ZPh`#K?!K?1Ba7K?!_4 `h`K>K?K? @O?A4  7 4Xt@*"K?!A60"#7@K?!Au4"6 _4 K>h`A4   @7 4X]@*"{K?!A6y8K?!"6PK?!K?1A4K?!_4 ~7K>h`K?)_4 }K>h`AK?)74X`* ;K?!A49@K?! [K?!K?)K?14YpA@K?!_4 }7K>h`A 47    AK?) 4]4X=`*#K?!A78K?!#K?!K?)7A4K?!_4 |7K>h`A 4 7  AK?) 494X`*#[7YAK?!HK?!K?1 K?!K?)k?4A}4K?!_4 {'K> h` '0 ) #0 " ) k?o k4+H"k4c5C5k4k4k4) c54Xc5L@7 k?iA E75!#7A 75!_7?i75!F 75K?i449]75!75!75FK4 { 4y @4y0F75!75!Fu75C5K4_-y Z4y@k4F-75!K4F75!K4F75! 75!K4F75!75!F75K4)4yPA7?!75!F7?!75!Fm75K4O m47A%7?!C57?!_ҙ Z4y@k4F75!75!F7?!K4F75! 75!75!F7?!75!75F}K4 4y`F]75!A75!k44y4 75!AP7K475! K44yA7575!_4 ` +h K4YK4@O44ypFy75!A175!k44y4 75!Ap774!&+450.K47?0n75!/ 4y750A'75! ( ' ( )r 2 rk?ok? k?+H#`$*+H$$_u {4x k?174y4 A7c_54 K?174y4 A7+cH?Ѕ4? 4? [4Ax 5  4hH +H:  BHH 2444w@4+H? Z+H9  BHH 2444w @4+H?+H7P%%"䂒"#+H! #BHH#2444w@4+H?#Z+H:  rHH b+H5+v T4< 44@D4+H?"+H9  BHH 2444w@4+H?"Z+H8 !HH!+H6+v V4! :44@@4+XH?ˀK>ˀK>ˀpK>+H%H<4$<@ـ!:+H8  HH 444w@@P4+hH? +H7  BHH 2444wP@4+H? b+H3  JHH :+xH8 844w@p4+H?+H8  Z +H6  :HH *44w@4+H? b+H7  JHH :+dPH844w@4+H?+H7 44 d&+H8#z+H8>++H" @>%@HH`> @444w`@4+H? Z+H<  BHH 2444w@@4+H?+H7 =++H6 =@HH =@444w@4+H?+H<9@=++H3  bHH R+v ]4" _44@4+H?<++H5  BHH 2444w@4+H?<++H4 ;u@HH;]@+H<+v U4? 44@4+H? +H8P@4"06P.`+dPH30n7?A   Z X׸ = '!01N 1! ')J X)+H=  :HH *44w@@4+H?+H8  Ҁ"z+H=  BHH 2444w`@ 4+H?"+H:  HH 444w@4+`H?!+H:  :HH *44w@P4+H?!B+H9  JHH :+H8 44w@4+H? +H8  JHH :+H8 44w@p4+H? b+H7  JHH :+H8 44w@4+H?+H=  j b+H"  JHH :+H8 44w0@x4+H?+H7 j +H9  JHH :+H8 44w@@4+H? R+H<  :HH *+H8 44w`@4ˀhH+4h4+ h4+H5  z+H=H b+H< "+H" B@ 4w@4w44 @4ˀK>+4h3+ h3+H4  z+H:H b+H6 "+H! "@ 4w@4w044 @4ˀ8K>+H$@ ˀK>ـ R+H3  :+H9H "44w`4 @84+H4`+xH:+6_ ]h#`ˀ`K>+4ϟ8h8+4ˀh5@H44K>K?K? @O? ( 'k?o+H<7C#z+H!#b+H5 +H6 X#2C*_e@+H7+ H?b  ``r"+H5 "+H<H"#447@4pK?Y+H"!j"B+H9  R+H4H :"446@4+H?!+H8  R+H3H :"{446w@4+H?!R+H7  +H=H #447@@ 4+xH? +H#  R+H:H :#[7W44@ 4+H? Z+H6  B+H!H *"446 @ 4K?Y@O? ( & ( $k?ok? k?+h +h 8+h +h  {+4z k?!7D_Mh +H? 4d04d0@%4+n4: k?)7@4$K?)_ 4 0@k?1+H87 a@ 0 _m4z_]K?14 @Uk?9+H97 @@  _4z_K?9K?!` ` 0_` +H8 @rK?)A4yP_K?)P` _UK?!Ƞ@ 0_5K?!%@ _%4z+H?P!  ڇ" _4z+_4z@+H5H *_4z_u4z+h +h K>K?K? @O?_4zPm+_4z`M+_4z+H? _4z++H9$ +H%+v ]46 _]_M4z+H7+v S4$ _ M++v Z4" S_@_4z+H8+v  T4! _e 4+ '0 & ( & ( # ( $k?ok>k>k>+H?4# _E+dP_UH$+H7"*+H? +H3P d "X4?+H8 4< $'4ƀXa"06p,@,P7>0N 1!' '10 0n  1IN1'FX$"H}4 WDRF4HbXChd+4$ HtH67:?@hu_m4 h`_e4\H|7ha_Ht(K>Y+H? =@+H=ਝ@44Ȁ` X4Ȁ J+H= 2+H3 +H4044+r@(H9+dPH! ! k? @k? 0 0$ "7?!$)00n@0H7>0 8'87>'YY +dPH6k>+K>H=0+]@hh:8 *+H9 +H3 7%` "+H4 @ +h:0+H7H<@@Jk? k?40k?7?!4A4:k?#;k?79`7?!4A4_-7?!4>hsK>YK>K>K>@O> &0 . '0 , ' # ( & ( $ ( ! ( ( #k?ok>k>k>k>k>+H4k>7F7/$+H84# +@H:H+H' _4+H:  J B+H5 @_Һ+|H:+|_uH9 +H6.+H"  +H'H.+H!H .+H( +H? X.b+H7.J+H=H"4'@K>4?4?#7 `7HH-+n@# 0"+nK>4: B 4+n x` .:. ℊ'򄆇j%$J# "_6 h`HH,Hy4 ( @ hv#[_57Z hh_-K> K>YHH,zHx4  ` hu#_7 hh_K> K>YK>Й4A4 K>YHH r+H7# 77@7_K>Ka?P i4: `K>Y+nK>4$4: B 4` n` ` 04 hdK>4: 0B e4+n ` HH*+H:PNM4#7 77 @7_4Ka?P14: (K>Y_M4HHH +dP4(%+4'0,7?"0n60$@_5@ K>YHz"{7T ht蒀P_6z #_7PHH)h`_44heHHh ""_]6`K>YHw46T`ht"_6 "{_6zHh`HH ""{_6zK>YH#7hu蒠P_U7 #[_=7Zh`HH "#_%7K>Y!*+n@< 4# _4 +H? _4 _}40_m4z @ 0 _M4_=4z 0@h  _4_ 4z `` `` 0`` #[_7ZHK>YHh#;5hvP_7: #_}7h`HH "K>_M4 K>Y_ 4 _ 4@_K>`h`HH "#;_7:p0K>Y!R+n@: 4# 4 _]k>+H? _E4 _%40_4z @a 0 _4_4z 0@|  _4_4z K>`` `` 0_}`` #_u7_UK>K>Y#_-7 "_%6_K>xh`HH ""_6HK>YHg!4hs`P_5 _m4h`+H! 2+H"؀  4 @_-4HH +xH9 8"@ {" 4z P4x @4x_@+rH94z " 4x @4x_}@+4< +H3h/k?_M4z _-4z Ka?#_7 Ka?OU4: HK>YHH *#K>_7 K>Y ;_e4: _4~_EK>h`HH *"K>_%6!K>Y#_7 _K>@h`8K>Y(K>Y"_6! h`K>YK>K>K>K>K>@O>HH?K>Y+nK>4#4: B4`` n`` ]`` 0HH(?OK>Y _4 _4P_K>h`HH>K>Y4>K>Y4 _4K>YHy47:=@ hz ;_ 4: h`4 HH>7K>Y_ КK>YHH=K>Y#;_ U7: _ UK>hhHH=K>Y"6pK>4@7>_ 7>Uh`k?7k?7X#47!p@ 4 +H? R+H9 :+H:H@ "K?44_ ]4+H=ȃ B+H3` *#7!K?4^]4 K?Y@7? (0 + ' + ( ! % ) ( "B ) ' $0 ,Bk?ok?@C7D+H4#+H5؊$+H?ȋ$"4 {4x k?4y!@ 4@}@+H=Ћ$J_4_4_4_4_u4_e4d+H8 +q0H: N4y"@X7+q0H7 Z Y K?Q E4@ M4+H!!B_@@B+H" *+H$  +H?؏@+H6 2Ka?O-4: +|49P_4z" _4+H7 "_4z"@Ka?O4: +H9`+|@ 4:P+H3P+h3_@+H7+r48k?4y"P@4+H8 2_5K?K?4y"7@4_ @K?YK?@O?OY@ +h +d`` 0_E4 +h +~@` 0_ 4++H< *#[7Y!7X 4^4+h +dp` _4 ]4h +x0` _M4+H9 >K?Yh +}p` _4MK?Y ( ) , & (0 ++H5>H3> k?k?ok? k? 7C7%4 k?!4"4 @4wK?!4"4 @4+H7`K?!4"@4 K?!44#@4_4+H? b+H7 J+H8  2+H7 +s484#@_%4+H= 'C "+H: @ _@+H9 RK?!4#P4 @h4w+h +}p` _4_4zK>K?K? @O? ' #k?7+|H: +|_H9 @@K?Y@7?k?o+H?H`b04+h?`4#L@ H}` J+h X+H8 +04ah9`+H:+W04h7X+h XK?Y@O? '0 ) ) . (0 + ( ) ) #` "k?ok>k>k>k>k>k>+7HH:7$76.P4#+H74% h`A 4#h+H: _7>K>7?B4>+H8 c?)@!;59#@}7?'7?_M4 #7# "6#_M47_54!"74AZ H4#@44,Ay4B,744g 464x4444|4844 <&gJ7  B : [74 P4D#y@ ;4'#HH* … (:>}@R$ "{6y$@5H_4@h`_4+H'j+H9* H44$_4 h4_U4 X4a4>@ 4`4 >@R4`B!k?5#4@ 4pH4@` 4 J4ӡ!k?5#4@ ]4H@Z4@`J4?b!k?5$4@ 4H!k?5$04@ 4XH@ 4&@4>F`B4`2!5$P@ E4H4@` 4 :!4ӷ5$`@ 4H@J4 @`@!4?w5$p@ 40H!5$4@ U4H_%4@h`_4+H4f+H5&H45$_44#;79$@ 4H_e4@h`_U4+H8f2+H5&#H47$_44#7$@ 4H_4@h`_4+H7ej+H4%R ;H449$_=4 4 @"`B7 6 X <4<@ 2 4\77 77   44$@%404 @ 84_4@h`_44_4@h`_4+H?`:+H7 "4$44_E4@444_4@h`_4+H6b+H<""46$4_4p4"6$4@M4H_4@h`_ 4+H?a+H3! [H44Y$_44"6$4@}4H_M4@h`_=4+H)0a+H=! H44$_44"k?6$04@4H_u4@h`_e4+H(`B+H: *H 44$_44ha4K>YK>K>K>K>K>K>@O> ) . (0 +k?ok? k?k?k?!k?)k?1k?9k?A+H=7H7#7!`4+H< 4&@4!h! 4%@75@4H_4a@4 k?Y4%k?a4%k?Q4 d 4 HAe 4%K?Y Ap b7Ab`K?a+h _ 4K>K?AK?9K?1K?)K?!K?K?K? @O?+h _4K>4%p7@4H_=4H_%4~U@+h _4K>ٍP>K?YK?QK?Y7?@Mk?HE 17?5JH` i4%HE4%5_?H _-4`"4~K>4 +h _4K> ) " ( & (0 +k?7+H7_ +H8h * 4" z4& j_E4`J#_57 "{_6z%+h _ 4K?Y@7? ) " ( & (0 +k?ok? k?k?k?!+H8؃ 7C @+4$4"4&'Hh b? 2 * " _4`B_HhK>K?!K?K?K? @O?#;_7: #[_7Z%+h _}4uK>k?77?!#'7 .00&E0N 7@1N , 1A$01!'8W'H '0 01$N1N 01A ' 8G'D?@8 +n` p+nK>4< p@7?+n [k?4Y&@@4: p+nKu2Ks2  k? ( !k?ok? k? {7D4x k?!4y&p4 _e4+H7K?!4y&_54 +H= !+H:Ј!R #7d!2+H%P b@eBK?!+h<P4y&k?)4 _}+H$P B4z&2EK?!@!"+H:P_474y'44_7a4@ @+4h7K>K?K? @O?+h H+4h94K?)4x`_-4 +4eh8H+4h?44y' 4 _44+H5>4+H6 >4 |4z'a_4#\_}7Z'+H? #<_M7:(+4%h"HKu1Ks1 k? #` " #p "k?7k?+H9+|` `  H` 0#["7X 46(q_4K>"{6x K?"k?6(_4 K?B:+|4? 0k?#k? 7(7)k?4_]4 K?_U7?!#K? K?7)_ 4 _=K? 4@<@+|K? _4: K? #\k?7Z)A_7?!#<K? K?79)Q_e4 _K? 4@@+|K? _u4: K? #k?7)_7? j"6)K? K?_4 _K? 4\@+|K? _4: 0K>@7?@@@K?@ @ ' % ( #k?7+H? Z __@K?Y@7? ( !Ku2Ks2 k?Ku1Ks1 k?k?7k?+H:k?@ #_57+|@9 0 2"|K?K?_6z)xK?Y+|4: 0K?+|H? K?7?k?_6?K?7_4K?Y4@7? ( !k?7+H:Ћ@ #_7+|@9  ""|_6z)K?Y+H7#+|7*48 +|H? k?4_!k?+H9K?_K?K?Y4@7? ( !k?7+H7Њ #_7+|@?  "#<_7:*!8K?Y+|H8 +|4: _4K?Y4@7?Ku1Ks1 k?Ku1Ks1 k?Ku1Ks1 k?k?ok? k? {7E7$#4x k?!7*14 _4"|K?!6y*Q4 _4Ka?H:4_4,"6*q_4+H:@@!"`BKa?H:4_E44Ka?_H:44Ȋ`RX7R_7Ka? H:64_4`"4z @_4^4z @RV64Z $_}4z @K>K?K? @O?k?o`pk?)`b7?1 7?''000n9D&D4?k?#[K?7X "k?!6*4 _)4w"K?!K?)6*_4 Ka?H:4_4,@bK?)} _ 4z#7_7Ka?_H:8K>"|_6z*Ka?_H:K>4|@O? '0 &k?/,/-/.oPk>k>k>+4$P, k?7E1 k?!0$ 0H _]@+4&@,#;780./,0 0$ %, "{6x |k?44y*_4+H!"jK?44y+_4 ,7>K?0$4y+1 _A4 ,K?0$4y+Q _4 ,,K?0$8F4y+q$F4  _ +dPH7K?4y+_i4 +K?H704y+_94 +dPH7+H50K?4y+ _4 +K?H784y+_4 +xH7 8K?4y,_4 +4&0,K?0$4y,1 _A4 ,7>K?0$4y,Q _4 +4&0,K?0$4y,q _4 , ,K?4y,1. 4 1$_Y 1 0$ +dP43&a+46X0K?4y,0n4 0&_Ka?H:4_4,+"H98_6PKa?_H:+H98+H:0:@r+H? *+H4 +H< 6` "+H= @ +h90+H:(K?_K?!+7H<8+h"(K>YK>K>K>O>/0./0-@/0,+H<Ku01Ks09 k? #p " $@ #k?ok>+H?Pc? j7? \4Y-q_4z+H<"j <49-D 4zKa?! 䀚 7?4-!_4z+H?!"+H4a +H? 4-1D =4zKa? 7?4,_]4ze+7?4,_-4z5+ 7?4,_4z+ Z4-QD m4z@Ka? *+H5P@4-QD %4zKa?H:4_E4, 4_U4yKa?_mH:K>YK>@O>+H6 _4z+H?+H9+v 9 W49+v X44 5 # _U7-Ka?_4z+H$+H7+v4:+v _43 ] b V"| _6y-Ka?Ku2!Ks2) k?Ku1Ks1 k?Ku1Ks1 k? ( & ( # )0 , & (+H5;aH3;i k?Ku1Ks1 k? ( ! $P , $@ #k?/,ok<k@>BH4&_4,_4_H_=HK;h`_m5_m4~_M4K;+H9@40_5(4+H9@_44404_5IZ4_u4_@41_}7+H3 IZ B4_4+|49P_%41A@+4_4+|49P_41q+H= IZ 04_u4_41(IZ_E4_e41IZ4_4,+H9  B+H: +|4? 0 _4IZ+H- @_@+h< +H8 `r#!77` _m42!XIZ4P_7=14_-7=1IZ_ 421IZ4 _4+H: ] IZ42A_7+H= ( B+H4 0IZ4 _54_U42aIZ4_4_%42IZ4_4_42IZ4_4+H44204 hbx42@42_u@+H5@ `IZh`p4h`h_4,_43IZ4_4IZ4_4_43IZ4_}4_43IZ4_M4+H443ᒀ0(44_=@IZ4_4_ 44IZ4 _4_441IZ4"_4_44QIZ4$_]4_}44qIZ4&_-4_M44IZ4(_4_44IZ4_4,_44IZ4_4.+H3 _45a _45_IZh`4614 5^ 5446Q5^5W46q4 5^57_ 45?4?#[7X 7h`p h`h40,!Ka?H:4'+4?h}P46P.4h}_4,_9HH4_4,_ HH4&_4,_H+H? +H? 8H4_)4_I46H4_4_46xH 8H4_4_460H4_q4_46H4_A4,4r@"47_I44 r4_!4H_9hm_@_ H8K;HKa?H: 74t8@:7,_Y447!_q4Hd4_4,54r`(h`471_44 j47!_4Hd5Ka? d H:_hdKa?_ 5H:K;hiKa?H:4&4_!4,Hn@4P_)59_IHH4_4Hn@hkx_47Q_H_@_ =HK;+H, aKa?H:4+4 _4,+H< \Ӛ4_7_1Iz+H" H!RIz4_4+H!!+H5 A+H4 Iz j4_14+H< +r4!x 7 +|49P_47qb4_4+H6 +r4<x+|  49P_47_Iz+H! (!+H"!+H-@ jHkP} ZKa?H:4 _4,_48Ka?_H:8++}pH! h7<4++#['!7L0-0Hs`0N0 ') )s +H<XH8 Ka?H:4 _4,+H8X48_5y+H"XKa?H:hb84}`_' +H< :+H9+H= 904 = +H+ Hv@v `Ka?H:4"_4,481_5yKa?_ H:hk@Ka?H:4+4 _q4,+H5481 +H9 +H9 _I5_iIz+H.!:+H.@4 RHmP *7=_48A4?hbP4 Iz+H8 `HmP ?@+`4H7 7=_48a+H5 `4huPIz4_4,4_7=_Iz+H? x+H8 p+H7 H}H  7 JIz4$_A4,5_Y5_yIzhmHHbXJ 4 z4' j4 @7=_-5XIz4_4,4_7=_IzhjX4%4 4'Hzp4 J4%24% 4G 4J#Izh`![h`5I0-!h`p+h`h4?P(/484 5^ M57Hwh484 ^ %5Hwp485^ 4 H4mb0%+HvpH7+dPH8hvh (hx+H9 8 0hb "+H(PHw  hd Z+H% +H& +H' 4 hlp4ƀ?`!05@/ /04|0N'7<1'Q00Q0n 1 N0'G@h`p4Hwp@Hth4 Ɖ4 `hpHypHzh Y(_Y@HHzpIz4_ 4,+dPH9_ 4PHzpHy_IHxIz_ @ K;HzpHy_Hx+H6 x+H4 p+H: HuH   BIz4$_ 4,5_ 4_ IzheH?Iz@>Iz4&_ 14,4_ I4_ iIzIzh`h`HzpHy_HxIz4&_ 4,_ 49_ Iz%IzIz4(_ Q4,05@0491_ I4Iz494 5^5W+H7x494 ^5+H74:4 ^u5@"'Ka?+H74:14 ^55+H74:q4 ^5+H74:5^4 Ka?H:4_ 4,Hvx!+dPHzh_ 4Ka?HHs+dPH&7Hhw hf4(_ 4,_ 94:_ YH_H hK;H4&_4,_4;_H_QH K;H4&_Y4,_y4;1_H_HK;H4&_4,_4;a_9H_HHK;H4&_4, +H& 4_4_H_HK;H4&_4,@ :4;4_Q7>4_7> _4;_ H_aHK;H4&_i4,_4;_H_HK;H4(_ 4,4_!4_AH_HPK;Ka?H:4'4_4,+H9h_4P_H+H*x4? *H4(_!4,_qH+H,x b+H.hHxHwk?4;_!7>4_7>_HH4_q4+"43 60.a-7<00&y^Uy4<1_)7_IHH4_4._HH4_4,_H_AH-+48@_/h`X+H*hf`hfHhf@hf8 0hk+H(؀ 4 @_4Ka?N 4: 8h`Ka?H:4&_4,4 k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Y+~`h p4%+h +{H9 |4&+4dh$+h$4'+4)+K=H7X+I8ph=4y ^4+H=X+xH? H&4(@H 4ZH:CT _4y+Z+H6 bh 4 I HH Bi H h 44y4 ^4I H5B?ai H+4*4 z4 Z4 @4yH I H7_h 4^YKH KCV*B_U4y*:H IC I HC4y ^4@ 74y@4 4^7H I HK4y`^i4@rIX )z4^4HI HI8p4y_7>H 7>_JzI H6?^5i H+H9 +H74y4 ^4Hp4y4 ^Y4+H74y04 ^)4+H3  J+H7 8+H.(Hp 4'+H? *Hp4 Ƃ(:+H8("HCF Hp4 4? 4(B4 4싿 :_]@(H_M@(ZhHp4 B+H= *+H: _4(Hp4 W " 4W 47 j+H5 +4 h,+H< "+h +4 h++H6 +h  4 4^a4yHpK=K>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O>7?i H dH +|6h 4%PK_%444y 4 ^i4+H7(+h 4y 4 4^!4'+H.(B:h+H? H4y4^ 4 H`+yH844y@^ 4 +rH844yp^ Q4 +|H844y^ !4 H`B+rH: *44y_4 hH" B+yH9_-444y4 ^ q4I H7?i H`H 4y05h C4H 4CH44y@4 ^ 4+H Z eI+H J+|H, 24y0C-4+|H9C 4+4h$49+h$ +4?h8 (4_4@B+H+4zp`0@__@EK=+h$+h$ +h$h+h$`+h$ +h$+h$+h$ˀK=ˀK=ˀK=ˀK=ˀuK=44yP4^ 4+H*4zp@0@_o_@K=44y4^ )4+H)4z 0@__E@K=44y 4^4+H(4z@0@__@%K=44y4^I4+H'4z0@__e@K=_@w'Hp44y4^4+H&4z0@_ _ @%K=44y@4^I4+H%4z`0@_ _ e@K=k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y+r4? +}@47+r48 +}@494?B +H94 D+|4% k?!5k?5Pk?5k?5k?5k?5`k?5k?5k?"\6C k?5k?5Pk?555555`5555@5`5555p5555P555 RK? BB6K?Ѷ4?Q  N / , x  J PK ( () F  " E C $ <  U `V 3 84 Z K? 2 K?2K? 2 K?K? 2 K?hPK? 2 K?02K? 2 K?78\  RK>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?ok=k=k=k=k=k=k=k=k=k=k=k=k=k=k=!50Qk?)50k?150k?!5+k>5/k?5*k>5/k?5*k>y5 /Ak?5 *Ak>i5/ak? 5*ak>q5 .k>5 *k>a5 .qk>5 )k>Q5 .k>5 )k>Y5 .Qk>5 )ak>I5.k>5-k>5-k>5-Ak>5,k>5,k>5,k>5+k>5)1k>A5(k>15)k>95(k>)5(1k>!+r48 +}`"<49p5'k>+{ 4: "6 p5,ak>5#5+Ak>5$5'k>5'1k> 5&k>5&5&5&q5%5%5%15$5$A5#6)"6*"@6+"6,!p6-!6.!6/ 60 P4445#A617?@@k4? @   x `- H+ 0 (5S  $ ! `SK> @K>   K> K> K>! K>) K>1K>9x2K>AK>IP2K>QS( K>Y K>aK>i2K>qS K>yS5K>Sh K> HK>(2K>S K>K>2K>K>2K>S K>K>`2K> @K>S K>SK>2K> K?K? 2K? K?SX K?!K?)02K?1  77Y79_m@K=YK=K=K=K=K=K=K=K=K=K=K=K=K=K=K=@O= "@ .B "@ "R , ' $ ) ( !k?o k6k6k6k6+H87C7&e84Hs46CBg!4@7?Q4z4t4 % T!t!ҔD!4_4x4>@e4F}к$@g% 4`4r4xD7D<#ә T 4}? ? +@w4 Z4`4n4yWezXEr?"6]7?@?  +h? % 44>c7?Q % +|4: _7?9bK?9+|4? B T _@ 4V " _@ 4V" Hv #4ǟ"rǟ@"r4?#\7B \ `+H8+|4:@4y_7?9c+h<+H8+|4:@4y_e7?9c2+h<+H8+|4:@4y_ 7?9dr+Ph<P+H8+|4:@4y_7?9d*+h< @4K6YK6K6K6K6@O6_]4z%Fm4z+h< ϟK6Y`ϟeK6YϟUK6YˀEK6Yˀ5K6Yϟ%K6YϟK6YϟK6Y+H8+|4:@4y_U7?9bD4 +H6  r@j4 `B+H4 *#4D70+h<+h$@ϟ K6YϟK6Y44z_77! 77!+4:_e4y4ϟK6Yϟ}K6Y44z_77! 77!+4: _4y444z_77! 77!+4: _4y444z_E77! 77!+4: _%4yU4+s49`4 @4z+4:H_4y4ϟK6YϟK6Y44z_m77! 77!+4: H_M4y+4eh9 @44z_77! 77!+4:_4y 4+r4$ +}@4% 4?   _404+H5 Њ:4+H&4@:_44]54?44z_77! 77!+4:_4y4ϟK6YϟK6Y 30 /B %  & ( ( ! "@ .B & ) $ ) "0 *+H59H39  k? ) .B +0 * * B $@ ) %` !k?/,ok:k:!k:)k:1k:9k:Ak:Ik:Qk:Yk:ak:ik:qk:yk:k:+H.  _EP+{H9 4$K8+x }7H7 H4%4y14]4)+y4?+r42+~`4'+4(k:+4)k:+4*+4w7k:4++|4:hk:!!55X- k:47k:4 4 Z4@4t4#7k:4y1!]676793ANK?(+#^7Y3QNmK?+H8@B+d`#H: ]73+d`H9 N K?"}K?N6y K?Y@7? ?0 - > r > ( ! $ & >0 # !@ 'k?ok? k?k?k?!k?)k?1k?9k?Ak?I+}4$+4&+4'+`4%+4(+4?4)!^(!}H(!b!J!4H Hk?45X3_]5w `h(_M@0t4  0z4 WH(_@ǜ_7H(_5Z34?K>K?IK?AK?9K?1K?)K?!K?K?K? @O??K>bH Z_mI:H 5Z4k?4(7_E4h0_K>H(5i_5Z4AϏK>_@h0^K>ٌ@ +h#+4ς}h:x ?0 " ( ! ( "B +0 ' '0 ,k?7+H? +tH: @+tH?C *4t 7C?@+H7 +tH9+`#^7Z6_48 a87+H3 b"_67!+h x+|^Y49P+t-+tH:+`H7 +}#>48 p] 797a_@+t_ H:+H= @k?7_ӺK?+h?x7K?Y@7? ?0 " ( ! ( "B +0 ' '0 ,k?7+H? +tH: @+tH?C *4t 7C?@+H7 +tH9#+`76_48 a(7+H: b#_77q+h x+|^49P+t-+tH:+`"H8 ]]67_%@+t_H:+H9 @k?7_:K?+h?x7K?Y@7?+H5K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?]4 m `_7k?a K?a^4K?a4 T47]7A? _7 @74^Q5Hz _@ dK?a>K>_]K?a]K>4 4!4a4 4 4 @ 4 p5? B :4 4505 5 #77 "44\e4 f  _-@_5f 7 ^44A 5A-?5(554 55A ~U@@ @ f @ _%@_5f 7 @^4"6844\ 4K?a;K>_K?aK> >0 / , ' >0 # !@ + > r > ? * ( ! p - ?0 ,B !@ +b +0 * +0 , , $ ) !@ ' ?0 " ( . ) .Bk?ok:k:k:k:k:k:k:k:k:k:k:k:k:k:k:7;k;A7;k;4?k; 7;7;4?+H5 4'+H,0h 0+H7p+h5x =48 + ~k;4y8Ah,\ 4 K;A4K;A4;K;A4$.>K;K; k?4x8q44y p\ 4 H K;k?4z 4 _E7;k;ɋkI H Ip 6i 6 6uh 6Btiy `HI VH 77Uh CUit ?4I K;9 A \47?I I В0a6_ 55I ]Y67]A6:I 7V~K;6B694y `B6H  ZH 4z>k?4y<7;_=4k;ɋjK; _7>_ @K;k;4y84 \=7K;Ɋ jvIJ &_@0t4 0z4 I0ǜۊ _u@ǜ[I(K;4y94 \}676=K;I 4?} IS  2I I=:I* @>m -H K;4z=Q_58 }k;TEI:   i< _]@]QI: _7  @=7>^ I9 7>I]  2I I_U58 @k;ɏ'TI:   i< _@] I: _7  @^ aI9 M7>+H! 8+H2 P@8K;! k>!m@;7>H K;4z:_58 y8k; @ _@]I: 4Yk;_u7 \ @;'7>^ I9  K;4y?A4 \M6W@:7>K;44z?q_58 @k;ɏ%FK;i6 T }I: i< ]7k;4k;ɀ`JI7   7 0 7k;ɋ 9B  € M_ @ ]I: Yek;_ 7 ƒ9= \ ^1I9 7>@97>H K;k?4z58 _7;k;ɋxK;ш@8 @ _ @I: @8w7>C]8_7>]@_ e7 ߃8 ^I9  h 4yH7K;\94 K;+4$ Jh p4y0HpK;\4 KK< @KfK^I9  M@47>H 4zH K;k?44z<_U58 rPk; @ _@] I: _7  @3o7>^aI9  =-K;4y>!4 \6W@37>K;44z>Q_ -58 qk;TI: i< ] 7Rk; @ _@K;_7Z  @277>^)I9   @17>+H H9+zK;k?4:p_ -4x>ыpk; <+H9 k?+{K;4: _ 4w0|k; @17>+H H9 +{K;k?4:`_ E4wP7k;ɋ{rK;4yp\ 4 K; m0*H 4zk?4y7;_ =4zk; 4k;4H 4y\Q4 K;K;4y\)4 +H7+H1p+K_4 H k?4x8k?7>k?k?(k?y4+H84y\I4 +TH:+H8+h<44y0\4 +H844yP\4 +H:Ȁ _@+h +\eH:`Hk;_7+7h<ȋ&K;+h24ypK_4 H k?4x8k?7>ak?k?k?yk?q"K;7=_54k?7>k?q7>ak?4x8K;H k?4k?4o;A_k?yk?7>K;k?4 k?6k?4 k?y40_Yk?q+w4(+`4)k;)+4*+6 k;I4++4p;k;14v:4,44-k;!K;K; k?4k;k<54x8qK; 4k<)4x8qk?_ 4z84?`k;_4z9A4?8k;_4z94?k;_4z:4? k;k=I+4h=0 mk; h h k; k.,gK;1K;)H  U58 , 004y< 04y4? k;ɏ+r_4z?4? Pk;_4z?4 ? (k;Ɋ@.H  54k;K;*_I4zP4 ? k;_!4z4 ? xk;+wH9(_4z4? @k;+wH7K;4)4y\4 +H< ZK<`JK;A4z 14y!4y_14 ? k;K<Ɉ`K< Rk;+H= P K=9@Rk;_4z4 ? k;] EI9 I+(%k;K<`b_I:  4d 4y@@4y`I8 _44?pk;] I9  4+h: +h? +H, +/h? +h? +mh? +mh? +mh?x+mh?X+mh?p+mh?`+mh?XK<`ri P+K;h x+H*84h78+h*84y`\y4 (4yK<` 4i"P4yI7PK;4 \K<`H 44y\4 TyH h 44y7\4 H B "_a4z04?k;K;`BK=i` K=y`"_ 4z4?`k;K=ia+H2  (K=a_4z4?k;\5Z7_5Z!_)5 75z]5Y5? q 4^ " 5 l @ 45 l _ 5zk;_ 5zK;Ɉ@*4z`_i5Y4?k;+4: _5YK=yb+H1  (K=q_4z4?Hk;ɓ@0K;CS "_4z4?k;T A@7\}7K;" +d`H0 "k?)6 k;7?)7;H)5Z+d`H: ]55Y!_4z04?(k;_4z 0H4? @k;ɏ!_@k;ɋaK<`K< \ =HH7!$5<  4:7?^a5H+ 6xh844y `[4 K<)fKK=GHB k=+h K= \sK;K;<[K;+H8؋<;K;K=4_ 4`Z44y4[ ]4 +H9 _4z4?uk;+4: _Q4+H8 44y[ 4 4K;k;HBa ;;++H< ;++H5؊:++H? p z+H.+K;h. +q0h. +h? `+4Mh? X+ h?p^4z4?k;+H6  rK;Hh +h4+h4+K; @4h% +q0h% +H4؈""+oH$+q04 ?h* + h* +xH"  ^H  4^H 7@(H ^%4z`4?}k;H: ]@0H7X44y[ 4 H+h$+H9+H:+t^48K; K<`+4h=8+H78K;4y[ %4 +H)8 b+H(  J^4z4 ? k;K; ?GK< qK;+H8K;4y0[u4K;84+H:CT84+d`H3 k?i4 k;7?iH7;+d`H: +]H98C4^4z`4 ? k;+]H9+H%+1h%+h$\4^7+7)h< P]q4 HpK; *+ h& !@ +b > !@ + > r ( ! ? * ' + #p 'k?ok=k=k=k=k=k=k=k=k=+rH, 7E (+r4? 4?_+r4* k=4? 7?!4?_+H:Ѐ ^@+h 7>14?7>97>17>94?"+H4p4 1k>ik?+H= 7>k?q4k?#k?7 k?4'+}460k?y 434 7>_M4k?7>k?4 k?4k?4k?y_k?q+`Bp4) _@ǜDI (4p4 4[-5wj!f$ J7>_u@744 4[7c2+wH8 $4(_@0t4  0z4 @I0Ǘ^@_48 7>1?7>H 458 _4b7\I: ^7 h@ ^u@^-5k  h@>W7>] I9  %* K=^-4+r4? 4?_+H:Ѐ ^@+h K>i:P4A@74`4 4[U7_@@7_@444w[4 +H844[5+r4? 7?!4?_7>1  j+H9_40H7>1_49A5 _44?7>14? p@ ^ @ pP4+h"x5K=YK=K=K=K=K=K=K=K=K=@O=I(_47>1+wH7404 [4+wH9,_U47>1 ? * $ ) !@ ' ( ! $ ,bk?o k7 k7k7k7!k7)k71k79k7Ak7Ik7Qk7Y47E7&4 44."z4h`+`4'+4)+t4*77a!!77aI7 5:5 _}4 ``7IZ]H SIZh c _574c_oI7 _@7@ +s4&+s4& 44 @ 7 @74! aZ ^4Z_]4`77ac @ ^}@b_ x44_4?7!5JA04 ~4z_44?4K6K7YK7QK7IK7AK79K71K7)K7!K7K7K7 @O74`:77a _  4  4_ ̂E@4.>-@>@`^4+4(77a4 `I % > ]@04>5J4_ @" 5JG 4?4  >0 / , ' ( ! $ 2 ?0 " !@ ' ?0 ,Bk?ok>k>k>k>k>k>k>k>!4 .5 I%k>+H$ ~%+H+ K>k?+`48 k>4$4z@_47(eh0+d`H: H \4&+H!H Ј h +t` "d+tH 6y H8k>_4%H+t4'h \4H \y7+H8 7:@:H @44y `@4+_U4z+H<x+# H'P +sH7  4* IT4 x4 +4+ H HIx_4 *5(@" H ? H @4+H6P"B+sH8"*4*IU4"4 +4+ H HIx_4!5(A H @? H 44zK>K>_4h0@H( jH CI RH K>k?7?h0G40H \H "H \H H _h@8h0^4 !7_u4z4?K>YK>K>K>K>K>K>K>K>@O>44I4+H? +H9 +{k?4: 4x _77h0`H(K>+4'`=h*4zP!^_55Z`ϏK>Y_4zϏK>Y>K>Y_4zϏuK>YˈeK>Y_4z`ϏEK>Y+H? h+ H= pH4?0k p+[h& hh0^77!h \MHH  [H`h0H ^77 ph \HH + 44H"+4h#x4Fςj_ 4zϏK>Y_4z`Ϗ}K>Y ( !k?ok? k?k?k?!k?)k?1+H67E7$76!4!_]5@47?a7?a4?_K>4^5+H74`2+}48H% 7!!>+}4:@ ]] _m5:05'@5:_E4K?i!HK?a_5:PI4!B  45:_4a  `?  K>+H<  * ^4Z_u@%7?a+H? =4=4 >_4:@7?a5:_4ρ 45: 059@_@K>5:Г 059@_@K>5: 059@_]@  *K>5:0 059@_@05$@5:`_4`05#@5:_4y4K>K?1K?)K?!K?K?K? @O?B "@`*46`@7\@4@4?@044~` @`7Z@4Y`4` @7\?C@4? ? * $ ) ?0 " ( !k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Q+`#7 48 k>a4k>i4%_ 444dph(+tH:\H +tH:7>h L7>K>h0 @"K>@44 30K>?Bj_}H058h0^  "P74 a  a+4*4 h 5 H04 7?![M5IW K>aK>i_m7?!a7 4H \4!  2SH h 5_ 75(_ h 4K>aK>i_4!0h(bZH0 5 59Ly@_4!p4@H04!7?![4 Iu7?!a4H0J_4 0o4|_4 o4|{>4 Z4`:4 @ ^i@ ^I4K>a4"4 [94w+h#x4|K=K>QK>IK>AK>9K>1K>)K>!K>K>K> @O>?7_4 om4||]4| 4!_M7?!o@ ? * >0 # !@ ' ( ! $ )k?ok? k?# 7 k?!44_U7?ya7+tH:\ K?y+tH:7?ik?yL7?aK?a7@ZK?i@J+H= K?!k?4"7?a_4`7_@`7@K?y_m4"`̏4_CC 4_= K?a4%  _4"04K>K?K? @O??4_4 ̏4+|4$   "K?y_M4"̏e4K?a@_4"0̏54K?i@_4"̏4_4zӟ4? _4#@̏4K?a 24L 9+4̂mh8x+dp46 6k?) ^ k?1K?aK?1k?9 ?h7?@84K?9 E 4 K?aK?1]'K?1@2K?9  4K?a ^ K?)K?a K?9? a+4̂h7x ? * ( ! !@ ' $ )k?ok>k>k>k>+`#=#7% 7#4' 44_E4+`4dh<(+tH:+`\mH9 +tH:7?Ik>L 7?QA7#K>_7"`ϏK>Y_]4z#>7:#44_M4+`ch<(+d`H: +`\}H9 +d`H: 7?ak>L 7?i@07"K>_6"`ϏK>Y_m4Ӗ_k>+`h<0bK>4 z"_=6#@ϏK>Y+|4$  >m@"~K>_6z"Ϗ@K>YK?I@JK?aA"K?QAK?iA404k?IK?Q@+dp4= k?QK?a@04k?aK?i@*K?aK?QK?I }  k?i  R+dp4' K?i hk?iHK?IK?QK>K?iL7K?IK?QK?a@jK?i@Z  _ K?Q4F`4K?i +4h:x4K>YK>K>K>K>@O> ? * !@ ' ( !k?ok? #] ~7Y 44z_7?ak?y+tH:\K?+tH4_Ek?Ak?yK?7?yL7?`7K?yAK? A _ 4+|47  ӄ!4 4LaК@+h x4z$@_eЙϏ(K>K?_=4z"`4?K>K? @O??K>_4z ϏK>_4z#ϏK>_4z#@Ϗ}K>4+4ςMh3x ? * ?0 " ( ! !@ ' $ )k?ok? k?"}6y 7D ~k?!4k?4z_E7?a+tH:\)K?+tH4!0k?+H7 K?!4z$_7?@+d`H: \K?+d`H$ k?@0k?K?7?qL7?y@7K?_M4z"`ϏK>ه "K>K?K? @O?_4z ϏK>_@K>5K?_ 4+|4%  ӟ "K?_m4z$Ϗ5K>4? _=4z#@ϏK>K?qK?y`k?q@+dp4< k?yK?qK?y}@: K?_  K?y4cC +4ς=h"x ( ! > # !@ ' &0 *R ?0 ,B %` !R $ ) ?0 " #p # ? * "P " >0 / + b )0 , >0 # (` # ?0 - P ' !P % "P , "p ) % . ' + #p ' $ & '0 )+H5>AH3>I k? , ' %p * ( "B +0 ' '0 , ( )R ? +0 &R ? 2 $@ &b !@ +b !@ + > r > )@ ' >0 ) )P ++H5>H3> k? ( - ) ' ) . ) 30 *r ' B+H5>H3> k? = , p -B >0 /2 ) ! +0 * $ &R !@ # !@ #2 (` , (p )R )` "k?ok/ k/k/4 k.#"}7W7$6x Z 4:K.+04 h4h+H6h04@B+H!h504@+H?h164K.+ҳAh3` @ r  bPK.+H5X "_6$+H9`Z-4ˀ K.K.5 "+#H:_7%+H3 `+H4pt :+H6p+H! `6K6t?+}p4_h5 4dk.K.4 K.4!" ~6 4 4y%4Z 54K.4 4y%0Z 4+H74 4y%P4%Z 4RK.k/q4 4y%7Z 4H4 4y%Z m4 tK/qK.4j6 rK.4l ZK.4 BK.46 *K.4΂ K.4x MIK. K.K.46 Z_@+``h<0+` lH<0Q1@ TK.K.!R+4h3+H4 "_6%Ϗ:_@+`` h<0+` H<0 4K 4 "_6&@Ϗj =47 46YY6+`<+H? _M@ˀ  K.4֊ j_@`k/y K/y+H5؆ "6&_4ˀK."%+}4:+H9(+H4 #"}k?7&_M6w++`` h<0+`H<0_@+``h<(+`tH<(+`H50"_@+`h<(+`h (+`H!0Ɓ 4[@+`h<(+`H304+h +H5@b+H?46+H3 + JH36_j+H4 +d`h4+`h (+`H504Z >49&+#H7 4 7 Z4#h` +`h (+`H30 4_4+`h (+`H504 ?_ k/+`H?04*K/+s45 _=4+`H604ƶ*K/+s43 _4K/46_=k/+`h (+`H!04@A"+4?h30+`h (+`H4044+H6 p +H! pk/ K/K` K/]5JK/J K/]H:K/K/K]k/K/k/?gK/+h +h p+h h+`h (+`H5(+04˖h6xK.4T z+`"~"6z' 6 4#48 _4` h|0+`H<0ˀBK. K.46 "^mK.K.K.!*+H3 ` +H4 +H5P@R+H! +H?P4@"_ 6'PϏZ+H5 膤 *+H6 :+H! $ "+ˀh xnfQq@TK.K. K.4& +H5  +H6 +H!X@R+H3` +H4X4@"_ 6'Ϗ"LK.+\h<xNK.4 "_ @+h<xK.d"2+|4:p+H9 +H6 ""k?6'_ 6++` h<0 >_ 4:(@Ϗ*+`H?0`+`8H<0*_ e@+``h<(+`H<(+`H30"6 W14+`@ph<0 J@ 2J+H6X  >_ u4:(ˀς2*ˀJ+`H:0I4#04h|(+˟h?xK.4 BK.4r *K.4 K.4v MQK.PK.K.4Ђ K.4#+H3k0!`""+`K.48 4""6(Ј6 6 +H? @4_57+``Xh<(+`H3({ "_]6(Ϗ+`H<( +`7/H9 \a4zC/4k0! BC/4J C/4L K0!6k0!+`h (4JK0!@? K0!4LB Z+`4#490+K0!K48`h|(+`H<( >4:)0+`4#48 +#H7 _7 `h|0+`XH<0+`KiH: k/"}6t k/+H5 2K/B "~K/_6z<+yK/4:\ 4@+H4 *K/I7/+Xh<xK/B< 4+h<xK. ZK.4n BK.4 *K.4 K.4!"+H5  +H6 +H!@R+H3` +H44@"_56)pϏz+H!4\@? 2+H4B +4h?M!K.K.zK.4 _ A@PK.K.4 ZK.4P BK.4䂓 *K.4 K.4ދ!NK.+`"~"h<04 6y)6 Za7K.4P *K.4 K.4⊓ +`H50@+H60 +H! @+H? B+H3d RG A@ :+H4 "+_H:+`h<0+`45H60+J0(h6xK..!B+H?  +H3` +H4H@2+H6 2+H!H4+H3 ` "_6)ϏZ+H5 膤 *+H6 :+H! $ "+ˀh xP@K.K. K.4 +H5  +H6 +H!0@R+H3` +H404@"_16*ϏOK.K.K.4x P1@K.K.4 K."K.46 "#+`7*P h3 "+`6*h5 +}4: +H9+`H8 4#+H! "k?_6 `Xh|0+`H?0 "~_6z*Ϗ+`XH<0J+}4: +H6 ""k?46+ _Y6*+``Xh<(+`H!(; #_7+0Ϗ+`H<(K.r +`H4(h5(_@+`h<+H<+H6 *+H! " *+H? +ˀ0h x+`H:(OH90K.zK.4!+`""6+6 4#48 _4`h|0+`H<0+`H: Ra4#+H!ph| +4h<x+d`H?+H3p sT *I@+40h<x+d`H6+H!p!_ d "+`Q9H:  K.ϝJK.4d#Z+H6 * >_4:+Ϗ j b+`h (+H?A+q0H4 43+`H6(45 A +e@44 V J(4? T J( _Jv  vF44J( t4?+H3j(^+q0+e@4:+H9+H5 "k?6%0_16 +``Xh<0+`H60  >_4:+Ϗ+` hH<0 Z+`4#48 +#"}H7 7,_6y `h|(+` H<(+`H:0H9 +H4p+d`H5 V K K`+ˀh x4˓ R JK.4"" =49 +`4#48 +"H7 _y6,@`h|(+` H<(+tH:4#+`H9 [4$ZUHzHsh07? 4ҕ ϝ+`4#H!0"4??+tH34$ +H8p7016,pZ4%HH701Hp+d`H!h|0 _?J7K 4`"+ˀh x"4˕zK. *K.4 K.4#RK. K.46 # 7,"6,6+`4#48 +"H7 6z_6 `h|0+`H<0+`H: Ri4#K.h| 4 b+H? +H3 p`!+`"H9 _6<4K.4 J ?4:-+`_AH9 Ka?I4: h4+H? *+H3 b *+H4 +ˀxh x+H5 b+`"46H8 6-!_i6Ka?IE4: 4+d`H: 4# ?49-!+`46H7 Z-k?Hz H4*+h<x4+xh<xK.4 P@HK.K.4* K.46%+`#"}7-A6y 4#48 _Y4`h|0+`H<0+H4 膄 *+H5 莢 *+H6 +ˀh x+` H8 4 4y-q4$Y4R yH h 4 4y-7Y4_q@#+`H? h 0H30h ( !+`H6 H!04 ! +`H50H! 6 6 4c0Q C0Q4 rC0Q4ă ZC0Q4 BC0Q4؂ *C0Q4 C0Q4 H+`H5(46h?(+tH4 +`46H! J0J( ? +tH!5J0J(6tj06J J0j( > +`H6(4#6h3(+tH4 4$H84 4-Y4Hv(HH67Z hs "6 6? =hw04 4-Y]48 H4y F94x0`"+ˀh x&+`H3(4?+tH4" 6k 4 6-Y4+`H: HK.+h<xK.4, *K.4| K.4 P!K.$K.K.4."+H3 ` 2+H4  "_6.Ϗ =49 +`4#48 47(+H? "k?_ !6.Q``h|0+`H30{ *"_16Ϗ+`H<0+`H5( "_6Ϗ+tH:+`H9 [4# =49 +H7 #hy 7.q_4x ` h|0+` H<0_1@+``h<0+`H<0+`H: +t_yH904+th<xK.4 ]@DK.K.4 ]@ K.K.4f _@+``h<0+`H<0_@"~7_6z<+4\h<xK.40 K."R ?4:.+`4#470+H3 #k?7 _4`Xh|(+`H4( "+H5`+`h50+`lH<( =49 +`4#48 +"H7 _6/`h|(+`H<(+`H: RY4#h| +tH:[!7_@`h|(+`tH<(_q4 +ˀh x+tH?C` "+t"H9_6<+`H:0YU4?K.46 +H? *"_6z/1Ϗ~v_@+``h<0+`K.4 "LK.+h<xK.<"+|4: P+H9+|4? 0k?+H3 4k?  k?4x0Q^4`+`h<04%4 4y04 Y7H0!+|^54: 0+`h<(4#" =4 6048 Y7^@H(4v 4t 4\ 4L 4F *4B +`4>h40+`4Th50+`4Th60+`4 h?0+`4\`h30+`4@h40+"H9^u60+`4?h60+`^uH:0K.K.4 "+w^E4:K.K.4 +w^4:+H5 k0a "+"H9 ^}60 ?^e4:1Q4K0aK.4V!"^M@+``h<0+`H<0G@+``0h<0^@W4+`h40+4?^h50^@+`H60 +h +`4?H30+K0h3xK.4^ *K.4Ҁ6 K.4!b+`4#48 +""H7 61^ 6 `Xh|(+`H6(  ?^=4:1Ϗ+` H<( +q04: +`H9 4#\ 4d^@`h|0+` H<0+q04: +`K.Qh:  LK.K.4Z BK.4 *K.46 K.4@ RK. K.K.4 O@ K.K. *K.4p K.4Ȋ-+4h6 4#+4?H:^k0i ?4:2!+`4$470+H? 7k?^4h(H(h` `a+`H4(!Z+PH:` k0i"^U62Ϗ 70qk0^70K0^4: K0 s u^}6K0 _ s^M6"K0i k0?@"K0i"6# k0iK0iK0  k0i +` H<(K0i@JK0i+`h50K0iH!06 #^72Ϗ+`h (+}p43+`H4(t J+}p4#+`H6(4$\ v H(a+`H3(46t_Uh4(4K.6&:k04k0+`h (+`4$48 + "}H7 4z3^6y H k044y3Y7K0`K0+`H5 4B6!+`H? k0k0K0Bt bK0BK0K06tk06K0k0@??K0K06?@Xk0+`H6 K04  K06?_k0K0ٌ @+`K0H3 Bk0ц bK0@? ?K0K06k06K0k0C`?K0+`H: Z4#\m7Hv(+}p4!6 "^6z3Ϗ+}p44+`H5(H9 [  K0 b^m@ ?#k04 494!7 Y7@+`+`H3(46t\ h4(+`H6(46@h?(+}p44+`H5( J+}p4#+`4$H!(\ a H(`+`H4(46_Uh5( ?494A+`#H704 Ym7 K0Ɇ`` dK0+H4!+`h (+}p45+`H6( B+}p43+`H7(#w 4Y74q+`H4(46_]h5(8K. ?4:4+`4#48 +#H7 ^ 7 `h|(+` H<(+`H: Q u4#h| Z7\ ]7+}p h<"^ 63Ϗ+}pH:4#+`[H9 h`K. K.4Ȉ6 j+4h?4#+`H:0+}pB 49+h<xph`+`"H8 4 6y44#Ya4Hz0BHy +h<x+H4 H+H5p +H!x H5@+H?` +H3p` K. "^ 64K.4Ȉ6 #^ 75K.4p "^ e651+(H<xK.4\6 +`4#48 +#"}H7 71^ u6y `Xh|0+`H40 "^ 61Ϗ+``H<0R^ @+``h<0+`H<0ˀK.4"6!J+|4: p+H98+H4 #"}k?75a^6w +` 0h<0"^65ϏRJ+`H60`+` H<0H:0^ 4#`h|0+`H<0+`4?H30+K0h3xK.4H ^@+``h<0+`PH<0+H6  B+H!  *+H9`Yy4(K.#^75ϏK.4R!+`4#48 +""H7 65^6 ` h|0+`@H<02+H! $ *+H? *+H3 d +ˀ0h x+`GhH: +h<xK.4 2+H6  ?^}4:6!Ϗ2K.4 "PK. K. K.42 PqK.K.K.446!+H? "^6z6Ϗ+|4: +H9@+H6 ""k?67^6 +` 0h<0 ?^4:7AϏ+`UH:0K.K.46!B+H4  +H5 +H6@2+H? 2+H34+H5  "^67ϏZ+H! $ *+H? :+H3 d "+ˀh xzrPa@`K.K.4 ^u@+``h<0+`H<0+h +4h6+h6+4h<xK.48 ZK.4 BK.4؂ *K.4$ K.4ʊ +H5  +H6 +H! @R+H3` +H4 4@"^68Ϗ\ K.xK.bK.4 K.4.!:K.4  ?4?8Qk0"6t8k0+}4:+H9+H6 "K0k?^6 +``h<0+``H<0+`H!0 ]K.0K.+`K.]H90K.K.4̊%"6 k0+h9+h9+`4#48 47(+H6 k0"k?^!68k0`Xh|0+`H!0; #^)7Ϗ+`H<0+4?h3 +h X+h `+tH:4#+`H9 Z4$"Hx4 68Y)4H( "^969Ϗz ?4:9q+H3 #k?7 4^70+`` h<0+`H<0+`H: 4#+H9+t^A48""66 4x ^4`h|0+`H<0+d`H: +`Z=H9 +H6  +H! +H? @R+H4 +H5 4@ ?^I4:8Ϗ2+H? P *"^6z9Ϗ+H4 +H5 "^6:Ϗ:+d`QH: +h<4#+tH8+ h84 4:qY 4Hx4 4:Y 4K0+h?+4`3+h X+h `+4h4 +H5 +4h6ˀ:2K.4 K.4ڊ r+H5 +H6  >^4: Ϗ\1K. K. K.4: +H4 "^i6:Ϗ:^q@+`` h<0+` H<0 +4`6+H! +4h?ˀK.4!:+|4: +H9p+H! ""k?6;^6 p+` 0h<0#^!7;!Ϗ  +`H30``+` H<0H:0VM4# h|("^6;qϏ+` XH<( JK.4"r+H3 ` +H4 b+H5 +H6@R+H? +H34@"^I6<Ϗr =49 +`4#48 +"H7 ^a6!^6 0h|0 =4? +`8h? R+`H30``+`(H<0+d`H: 4#+`H9 Zm4$Ht ^h `h0+`H<0+H5 "^ 6=ϏB+`H! @? *+^H:p+"+tH:4#+H8+`"H7 Y=67a^1Hz+4h<xK.4D +}4: ?48>+H3 #k?4^ 72a+``h<0+`H<0^ 9@+``h<(+`H<(+`A9H:0+h<xK.4b K.4`6(+`4#470+H4 #"~k?7.6y<^ 4`h|(+`H<(+`4#48 +""H7 6>^ !6 `h|(+`lH<(+`H: Q4#h| C "+`"~H9 ^ )6z<K.4b H@(+` =48 +"H74 6?!Xu4#HD+}@43 +H4 v $+d`H?+H3p sT $j+}@46 +H!"!6?AAM4!+}@45 +H6" 6y?QA4 +}@44 +H5# 7?aA4 Z+}@43 +H4 ? v49?qA-4"4 +}@4? +H3  s4y?4$X4P 4G5@G%@"H4 4y?X6 H B+}@4? +H3 s!+d`H?+H3p sT !+}@46 +H!"!6?AA}4>W4 +}@45 +H6" 6y?QA4=4 +}@44 +H5# 7?aA4=4 +}@43 +H4 ? v49?qAE4=4 +H?A +d`43 +H4t *+d`46 +H!\ \4 +H34?+d`44 K J+d`4? +H3+`" H80Y 6?G +"H74 4y?6 X4$H+d`4% 4X4y?H46 X4y +`H!0?04+˟Xh?xK.4 ^@+`` h<(+`$H<(+H5  "^ 6PϏ2+H! *#^7ϏWU4ˀRK.4H$+H54j@* ?^Q4:Ϗk?+`71h$ 4 4& h?(4#4048(E4k?+H4 "}k?4P6y 4w0^4`Xh|(+`H5( "^A6Ϗ+`H<(+`H!0 #]7Ϗ+tH:4#+`H9 Z4$ H 4 4 XE4Y%Hzh0+Hs" |6H7 k94@6 ]}4 ` h(+`H<(+`H! @?!+`H50"6 K9H9 4#[6?+tH:+d`H8 4^ 4%H hy G4p+dp4JHx `?04 ` 44X4K94 4Xe44hs(+`H4(4#+dp6``52G4:0Ha(4?h(K944J4"K94 6yX4+tQH:+h<xK.4 +46H! 4k9+H?j 4Xk9!4Uh8+`h<(`:K9+K9!h3 +h4+h x+H5 ] @+`lH<(K.466 +H? 4k9)4Xh3 4U4+`h<(`BK9)+h4 +H5+h5+h x+K9)h60+`|H<(K.4! +H4 43k91+H54k994 jx 4Xh6U4+`h<(`BK91+K99h? +h3+(h x+H4 ]@+`TH<(K.4J&k9Q4k?79yk?q =k9Y4$ k?+k9a ~H?+k?4%H4 +}k?45@k?y794 4x8q]4k?7: k? ?k?79yH k?y4k?48k?q]4k?7: H k?4k?4x8k?4k?y]5k?q]579+``h<0+` \H<0+wH5!]@Ӂ?0t4c9q@C9qt0z4@k9i]@ǜ@ 4 >]4:3ϏJK9i J]=@ǜ04"]m69AϏ 6 .+wH5( k9I r+H6  >]4:9Ϗ*#7:k94k9Q 4k9Yk9ak9Y4k9aϝ2+wH!$ *+wH? ϝ  +tH:4#+w"dH9 Z 6x Ht+`h4 ]4#`h|(+` lH<(+H5 膤 *+H6 *+H! $ +ˀ8h x+wH?( *"]6zϏ+K9YH4P+ h4+4 h6PK9a +h PK9Q p+`H: P4#h| C` "]60Ϗ+4h68+`H: +H!]}9+h<x4?+H3+Kx\h3PNK.4L K.4z6,hK.k:Y4zk:ak:ik:qk; k;4Pk:Q+H5`+H6+H!46k:Q+H?  +H3` +H4@R+H6 +H!4@"]6z@Ϗ+H64k?+k?"H? 6 k?"k?4$+}643k?y7; k?q7;Q4 ]4wk?7; H k?4k?4xk?4wk?y]Uk?qK:Y'J7;Q]= +`h<04# =4% 4 47X-4+wH74 44&X4H(4 4X4H0`+`H<0+wH3j%]E@ӕ0t4c;@C;?0z4@k;]@ǜ@ 4"]63ϏZ+wH6(#†̅R bȁr"€b  * K:Y~4k:Qk:Q4k:qK;+`4 h3(+`4#47(+H6 "k?606P] 4`h|0+`H<0+wH!(& +`H?(k:aH4(k:a+H5@"+H6+` h6(+H?+`h?(K;` +`H:(] U4#+H5 "k?7644] m4w(`h|0+`DH<0+`H6(k:iK; :] @ǜ 4"~] 6z9AϏr+`4#48 +""H7 6`] 56 ` h|0+`XH<0J+d`H: 4#+`ZH9 Hv k;K; :] @ǜ 4"~] 6z9AϏr+`4#48 +""H7 6p] 6 ` h|0+`@H<02+`Y H: 4~` ?] 4:Ϗ:+`H9 ZI7:PM7:@k;+wH? 4k:YϝrK:Y87;QK:Y R+tH:+wH9 Z4#Hv(+`h6( ?4:+`4#48 47(+H3 #k?]e7 `Xh|0+`H40 "]u6Ϗ+`0H<0"+tH:+`ZyH9 +`H6(  ?]4:@Ϗ:]@+`` h<(+`H<(zK:q 4?k:Q+t"H8K:Q46pX 4#K;K:iK;HzK:QK:ak?4k?Lk?+h<x4X#+`4#48 47(+H6 ""k?6]6 `Xh|0+`H!0; #]%7Ϗ+`H<0+`H3(` "]6@Ϗ+tH:+`YH9 +v4:+H9+H! ""k?6]}6 `k;K;+v4:+H9+H4 #"}k?7 ]6w `k;pK;+`4#48 +"H7 6P]6p`h|0+`H<0+`H60@ ?]4:Ϗr+d`H: +`#H9 4#Z 7 ]@` h|(+`PH<(B+tH:+d`H9 K;] K;+h<xK.4~!b]@+``h<(+`H<(+H9@+H8h+}p H7 ]}4z]m4z+H5B #]57 +H3HBt "+"H9H]6 ?]4:+s]4:+4xh<xK.4> r]@+``h<(+` H<(+s]m4:+4h<xK.4N"J+H6  +H! +H?@R+H4 +H54@ ?]Y4:Ϗr+`4#48 +#"}H7 7]q6y ` h|(+`H<(+H4 *"]6+ˀh x"]]6 k;+H!k;K; jXK;@R+tH:4#+`"~K;H7 Y6y7a]Hz+4h<xzK.4 *K.4€6 K.4 $+|4:p+H90+H6 ""k?6 ]96 +``Hh<0+`H!0; #]7@+`xH<0+`4#48 +"}H7 6z]6y `h|(+`H<(+`H: Pq4#Ht0 h| ↈ r J "!+`4h5(+`4 h6(+`4hh?(+`4 Hh3(+`4(h4(+`H50 :Ka?4:@+`"H8 ]6-" ?4:-+`]H9 E@ b+`H?0 2Ka?"4:@]a6y 4"]64+h<xϝj+`] H:(@K.4 @+`H:(H9 ]4#8h|0R+`H:(H9 ]4#h|0+`H!0 `R#]7p8+`+`4?"h30]6+`H50+04 h<xK.46 K.4 ]@+``h<0+` H<0K.+ 4h5P+4 h<xK.46 ]@+``h<0+` pH<0X M@+`h<(W4+ (h<xK.4"+H4  +H5 +H6@@R+H? +H3@4@"]6Ϗ =49 +`4#48 +"H7 ]6 `Xh|0+`H?0 +` H<0 "]6z @Ϗr+tH:4#+`H9 Y4$Ht]h ` h0+` @H<0 2+`H: P4#h| +k?7H7X7;4$]Q4HXh|0 0+`H60  ?]4: +`H?0+p4 Ph<xK.4""+H5  +H6 +H!8@R+H3` +H484@"]6 Ϗr ?4: +`4#48 +#H7 ]7 ` h|0+` H<0+tH:4#+`H9 Y ]4$Hs] h `h0+`H<0+`H: P 4#h| +H7Xk?47]7;h|0p4+h<xK.4,R+}4:+H9 =47 +H? "k?]6 P+``h<0+`hH<0+`H306t> 4u':+}4: +H9 =47 +H? "k?]16 p+``h<(+`H<(]@+`h<+`H<+H3` @+`H:0HH9(W4+@h4x"H90H8(]6 +4h6x+H!x %+`H?0424#44!J4$+`H?(`8+`H3(4``+`H5(+`H6(46@@+`H?(4` +`H4(P6?O+`H6(46 +`H?(7>4j6u+x46 p 4 +`H6(`8+`H!(4``+`H3(+`H4(4@@+`H6(46` +`H?(P7?O+`H4(4 +`H6(6>4j43+x44 t u4 x+`H4(`8+`H5(4``+`H?(+`H3(4@@+`H5(4` +`H!(P4??O+`H3(4 +`H5(6>4j6+x44 r 4 8+`H3(``8+`H4(4``+`H6(+`H!(4@@+`H3(4` +`H5(P6?O+`H!(4 +`H3(6v>4j6+x4! v 43 ?G4: `H@+h x+H<x+}4:+H9+H4 #"}k?7 p] 6w +``h<(+`lH<(+`H5(4> z+xh h +H! 2K @W4+h<x+ˀh x+ˀh x]@+`h<+dH<+H?"Z+H3 `"+H4"rc;+`H604c;7;c;] a4W4+h?x+H3` +H4!z+o4:P+`H604"6 6 +`H?04؊ +`H404 b+`H6046 #H7 +44;Q+`H50 "6 43X 6x+o49P+`#H704 W7 +H3` +oI(4:P+H<x+`"H90]6 +4h<x4K. ]@+`h<+LH<+4h<+h +h (+h<xK.4 "F@+h<xK.4"+`4#48 +""H7 6 ]6 `h|(+`,H<(+tH:4# ?Yq49 p+`Hz]yH9 Hz47;I]44k=7;K=t "K=46_k=+xK=7;6t?h4 H+{h5 6k=Yh6 ӟ+ x`<+""@76y 6 W4+4]Yh5+lH<x =48 +"@74 W6 +4 h<xK.4! +`4#48 +""H7 6 ]16 `h|(+`|H<(+`H: 4#]94"h| 6<]I7 ?Hz Y49  4+h<xK.4%+z@4pk> "]6 0+` 0h< +z4:p+`H9 Z4+z` n@!p "]16z @Ϗ2+d`H: 4#+z"49pZ6 Hu "*` +`Hy 4#48 47(+H! 6 ]Qk?`h|0+`H?0 h+`]!H: `x+`"H9 6z \4#H|0+`H40 +`H<0+`H50 +d`H6 H: 4#+`H9 $Zy48 H +` ]Hz Ї ""\6z@׏\@+`h<+H<+H4 2"\6 +h xD׀+d`H6 B B+d`H: +z44#\48p``n+z` p+tH3+`h3 h 0+z@4p R+z49p4"k?6-4]i4+`h<0+`H?0 @+d`H: +z49p+zXE48pH+`H: +z48p+z"~6y7aX47p+`H: 4#+z48p+d`"H7 X67a\M@\MHz +H5 @h|0\5ҺH|0K.4"6#+H?k> *"\6z 0+ˀh x+z@4p "\]6 p+` 0h< +z4:p+`H9 ZY4+z` n@!p ""\6z ϏK.+d`H: 4#+y4$p"6 Z4Hu "*` +`4#48 +H7 6 \4`h|0+` H<0+y4#4:p+`H9 4$Z4+tH!``&nh +z@?ph0 R4+z"k?6-49p4\U4+`h<0+`H60 @+d`H: +z49p+yX)48pH+`H: >497a+z48p+yX47p+`H: 4#+z48p+d`#H7 X77a\5@\5Hz +H3 @h|0\z H|0K.4(""\@+``h<0+` |H<0 \4z+H64z@ +H!#7p6a\%49+H4 J+H5 2+ H9\4z\4z+H!" 6+H?"6tp6\U7+H5 :+H6 " ?4:+\H9 \4z\4z+4 h<xK.4*$B+`48 +"H7 6 \6`k> K>+tH:4#+`H9 YY4$XH Hu4h Bk>6 K>+`H4 7? 4Ҷ6 K>+`H4 7? tK>6t?H6 k>6Xh? +`K>H? 4T uK>H6 6  K>A:+`H3 K>4Tt Ҷ6!K>+`H4 7? 4TҶ6 K>+`7?H5 k> K> @z+`H? K>4T ҕ BK>4T4??+`H3  ҕ?GK>+H!؄ +H?Џ ""\-6zϏK.+`\H: hk>!+"H:K>!6X4\@+o4?lh<+`"H9 \e6Ϗ)"k?66\A4+``h<(+`H<(+H!\1k>1+``h<(+`H<(K>)` K>1``""\6@ϏK.+H5@2+K>)H!6`+H?k>)+H3`@2+K>1H5`+H6k>1K>)WmK>1+`h<(W4+h<x\@+``h<(+`HH<( ?#4497 W 4W@+`h<(W4+h<x\@+``h<(+`H<(W@+`h<(W4+@h<xK.4,k?14?k?9 k?A4yk?I7?1k?Qk?Yk?ak?i\9k?)7?Q\!4y4k?+4$H!7>k?+k?q"H3 4%k?+}4x6 k?44k?y7>94 4&\y4wk?4@k?"k?y7>HH k?4 k?68k?q\4w7>9\@+``h<0+` H<0+wH5H4(7>$Hk?\@ӟ0t4c?!@C?!ҕ0z4vHk?\9@ǜ@(4#\i73Ϗ@K.+wH3(fbf"b†b ʎ`#BK? j+`4#48 +"K?)H7 \Y6P`0h|0+` H<0K?)+`h6 +`H9 \7?17>9+`h  K? +`4#48 +#"}H7 7p\y6y `@h|0+`H40 +`h  xH<0+`H9 \7?97>9K?+` xh  =49 +`4#48 +"H7 \6`h|0+` H<0+`H9 \7?A%7>9K?+` xh  +`4#48 +""H7 6z\6 `h|0+`H<0+`H9 \I7?I]7>9ϝK.K?k?i K?i$"4k? =4$ k?+H?+k?7>k?q4%H4 +}k?45 k?y7>94 4x\a4k?7>H k?4k?4xk?4k?y\k?q7>9\@+``h<0+` H<0+wH3H?(j!k?\@ӕ0t4c?!@C?!?0z4Hk?\A@ǜ@(4"\q63ϏHK.K? K? ?4?+`` ph? +`4#48 +"H7 6\i6`h|0+`H<0+`H9 \7?Q7>9ϝXK.+wH9 \7?Y+`4#48 +""H7 6\q6 `h|0+`H<0+`H! @? K?Y+`h4 +`H9 \7?a2K?i!"! =49 +`4#48 +"H7 \60`h|0+`H<0+`H9 7?a\!4#+#K?aH7 7`\Q4x `h|0+`@H<0+`H9 \7?Y\Q@+``h<0+`H<0K?9K?AK?IK?QK?iK?YK?aK?1k?k?k?[k?+`@ h<0+`H?0+h?x+`(H<0K.4"+}4:+H9+H! ""k?6\ 6 +``h<0+`H<0+`H?0* r ҇ 2 ҏ b [@K.P@K.F@K.[@K.+`\AH:0K.\Q@`K.[E@@K.+"H9\ 16z4?K.K/K/K/ @O/_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ? (0 " )0 ."k?ok? +H<!J#7 @47 pVU4 K>6y 44xV4!k?I4k?4k?Q7?Ik?Y4yk?a4k?qk?yk?_k?#_7Y 7X p7Vm4 +4h4 K>K? @O?+H#+ H$"6 p@}>"#7 47 4 V4x4"6y 44xVu44y_4#_ (0 +k?7+H?+ Hh  #7 47 pV4 K?Y@7?#_7X p7Y k?4V}4+H3 ?K?Y_ 4#K?7 @7V4 MK?Y ) "+H5?H3? k? ( $Rk?ok? k?k? FD4 pk?!4 `4 VE4+H7K?!4#4 V 4 Hbhb!H4~?A +}48 7hw  4 V440Z' $⃂!r$*46$+}`$4` 48hw4 hwV44H|  * (+}497_4+}`$4` hu40 44>HHx  2H@"+}497?_4h`+}` h`4 4hv4 4@4`4hz+}Hw484 V544"+H4 !K?!44 V4h`+4h< 4^@4`HHd P4 Xh`+}49k?I7?_-4HwK?I4 0V 4h`+}` 4 6h|44^@4`Hz h` bH@R+}49k?A7?_E4HwK?A4 PV%4h`+}` 4K>K?K?K? @O?406hu44~B"4b+H?Ѐ!4҈!JHt+}4$ 6?k?Q4 p_%4 k?9_M@Xh`K?Q4 _4 2_@Hz_K?9h`Hs  H@K?97?_E4HwK?94 V%4h`Hv  bH@R+}49k?17?_4HwK?14 V4h`+}` mh`406htM446 4 hs+H& =4HHz_@2+r7H7hs $h +rH7h`uh`4! Ha h` bH@R+}49k?)7?_ 4HwK?)4 V 4+H= h`+};` K?!4 4V 4 +rH%H}4 ]@+H% 4;-h}HHu7@b+rH6hw 46"HsH&6}h} f h +rH?h`mh` ( $Rk?7+H:H4@@+_H98K?Y+H?8h H+`h?p@7? ( $Rk?o+`H?p+4#+`7h7pH}HHy(7 0hH4 4K?Y@O?#_7Y 7X pHwHV 4 HzH_Hy8Hx8h`H+`}h8p@P@K?@ @ ' 'B ' + ' ,Rk?o+H8(4#a Hy@h`(+`h9x_u4A7+`H7x6h=xHb(4__-h(`7Ht(4 +` h7_H9x`Ha( hw(H|@+`h<x+`H?xHx(7h3x7?Chu(7\K?Y@O?@7\uH|@ ( '+H5?H3? k?k?ok? k?k?k?!k?)k?1k?9k?A+`4#+4%Ka?44& 44 4 _4 ph|4P74 VM5xH` hi hhh4H_Hxh|`H4p5xV4 H _@ן4?K>K?AK?9K?1K?)K?!K?K?K? @O?4HHxhw7?hy6hz]BKu0qKs0y k? $ ) ( ( ' + 1 ( ' % ( # ( $ 3 !b 3 %r ( $ %  & /+H5;H3; k? ( / ( ! (p 'b ) " ( "B % ) % . ( Ku1Ks1 k? & ,+H5:H3: k?k?ok7k7k7k7k7k7k7k7k7k7k7k7k7k7k7Ka?_E4:k8Ka?4: _k8k8+4:k8 _4c?3+}` +h _4#+H<3r+H= 4(@0+H3  +H43J+H1  *+H2Ј +H? 3*Hw@ :Yu4 h|@3"Hl@h`(+`h,xHx8 :Y%4h|82Hm8h`H+`h-pHy Y4h|2Hz0 Y4h|02Hk+`h+4$ `+H:h!: +4 pH74P4 V]4Hw(44 V54HwH44 V 4H44 V4+rH8 k8144PV4 +H!،?@2_@474VY4 +H4؈H+ H744 pV 4 +|4&P444V4+H= +'849+H8 ( 0h`PH :!F+H: 04? ^44_@_ӚIY H _46Q6P:_M@_MӚBJIX H<+H? U 6_7+!N!"."IA H"4HiR H+H0 o "+H<h V]+H4 Au! _M6 (7Ht _-67 RK8!4 4 V!5ck8)+h إ# #I7 p%$4hX@Hb(`K8_7;  K8_7; Hpp4zj_54ph`p+H:_7;  +H:_7; K8A`Ho(_7K8_4k74!6+H3 !+H5!Aq lAp nK8!44@VA4_ @+}IY HH8Hx<@Au l 8Ax n+H8 (4_5:n"+x@7!.J+I _uH9 hn2+H7 @K8!4V94 4_544_4+H7pK8!4 V4 +H5  +H6p r_@K8!74P4Vi7@ǨPK8!44V14K89 H| _]4FK8+H:+_5H9+H7+H?h@-h`hhhP hX+H8 (4_=4iR+x@5!)+H*h``W04 (k89+H< 蓉04 k89K89R+H3 )R+H. )+|49P_4p X+ H ZHX =877HP =877Hp :Hp _Hb  k8I9@Hb +H1  HrB9}@Hv>:+H" >"_ M46+H?؀ "+H9h V]46+H0  Hu  H O j+H< R_5+H1؀ "+H8h V4_M5+H2؀ "+H7h V]Ht  2H} "c?17?14_4+rH4 7k81TW}k8YK81K8Y5P  _ eK8 _@FK8_m@Hv``b+H!  _E4Hb`B@"C@` _@h``Hhh;K89<+H' ;+d`@=Ѐ;4!494p5V4_ ]@_ 4+H! &ˀK7Y_ @+H? _ 40+H= @_ Ӻez +4 pH7k8!4&4V4 +H7K8!4'4V4 I K8!4V4 +I _ uH9 hv7+H, 6+K8!4@V!4 _ @_ 4+H3 +|4)P+`549+H6 _=@K89 _ 43JK8E@_ @T@Ka?H747V 4!__ E5ZˀK7Y!?_ 5:ˀK7Y!_ 5PˀxK7Y _ 4ˀPK7Y _ 4ˀ(K7Y _ }4pˀK7Y _ U4ˀK7YHz04WA4_Hz044@4V 4 ˀpK7Yˀ`K7Y49P_4P++| 49P_}4I ?@ _]4+H1Ȁ +H8 @44X40 4+|4- _@_4_4 +_4+H2؂@:++~@490_M4+H9h4 :74 %4 _4z`EK8ˀpK7YHz04`W58_5Hz0ˀ0K7Yˀ K7Y_@_m4ˀK7Y_M4_=4P_-4_4_ 4P_4ˀK7YH@H@+v48 P +v s X  k hX4( H   9  h` 8  hPhh+H(؅ hH+h +H1P +rH8@H8HH@0K8!C 4 4 hho+v B48 y14" J  Y142+v N4) ? 4? 4 hy+H3  4+H/h+ WK8!h`4hw4 h 4 Vh`+4 h:44_]79 44_=7; 44_7= hip+4)+4*+x4++4,+{4-Ka?4.K8!44V4_4K8!k8A44 V7Hwx#ZHqH *+H:_ 7; Hp(K8_ i79 Hp( K8A`"K8_ 17; (++H:_ 79 +H:_7= K8!44Vi4k?4 79 7; _E7= K8!7404 V 7`: I()wHppI}4 UHppK8_7;  "K8!44`Vy4+H:_I79  R444V)4 +H:_79 4k8A79 _K8 BK8!44V4K8_979 4+H:_a7=  R444VA4 +H:_7= 4k8A4K8!4 V5HK8!40V4 HwxK8!4PV4  "H`Hx'/+Hx!K8!44pV14Hbx4Zhzx@P!K8!h`x44V4+d`H=("X IȀ"B+H! @44""K8!44@VY67H60?haH4=h@<@hӚ>HxH^HxHax >oHx}+H4 I8P =+d`44U6I8 mhxx_1@?Hb60 ZHh :=877H` :=877Hy _:k8II3 p` 7HH4 z@HP b_4_Ӛ40huP "_4_Ӛh`P:+H?>:_14?:_!+H1؂ ;]@+H2h 04V_4 K8K89 _94E K8T!@Ka?H74`7U4K89 _4E K8T@Ka?H74`7U4K89 _I4E K8T1@Ka?H74`7U4 IV H i@ H :+H3 K8Q` 4k8Q :Av! +H:ȓ@0h`pA} ܏> @K89 _ 4 0EK8K8!44 `U}4+H9 A} ܀ "+H3X _+H! ;HTy5C = @7 _ Z 9 ? 4k8)+4+|V47P_H0+H8 dzH0V]4y_H0+H?+H904 04H0V4y*@_H0+H? 4怿$"4ހ#4ڀ$*4ʂ#$*_4z*+_u4_uӚK>K?!K?K?K? @O?+h p_-4z)K>_-@K>+H3  +H6 j+H:04?\4?H504H30`_H:0K>_4K>+H4  +H5 j+H904?64?H404H=0_H:0%K>_4K>_@K>+h p4h"`_-4z)K>+h p4h$`4h%h_4z)UK>+H5+H:0 (4$+|48PV54y)+H! 4y) ;W4x*0E4x* _=K?1+_4z*p+" _6*H+# _7* +# _7*+H3 H ` H0 4y+4x+1@4x+AV@_=H0+H'؀ "_4z+Q+~@_4:0+H= 0S@=K>_4_Ӛ K>+H< Ty4K>_}4K>+H& r_e@_eK?1H @_]ZzWK> _E4:+q+h p_4K>K>4 +n4# +`h#4|h<4$ eH46?Vh8H7AhC\^@-H_4K>_4K>_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?k?ok>A k>k>+b4: k>4W7VQK>+s4:k>V)7+d`4:k>V7+|4:Pk>V K>V  V7?A 6@ 4@: !K>V49YK>@O>+H8K>y  @k>+H7؀ ""a6y;Va7?A @4YPW Q7?AAa aK>K>K>K>k?7?AK>k?4y;k?7Vk?K>44y<1U%4 K>Y@ @K?@ @k?7+4#!#h?479<7@U4+n4: T I4K?Y@7?@ @K?@ @k?7+4#!#h?479<7@U4+n4: T y4K?Y@7? ' 'Bk?ok? k?k?k?!k?)k?1k?9# k?I78@7W k?A4K?9K?1K?)K?!K?K?K? @O? ( ! ' % '0 "k?ok? k?k?k?!k?)k?17D7# 4=!44U4w+H:ȃ@ B+H= H +H3` 4=1_4@Қ@!R+4%+4&+x4'+4(+4)4_@ : H  H @ l 2I7 "04_@: 2I  04_@` _4z 8@?@K>K?1K?)K?!K?K?K? @O? ( #k?ok? k?k?k?!k?)7C b$ +4%  4_m@ӈ44=A4@U5HȀ * "_5 _4?w4 b$?_4K>K?)K?!K?K?K? @O?k?ok? k?7C7$V 7:#!k?!479=q4 Uy4#A7Y=44 UI4xV )4zK?! `J e @ "K?! ^4 :_ e 4K>K?K? @O?ςK>+H5?H3? k?k?7# 78@#k?47=U4_m4+`H9^4+`H9^4#7>K?4U4K?Y@7? & ) ( !k?7+H4k? +H9 K? K?7?"`'6x /00N8F'F_-`H#K?_7>K?+h7 K?Y@7?K?_7>QK?Y ( #k?7+H?ȃ BW k?_K?K? _4K?Y@7?+H? (`:+H7W6`#@@7\@7W>Ƕ4?"`+}6y ȓ0L47 48 KW#@7 `@7@4& #@7>#@7@"@6?"@6@"@6?#@7@"@6?! @4<@"a@6|?1#@7@#@7?A"@6@# @7<@k?ok?k?k?+H4X!Z+H=4#!:+H94`x4%+y4&  V}HyЃ *H4_ 4+4h8`4+H:4%@@r+y4& VHyЃ *H4_ K?Y+4h3`K?YK?K?K?@O? $ ) $ * "@ .Bk?ok>k>k>k>k>k>k>k>k> ak?Z4z?Q7_E7?K?%*+q0448 G4<+q048 44> $47_7Z $7_7Z $j7_7Z $B7_7Z $7_7Z #7_7Z #7_7Z #7_7Z #z7_7Z #R7_7Z #*7_7Z #7_7Z "7_7Z "7_7Z "7_7Z "b7_7Z ":7_7Z "7_7Z !7_7Z !7_7Z !7_7Z !r7_7Z !J7_7Z !"7_7Z 7_7Z 7_7Z 7_7Z 7_7Z Z7_7Z 27_7Z 7_+h?ZA4z?+4:_7Z4z?+4$4%7_4Z4z?+4&4'7_e4Z4z?7_=4Zi4z7k? C7 +H8+y4:_7?!@R *+h `+4 h?X+h X+h<`4z Zk?7_E7?K?!+y448F4+y474!(47?79 7?79 7?79 7?79 7?79 Z7?79 27?79 7?+K?Xh?+y4* +y4)+y4? +y4@474>_+~4 4, "_ K 5kh +h++4 4+ j "_ * 5JH j +H:+@#hh*! 5(V}5"H 4_5+H: 4:_5HȈ 4y@_4+H+ "XQ4+y7"xh<V4yP+H<47Xh%+y7"h<V4y`+H646Xh$+y7!h<VE4yp+H546h"X)@+y7!Ph<V 4y+H&4h*H 4y_4HȈ 4y_44z+H:V 59?H@ @4yV 7_GHH 4y_4HȈ 4y_44zZ@+4:_7Z4z+4:_7Z4z0+4:_U7Z4zP7k? C, k?A_7?AK?A@ 7?Q44F4x+y4$+44%7 f 2_m H47_h4_-7?AK>YK>K>K>K>K>K>K>K>K>@O> ( ! ' %Ku0Ks0 k?k?ok? k?+ @h: a4X@7Wk?!4ypU14 _@+`H=4$ 4z 49 @4y_@+H%Ȁ bK?!44yU4S @h7C _]4z+H?$ڇ*"!J_4z44y4x:qT4 Ka?D4: HH# _4+4h=04$+H:@ X 9@+H:+@ X h H0+`h 4h04K>K?K? @O?+H? _4zpKa? JH4zp 4y@4y_U@Ka?_54zKa?D 54: HK _4+4h:044$4y4xT4 +_4z Ka?D 4: 44y4x@T=4 HK _54+4ȁ}h30+n4%@4y`4x4T4 +n@6@ _4z@ Z4_@  4z_E 3z@?@_4z2H 4z@4z_@_4z 44y4T4 +H904$ {+4h0_M4z044y4xpT4 +4*ȁ}h50@P@K?@ @ $ ) $ ,bKu0Ks0  k? ' / % ) %  '0 " ( ! ' + ' ,R ( $ ( / ' % & -B &0 *R % . & $bk?ok@61_4p)4K= _Y69%K= _94%K= _4P*q4^}@Ӛ  ^Ӻ ?  " z "_4+H!hg@ ?4+H2p@?4H4_ @_[4Ǽ_K4_ 4@)4UE4`42h04hw@K= U444h04h@^ M4Ѐ (K= U44(@h0^ 4 "K= Ue4 4 :h04 hx@ ='Ha@HyK=!73?`4?S K= ^ ]4Ѐ hk@h0K= ^ %4 K= ^ 4 hk@4.Mh0K= ^ 4  K= ^ 4@ hk@40h0K=K= ^ ]6 K= ^ =4` hk@44h0K= ^4 "K= ^4;GHa@hg@%h0K= ^4 hg@h0K= ^e4 hk@h0K= ^-4 hk@46uh0K= ^4 hk@445h0K= ^40:Ha@hk@4:h0K= ^e4 hg@K= ^54 hk@h0K= ^4P hk@Mh0K= ^4p hk@46 h0K= ^48Ha@hk@4:h0K= ^=48Ha@hg@4^4uHa@^y4Ӛ^ `@K=44T7@4 ?8hg@0hk@Ha@K= Ue4 hg@h0K= U-4 hk@44Ph0K= U4 K= U4 hk@h04 ^K=  hg@h0K= ^M4Ѐ hk@h0K=K= ^ 79 hk@46Uh0K= ^4@ hk@h0K=K= ^7 hk@44h0K= ^M4  hk@40h0K= ^ 4P5wHa@hk@Uh0K= ^4` %hg@K= ^4p5Ha@hk@+}@+P (Hg@(44_@H^1@Hz W @h`+H:@ W @Hn@+h 04h0Kk>k>k>k>k>+`k> k>64P4# h 4h}4+K>hz7Xhe4h'4&4S 4 #@7X@k>44S4 +H' (4 @ h+H?WhH f"?0D4h0h7084+h? h7 70T4?0.4+h7(?004+}48 +h?&hwHx44Sm4 +nK>` @44 S54H BV4h&K>44 S4V}4+4'h<%K>4@4 S4+H8 (+|4:P+4(k>4_5e+H: +H8 _4 @_4HK>4_M5f*+H: +H8 _%4 @K>U4P&+H?P@ 4g(``H?iRTHzHh|KHw\ hiB) K hxC9(Bt4(z7hxCә ?Bh6_4 _4 +44 &!5 0.`7>K>0N4p0&4S HwK>4!`S }4 +}H9]i4h|+}H8+}H7+}H=+nk?4C4: Hy]4+H?0**4K>YK>K>K>K>K>K>@O> G4`4_4+4ˀmh50?0p470h4h7 70V4@70X4@7064@70\4e@70`4E@70r4' 24U+}_4P+4ˀ-h604"_5+ˀh)04"_]5H+ h)0VU@ˀhT9K>4@|@"K>4pT7>4Tq7>_7>H+4 h(0V@H@ V}hˀhTaK>4@\@"K>4T7>4T7>_7>H+4 h%0V@H@ Vhˀh_]4pK>_E4H+4 h$0V5@H@ Vhˀeh HaH?p`+H?8 hH|KhbHuHJ @xhw@`x`x`xԈ X``+}H)8hi(``Hh +}H7hwH4$u THz`rHx7? 4vv 48hbHh "HT4Hhi_-4茢7++H?@ `hPh`K(Hy hy6B7K @hH`h`4@hf+H76x XhxHt hx 4xhg+H?6++H7 6+8oK>_4 K>4?_eHxK>ً6w+K> 6_++H=06?++H:  :_@K>4_7+_@K>4_7+H9 ?@_e4 +_E4@+H&@` HyK&+H6  `+H5 `+H< r_4p+H9 _44@_4_u4_e4 _U4  4 `4 @4 _@Hyt@_ 4 ςmK>Y@ @K?@ @k?7+n4:R4K?Y@7?@h@K?@ @ ( #+H5=H3= k?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?q+`H,4#C"+H)4 $i#04$h`0444@H 7 HH @` 4X@!k?45!S4Hj0 !+4& 44 4 4 4 h4 (4?4`Hz(]@b07K?64!S4  6HȀ _e6:47H7  6XH4c4!HSQ670#*p#!R"h`0Hy0 >Hz(""Hw0K?69"S4 K>K?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?!]54Mho0+}]H:4hn04?hp0HC B Hx  C  hhj0H BC_ "HC_Ӛ :Ht  HC_  hhn0HȂ`=Hy0H=Hy0_E4}Hy0H4!4ZU@ 5hj0H4!Ua4:=Hy0hn0H4"U!6: "H4"U70h4"!HH6S4eHy0H4"AU6 "H4"QUa60h4"aHH6S4Hy0@ @K?@ @k?7# 78@#k?47"Sa4#7"K?4S14K?Y@7?@0@K?@ @ &0 *Rk?o7Wk?#@k?!7X@ bk?4y#Sq4 K?K?!+H7+`h 0h8( Ph9 V4+h<!K?4y#!4 S4+K?h 44y#QS4+}H8+}H7+}H?+nK?k?C 4:K?44y#S!4_5@+`H<0K>@O?+4 ϟh=0+H5>aH3>i k? ( !k?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>#+7@ bH7k?4$4y#S4 H `k? ]%4ӅK?44y$SQ4]U4?@H@%+4%+4&+#7 k?4'4&4 !B4 >4 x!4d447?q4?_"] 4ӑK?44y$!S967]=6:_6:$c?q: 47?s4]}@ӒK?44y$AS6WZ"2"]6Z6447?q +n4y$a48@S)4 64y$4S7?q6?@z7?qP _} R  71?q 6?5@"?06_-? 67?q X 7Sk? 44y$S!4 K? 7?q  4y$S4T7?qB_7?q7K?4? 4 ]6ZZ>44h@ h@+H!Ȁ _4z%!4h@42h0+H<Ȁ _E4z%a4h@4.lh0+H6Ȁ _4z%4h@4(h0] 4 `h@H4^\ Z+_EH:4b\ 8+H3Ȁ _E4z%04+H4Ȁ _ 4z&4h@404h0+H5Ȁ _4z&14h@4,h0H4^1 Z+_-H:4R 8+H:Ȁ _-4z%04+H=Ȁ _4z&Q4h@ h0H ]4H@]4h@H 2+H9Ȁ>_M4z&qH@]}4%hh@H J+H8Ȁ _4z&4h@48h0 ]48@h@]5 h@H4t 4v 2+H7Ȁ=z_%4z&hH@ 4z ]=5 h@H( *+H2 4F  ]48@ h@ ^]5Z0h@H@H( "+H" H "]U5h@@H@ 4^ ]5Z0h@ ]5 h@?h@ F]5Z]h@H( 2+H! H4F  ]M5Z0h@ ]%4 `h@4J  ]48@Hh@ ]5Z h@"%]6:,h@H@H( 2+H< H4F?  "]-5Zh@H@ ]4h@ ]48@h@4J?h@?h@#]7Uh@H  *"E]E6Z,h@0H@4J  ]5Z0h@ ]5Z0h@?h@]5 eh@H( B+H6 *H4F_  4n? "#G]-7ZXh@ ]5Z0h@ 4z ] 4%h@H@H ] 4X`h@4J  "#] U7, h@"] -6h@H@H 4z ] 48@h@ ] 4Xh@4J  "#] }7h@] ]4Xh@HH@H ] %4%h@H( H "] 5`h@H@ ] 5 h@ ] 4Xh@+H3`?h@] M4 `eh@+H0 2+H5 H4B_  "] 5`h@H@?h@H( ?h@] 4h@H( "+H4 H 4h@ h0+H7 ] 48@Ph@ ] 5Z0(h@  ] 4 `h@H@H 4z? ] ]5Z0Xh@H  ] -5 (h@  ]4h@H@H ]5Z  ]4%h@H ""]e6,Ph@  ]548@ h@0n] 5`h@H@H ]48@Xh@  ]5 (h@#0n]u7,h@`H@H  ]=4%HO ]5Zh@H  ]5Z0h@4@H 4^? ]4%h@H 0r"g]e6zPh@H( "+H3 H "4h@4<h04@ 4^_ ]5 h@ ]4Xh@/z]u4`h@H( 2+H= H4F  "4h@4@h04@? H  4^ ]5 h@4n?.#]}7hh@H  ]E4 `0h@4^.]48@h@H( ]4X h0H  ]5Z0 h@H  ]}4 hh@4^? ]M48@ 8h@4F - h@H4@_ ]5Z h@H  ]4 ` h@ ,]4% xh@H4@ ]U5Z @h@H  ]%4 h@ +]48@ h@H  ]4%0h@H  ]5 h@4@H "#%]U7:, @h@H  ]%5 h@4^?*]5Z0 h@H4@ "4h@4. h0H   *z]u5Z0 `h@H *J]E5Z 0h@H ]4X0h@H  "E]6Z,h@4@H ""]6 h@0zh@ xH@H( ]Q5 @h0H  ]!48@ h@H (]4 `h@H  ""]6Ph@H  ]y4h@]Y5Z0h@HH@H( ]!4 `Ph@H  ]4%h@]5`h@H@H( ]4Ph@H  ]Y48@h@_4z&h@(H@H( ]4%Ph@H  ]5 h@]48@h@H@H( ]q48@`h@H( ]A5 "H  ]5Z0h@H4@%4h@40h0H4(S%+H?Ȁ%_14z&qxH@H4(4%R+H2Ȁ%:_4z'A(H@H( ]5Zh@H  ]4 `h@4($+H1Ȁ _14z'a4h@40Xh0H $:]14 h@H $]4%h@H #]48@h@H #]5 xh@H q8h@XH@H #2])5Z0h@Hp ]4 `h@+H:""]6!h@H "]4ph@H "R]I4%8h@H "]48@h@H !]5 h@H !h@H !]y5Z0hh@H4@ " .]94:(h@0(h@H@H 4z ]5Zh@H0zh@H@H 4z_ z"$]i6:!Xh@H 24z_ "+H? H( Ph@H@:7?q! K? 7?q @ +H)Ȁ 4e'4_9K? 4 _4z'K? @0_4z'K? 4z'4A `0_@_4+n4:@T4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>H0zh@%H@ ( ! & )k?ok? k?+H5 +H6  +n4$@@ 24 "4@ ?44$r`p4h# +H?+4 8h7@+H=  "6(Q_4y+H:4( 04#+n"4:@]6(%+n4:@ k?1]4(ы%2K?1]a4(ዀ%K?1]A4($ K?1]4$K?1]4$K?1]4)$K?1]4$K?1]4)!$K?1]y4$K?1]Y4% K?1]94)A%K?1]4)Q%*K?1] 4)q%:K?1] 4)%JK?1] 4)%ZK?1] 4)ዀ%:K?1] y4*%*K?1] Y4*%:K?1] 94*1%JK?1] 4*Q%zK?1] 4*a%ZK?1] 4*q%:K?1] 4*%K?1] 4*%B4hd@+4(h"0] Q4+$K?144+R4 `K>ـ;4"6'4[4;+S4` 84X@_!z W=47+H: C;O+7?A"'6/00N8F' F @Z+_@zO+"b6z(_E4y++H94"h|@#_7(K>xh`@4`h|@4Hha@4h|@+4.h?04hv@+40h$04hu@+40h#04ht@+4,h%04hs@+44Xh?04h}@+48(h704hz@+40h"04hy@+4.h%04hx@+4@h80h`@4hw@+4>Xh904h@+4<(h=04he@+4K?K? @O?+`H9+804hx@42h30K?1]14* 4]hv@K?1]4* 4%hu@K?1]4* *4hb@+4Bh40K?1]q4* 2K?144*R54 K>K?1]4+ 2K?144+!R4 -K>K?1]4+A 2K?144+QR4 K>K?1]i4+q8K?1K?144+R%4 uK> ( ! % . ( $k?o+H!4 +H60 @@#@7X@"76+4 RI7`+H7+4!h30"_6+4|+H"Ȁ@!#_7,x4|+H3  R+H9+4  h40"_=6,!`4|_-@`X7+H?+4 h=0#_7,q4| 8+H<Ȁ b#"_}7:,H4|H8+4  h:0#_M7,4|K?Y@O? ' + & $b '0 " &0 *R ' Bk?ok? k?k?k?!k?)k?1k?9+H7  b48@k?A4y,R14 +K?AH74y-R4 +H"4@"+H&"+H%Pb_@K?A74y-!4 Rq7b+H7 +|48P4y-AR14+H7K?A4%4y-aR4 +H7 (K?A4y-R4 +H3  +H5 (aH +H? (PhHa+}46 !+H?8 +` h?H+`h:4&+H(@ Hx0K?A44y-4 R5A! +H: +H8 _U4 `+H?P+H' @h 4?`HȀ4Ȁ4Ȁ4Ȁ4Ȁ4K?A44y-R4Ȁp4Ȁ`4̟P40HpH`Ј```\5:44y.a58R4 Hh@04_@K?A45YR4H8\m544y.5RA4 H!K?A44y.R 4H44=87K?A74y/4 R7_4_@p+`444y-4 RI58@Ѓ>H8Hh44y.R 4 Hh _@4j.1K?A44R5Y+H? =H8Sy5:7_5:}Hh+̟@h' 4K?A4y/A4 R4+h' 4K>K?9K?1K?)K?!K?K?K? @O?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?@ @K?@ @k?7+n4:pP]4K?Y@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y+`h @4$+n4%+#!044&7'h44 4 @4 4 ~4 444N4DHPB 4Z zC bHP4C#Z7hPCR6]?S4? `+n43 c ˀXb "b "b "b "b "b "b "b "4"bh "Xh@+n4:4h@ C 7ςhhPh`CZ^@!HP6hPCA8h`CA^:!HPH`6hP ZB Z 7 8h`^-Z HPRC^ HPc6hPByBw4 A^2 BHP\4UhPcBә 8_b8 "HP4cC " "4cHP46|hP\HP+n44  4K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O? ( $Rk?7+H:x@@"+n_49 +h x+H9p @"+nR4:+h pK?Y@7?@@@K?@ @ ' 'B ' +k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?q+`H%H4#4#+n4% 4&+4'+4(+4)+4*+~4+!4 444H|`7?`JHyp77  ? 6H}`7?Hyp_5475p54 R 7b I?h r_4IY HIx @D 6:  8HsH i@ H4iB HH|`Hsp7?  84?HtX BHu`H}pI?x6? 7i9x :H؀ Ih "Hv`Hpp6? : JHu`Hbp6? P  "I4p6i:p _RHzh@BHt`Hap6? " P ӚHzhW7HzxHyp[AHx`04`@h}H_@_@`(7 h4HsH`<4K>K?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?@ @K?@ @+`@h Hk?ok; _m@+n4$R4@74|? 4+H:ȃ@ B+H= *"644Pe4w F4+H7+`4!h9H+H7!"466P4K:c;7;q4?_"+`h$x7;qh8p7;h5h+n4:p+H9`+`h#`+~H8 H+~H7 P+~H? XAk?+H"Ȁ B+H# * "4497;P4 +H$Ȁ J+H? 2+`"bH7H6y 6xP54 _u@K:K; @O;@@K?@ @ 1 ( ' B ( $R ' % ( $ ' /k?o+n4:Rk?+H3k? B+H4 *#B7Y`K?K?P4 bK?S 4y#K?S u4y#K?S U4y#bK?S 54yЃ#BK?a K?C :K?7_=@ | b:@?@K?_K?+`H5X *+H6 H K?_K?+H<؀ :+H! H "RK?K?R7+`H?@"r_=4_]Ӛ+H7h +x@? l Z+H7 B04_@_Ӛh+ R+H?  204_M@_mӚ+H"؀@!J+H# H`!2_4RӚK?Y_4_Ӛ+`H7X _4z+H9؀ +H: H 4zR4 pK?Y_}@+`H?X _E4z+H8؀ 4zR4K?Y@O?@ @K?@ @+4?@h? '0 "k?ok? k?k?k?!+h +n4#+~4$+~4%+~ _e4X_ @H pH `H hk?74zpAd4?@+H<K>K?!K?K?K? @O? & ( %  & / ( ! ( $k?ok? k?+H6+`4# Ph:P+H= 2+#H9P47P 4+H7 @_@+h< +H8 (+|4:P+k?!4_49d+H9?04 $hX2HdX%+H? 4&b0+JHP+h7h+n` 4$CZ@&R+H9ȋ &+H9 h+_H: f4[4@k?)HyPC:Z@"4ZBe@ BH}P7hxPC B%?H}P_Uh`HHeH HwP6h}PB%@@_ @%HP7hzPC%_@HsH`?oHwPHPC z7huPCB  JHPC 27hyPCB ?HPHbP@_ ZB  BHzP7WhwPB B U?HzP@p@HaP@7 _m@$2H|PC@=m@K?)[4HvX  _m4P+H!Ȁ B+H# *"466P4ςK>+n4#"K?!6R 4z_4zˀK>+H! ?04hX+H"@_ 4hX+H7pZHdX+d`H? W " +H<Hh|X :_HdX+H%5heX+H<  *"bK?!_u6z0++"H8 K?!_56p++H= 4H3w04HP049HP+H8  4mHP7PY@4Wi7 3z@?@U++H:@9O+ 444P4  +#_7ˀK>K?)[ 4HuX  _]4+H<Ȁ B+H" *"466P44K>K?K? @O? &0 *R ' + ' 'Bk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Y+H"4#@ +`H$X +H%h z_ @K>K?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_@u74b_44?+n4% 4&+4'+`4(+4)+4*+~4+4 _4Hh ӎ _e@IY HIx xC5 i@ H4iA H_M@^%7h4 5IX "Hx7hx Hz؀ :I4h  "Hp6hp 5^5?_@MK>_4?_@+n_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?Ku1!Ks1) k?Ku1aKs1i k?k?ok? +7DH:7#_!+H? !+H<8a7?k?4k?7?q4_?!O@Ka?#H77P7Q 44 K?yc"Jk?a+k?i4H:k?7?a?_U4!O Ka?H747Q -4K?q+K?yh4+h?4K>K? @O?+h$+ςh#K?>K?q b4y4xQ m44d4x 44Q =4K?q4x@4Q 4K?y4yp4xQ 44 BK?a4Y 4X`Q 4 K?a+K?ih6+ςh8 b4yp4x`Q M4 K?q+K?yh5+ς%h7k?ok? +7CH:؇_!+H? !+H58a4k?7?k?7?q4 _?!ZO@Ka? BH74Y7Q44`AK?q"Zk?y+4H:k?7?y?_4 !O@Ka?H7 "49 7QU4K?q+h64K>K? @O?+ςh#K?>@ b4y 4xQ44d @4x 44Q4K?q4x p4Qe4%4+#h77 7`Q4 ςK>#B7D`7Y K?q4 Q4"K?y6 @4Q4 +ς]h##7 7`Qe4 +ςh#k?ok? +7CH:؇_!+H? !+H58a4k?7?k?7?q4 _E?!ZO @Ka? BH74Y 7QE44`AK?q"Zk?y+4H:k?7?y?_4 !O @Ka?H7 "49 7Q4K?q+h64K>K? @O?+ςh#K?>@ b4y 4xQ44d @4x 44Q4K?q4x p4Q4%4+#h77 p7`QM4 ςK>#B7D`7Y K?q4 Q4"K?y6 04Q4 +ς]h##7 p7`Q4 +ςh#k?o+7CH:؇_!+H? !+H38`ar7?k?4k?7?q4_}?!BO @Ka?H7 "49 7Q}44!k?y+4H:k?7?y?_4!:O e@Ka?"H76 7Q4K?q+h44K>@O?+ςh#K?>K?q b4y 4xQ944y Pk?4x 4Q 4K?qK?4x Q4-4#K?y77`Q4 +ςh##7@7`Qa4 +ςh#k?7#477`Q4K?Y4@7?+H5>H3>  k? ( -Ku1AKs1I k?+H5=H3= k? ( !+H59H39 k?+H5=H3=  k?+H5H3> k?Ku0Ks0 k? ( -Ku1Ks1  k? ' + 3@ Zk?ok< k<k<kM@H,>5@_Iz؁<4 H44y!Pm44Za4:4k??Iz7=I_ 4+_H:+H:+_ H9+_H:+_iH:K<+h:4 k=4Z17=Iz7=_7= Z_K=+~4( 7Q544y!05P4 +H?1K< 1IQ "_4zKa?@4: 7=4_y407K<44yP%4I\/H/A K<44y!P4_K=2YKqS45Y4S7=K<4Sa7=44yp4 P7>q44y7=P4 KqS445Z_a4 ȪP4K<44z_ -4  K<4yS94K<4S7>q5Y4S7=K<4S7=44yp4 PM7>q44y7=P%4 KqSA44K<4yP4 @4eK<44yP}4 44y04 PU4@] :6W4y]Q47=YӜ= Ka?4:@4yp_4Ka?H7K<4yP 4 Ka?ϟeh 4 h4hϟ-K;Ka?K<4:@_%4yKa?H7K<4y@P 4 Ka?ϟh _4zKa?H7K<4yP 4 ϟmK;_@5k?9f_ 4zFX _5J7K<4yPP 4 _]4z@(@ϟK;IЃ/Iz44y P 4 I_g?YIzk?a7?Yg?]_Q4 oWIzKa?Iz_ H$KK? 4Y7>44_I4 74g>4 bg>_4z#k>47>_4  :7? 4_7>_q4K>ы@ k>4_]7< b744y$ 4 P7< _7< 74?K+~4% 74Q444y#4 P14H  K +4'K^k>77?!QA4HЀ *R7?! HR444y$`7?!Pa4 H 7h K?7KˀK#BˀK?YϟK?Y $0 !R &0 *R ' B ' 'B & % ( !k?o k6k6k6k6A +H7+4`k64$h HP4 +H7K64%Pi4 +H64@4+H<@ _@+H7K64%0P4 +H7K64%`P4 _=@c;+4h?U4%70K644%4 P97Q4 87;"  7"? 74%44%4P4+s@5#Z7=Q49 44&4PY4+44&4P!4+H?!27644c Qe7;Q7;7C  Q-7=Qy7=7  Q7?QA7?7 _4Ka?h _4xK674'4 P7`C`cJ4K6YK6K6K6K6@O6U4&q"(7c?7?QA@]c? b`Z7? 9Z-:  ZEZ _ 944&4P4_]@Ah7Qi7?7? 4&Q4@4C; R7=Q7; 44&4P4@+ c=44&A4P4+H9 =c?C=> 7?R4 ̢c?17?R4 7?4&U7?44&4P4+K64'A4 P4w4'a_e4yϟK6YKa?H7K64'PQ4 ϟK6Y@X@K?@ @+H591H399 k?k?ok? k?+H:4#44_u7?@ZKa?4$4H!Hz44_7?H"6`C?##k?!79(P4 C? 2#C7Y(1K?!P4 _ @C?w2#K?!7(PQ4 +h C?W:"cK?!6y(P 4 +4h7C?B"K?!6(P4 +x4_`8K>K?K? @O? ' Bk?7+H8 +H9" 4K?Y@7?c?4c?4c?7?_U4` ϟK?Y"#6`7)14 P q4ςUK?Y_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?+H5;AH3;I k?k?o4k?_k? *K?4=87(K?YK?4=87K?Y4|@O?k?o4k?7:k?Zk?!K?k?)YE4K?_k?1 "K>4=87K?!4=87Z5K?)K?1 K?1Y4K>4|@O?k?o4k?7:k?Zk?!K?k?)Y%4K?_k?1 "K>4=87K?!4=87ZK?)K?1 K?1Y4K>4|@O?_ZE : Kw@?@_ZE : Kw@ @WEX7 z@?@ ?@0@K?@ @ $0 !Rk?7# 477P4+H9`Y4.+H7؎ _m@@J+H8@2+H9 @CT@_ U@K?Y@7?k?ok?k?+H9h4#x4+x48 v49 t4: r4= p ~4s@ ^4T@ >45@"46@44̀ 4` 840!jAwaȤ E 840E!AwaȤ % 840%!AˆwaȤ  840!6a4p@w`7@W` ?6@w` Ȥ~@^}@4# 77P4ς~u@^e@m4# 77P94ς~]@^M@U4 44P4ςZ~E@^5@=4 440Py44 z+x@: @ b@=!  @3!  @5! 2" 66P4P4^4K?YK?K?@O? ' + ' 'B ( ! 3@ Zk?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y b 7X44yP4 +H?44 !4% Gh؏d$H7h \_ @_m7704H`* "  _@BjH%+H. A4z"85BIh74y 4x4 PI7 >@@2>@D##$2$r~@+H- "rA4z!`54xh4yH4xO}4_=@ 7+H<h!+H5 A\4zH4 +H3 ^4&_@~H+n4*0+4++4,+4-+4.444?_4<@H 4 =H+H:@K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?_4z P+H1 A4z -5Ih Ӛ;I HII i H iIw i H iH4IhJ _4z +H0 A4z!@55_4z P+H/ A4z!5H B+H* *H `_U4z"P4 ?hHHHH hh4&h+H?D  (h A4z"`5 Ax4z"5 $ .Bk?7+H8 Z+n490# k?P7"+H9_}K?+h +4xK?Yh74@7? ' Bk?ok? k?+H47D%7#+H5%4 4؀ 4%@ 4`x@*4C@ 4v@ 4z"4$ rEJ4`wE:  Ԑ`1w4j+x 4% r %4D rE4`eE  ֐`1w4j+x 47 p $4 rD4`Cd  `1w4j +x48 v  $4 rD4`#d  Ő`1w4j+x 49 t 7@$r4 `0Jc?+H5`! @ 4`|@*4t` 4z@ 4C €C4`vC +}@`1w4j+}@494> 7  ҕC +C:43Hx 7B"Ӻ W  +H3c?c?c? c?+H4 4 +o4=Pk?! 4#@4؀4$4$4# P K?!K?!44 O4w+H: AK?!4_m7?e:@ 4`u@*4e` 4}@ 4y)4&D4`tD  ϟK>ϟK>ϟK>4az@4z@4w?Oˀ8K>4Z@4z@4w?OˀK>4[-@4c{@4w?OˀK>4[e@4{M@U4w?OˀHK>4c\ @4#{@4w?O+H6 +H<!+o43Pk?) 4"4؀4 :4 (4# +4=;Q @4#0@ 4`|@"4C@ 4w@ @4`v@ P+4#@4d@ 4?O 84j+43 @4#0PMK?)K?)44 O4w+H7 AK?)ˀK>+4:;QD @4#0@ 4`z@*4s` 4u@ :4#0@4`w@ P+4}`4t@ 4?O 84j+4!E ? ϟK>4C@4z@ 4?O`14j+x 4? r  @4`u@ P 4}`4x@ 4w?O`1w4j  4!2@4`s@ P 4#@4y@ 4?O`14j+x 4? p  @4`t@ P 4z`4w@ 4w?O`1w4j  `4!2@4`}@ P 4|`4x@ 4?O`14j+x 4? v  @4`s@ P 4y`4e@ 4w?O`1w4j  4!"@4`d@ P 4e`4@ 4?O`14j +x4? t  z@ 4`z@B4v`4w@ 4c?O`1c4j d 4K>K?K? @O?+H5:aH3:i k? ' Bk?ok= k=k=k=!k=)+6H77D7'!7+H8!€@ 4`@*4` 4@ 4d!`a4a!c=4c=4c=c=4f+7=H7 44u 4 +H?&4\"2"*+o 4%P@4#4`@*4` 4@ 4!A*4`A`+ˀ`K<ˀPK<ϟ@K<" 6#p6#4wOu44?Kc=`^4f7=5_}4x4f4`4@ 4?O14j+44 @4#0P4440"Z!+o 4%P@4$04`@*4` 4@ 4D @4`@ P+4`4@ 4?O14j+43 @4#0P4X4!*!(+o 4%P@4$p4`@*4` 4@ 4$ @4`D` P+4`4@ 4?O14j+4:_ @4#04PI5 4+o 4%P@4$4`$`*4` 4@ 4 @4`@ P+4`4@ 4?O14j+48 @4#04P!444 4O4+H< A44c 7=_4y|@ ϟK<ςK< ' + ' 'Bk?ok? k?k?k?!k?)k?1_@Br+H84 bP4#+n490+4%+k?A4&4! 4_@!x7H : +H9+H9 HA$Hp75%54 O7, څ(҅( ʅ$$ J" H +4 h7 H+4ph=H + Ph H+8h HyK?A75hu ! 4? `j2 @ZHxK?A7ht  _5@@Hw~44K>K?1K?)K?!K?K?K? @O?k?ok? k?k?k?!+x@8 +H$h 7#F!BD J_E@4K>K?!K?K?K? @O?+x@=!?@@4+4h:h+4% 4 ` h_ 4% ` H?@+`!0h$h+h +x@@@4+4h9h+4% 4 ` h_4%` ` H?@+` `h$h+h +x@4!04K>_@+x_@+xk?7C_#҇#j#"䁊 2 +x4ψ`:!ψ` !+H6  :+4h? +x`?!@4+x@!! @4+H? +H84 +H" : J+H64 *+H?Ȁ @,4 @4ψK?Y+H<  *+H? :+H<  "+h @4 +H7 :+H7( 4@D@ +H74 w +H! : R+H54 2+H"Ȁ 4@@4@@ψK?YCY+`9 x+x4ψ`=!+x4`3!@8!  ` ! @=! ` ! ψ`K?Y+x` !@9!  ` ! @:! @ ` ! ׈4K?Y@7?k?ok? k?k?k?!k?)k?1k?9k?Ak?Ik?Qk?Yk?ak?ik?qk?y#7@k?+x43+}@46"^6X@k?">69@k?"6@k?!5@k?!5@k?!5@k?!5@k?!~5|@!^5A@!>5#@!5@44j446f l6g n6h p6i r6j t6k v6 h6w j6x `6y b6z d6} f4 4 ``"`5 PT@` 58 40 `(`5 P T@` 58 40 `( `5 P@T@` 58 40 `(@`5 P T@` 58 40 `( `5 XT@` 5 K? 40 `(`5 X T@` 5 K? 40 `( `5 X@T@` 5 K? 40 `(@`5 X T@` 5 K? 40 `( `5 XT@` 5 K? 40 `(`5 X T@` 5 K? 40 `( `5 X@T@` 5 K? 40 `@` H T@` 5 K? 40  46>َ`6?O` T@ T@` P 8O4j  Q @`61` T@ T@` P 8O4j  Q @`61` T@ T@` P 8O4j  Q @`61` T@ T@` P 8O4j 6 Q @61X%5pb`!4bb 4bc +bb d4jbbD bb bb`! bbB bc 4@bb "^bc ">b`! "bb `!bb f!bc 4bc4b`! 6@bb@5@bbF5bc4bct4b`!4 `bc bc bcrbcj`bc bcbb 6B@bct6#@j`H3 >@4!@`4`@`"Z` Z` 4`j2@` 5K 8 \ 6` `4` j@K @` 5K 8 E 4 0K `4` Ɋ@ @` 5L 8 D 4 0  ` ` ` 4`j2@` 5K 8 A 4 0`+ `4` j@ @` 5K 8 C 4 0 `4` Ɋ@ @` 5L 8 B 4 0  5Jp}e64K>K?yK?qK?iK?aK?YK?QK?IK?AK?9K?1K?)K?!K?K?K? @O?k?o+x@?4# R@w b@xȋ @y @z@ K?Y@O?B,@``Hz?@xB HyR)Hzh`h`E``B@5``B@%``B4@``k?ok> k>k>k>!k>)k>1k>9k>Ak>Ik>Qk>Yk>ak>ik>qk>y+h 4xh4">h 62@h "h 6@h +xk>4: `k>4= bk>49 fk>48 dk>47 vk>! k>5#0k>"k>6@k>"^k>6Y@k>">k>6:@k? ^k>4T@k?#k>7@k?)!5@k?4% j4& h4' t4( r4) p4* n4+ l+}@"6@k? 4,+"6@k?14- >45@k?!"6@k?9"6@k?A"~6o@k?I44444`@pk> `a @obpB6_@40 `aobpBz6_@40 `apobjpBb6_@40 `aXobRpBJ6_@40 `a@ ob:pB2H6WHz@/JR@0h`@q@o`p@d. @ڀq@6_  @#~U@6_ #~m@6_ #~@6_ #~@6_  #~@+o`p@ m6_=_40K?IE ] =w40K?A] Z =40K?9u Y =40K?1 X =40K?) W d K?! _40+H? K>  x`@q@ HK>o`p@ 6Wd K> V40K>p@q@ HK>Ɉo`p@ 6Wd K? A40K>W@q@ H  o`p@ 6Xd K? ]40  x 7@q@ HK>шo`p@ 6_d K> V40K>p@q@ HK>وo`p@ 6_d K? B40K>@q@ H+o`p@ 6Wd K? \40+H8 '( _@q@ H o`p@ 6_d K> A40 "R⁊ ˆ"@5%q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N4 2@5%Јq@o`p@d b@q@ @ o`p@ 4?O84j @K>4N4 r@5&q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N=4 @5&0q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N}4 @q@ H o`p@ 6_d K> \40 *"j⁚ ʈ# @5&`q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N54 P4@5&q@o`p@d b@q@ @ o`p@ 4?O84j @K>4Nm4 4@5&q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N4 4@5&q@o`p@d b@q@ @ o`p@ 4?O84j @K>4N4 44>ـ@4w?Oq@ #@ o`p@ 7 8?4j  x @7q@ #@ o`p@ 7 8?4j  @7q@ #@ o`p@ 7 8?4j  X @7q@ #@ o`p@ 7 8?4j  8 74cq6Rp+H5@ +x` z` x+H6 +x` t+H3+x` !4#` !` ! ` ! ` !` h h ` ` `0` h`+h`4````h K=K>yK>qK>iK>aK>YK>QK>IK>AK>9K>1K>)K>!K>K>K> @O> $0 !Rk?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k> b +4xk?4$H74y' NE4 +H7K?4y'@N4 +H%,b+H"@,Z_ @H,J,b, 2K?44y'N44h+H7 4y(4x(0NE4+H& 4"+H7K?4$4y(PN4 +H7K?4&4y(N4 H @ H@ _e@HK?4y(N]4 HK?4y(N54 HaHa+x@5!h+x@6aJ4^4>j+x4̢`2Dl4^=4ljLrLj  dgJ4^4mbMjMb +x@< X+x@!$`:4^}4>i+x4`14+x@8 4$ B@ $`24^ 4ir4` 4@  B@ `24^4i*4` 4+H38 R@ ވ B@ ڎ`24^E4h4` 4@ ܈ B@ ؏`24^4h4` 4K?44y)N 4@ r@D`b4^m40h74`4K?4y)N e44@ r@`b4^40g74`4K?4y* N 44@ l B@ h$`24^]4gb4` p4@ n B@ jd`24^4g4` r4+H, R@| B@x`24^4.f4 `4+H/ R@ B@$`24^%4FfZ4 `4@| B@x`24^4Nf4 `4@~ B@z`24^u4Ne4 `4" 6 Xk? "6@k?"6@k?"~6h@k?!#7@k?)#^7J@k?1#>7+@k?94444 l4 n4 j4 4 r44`4 h4 p44K? 4? @@`@ 2DbDZ ?  L44]6Rp ^E4z*PfR4_@+H?&B@  B@ D`24^ 4^f4 `!4@ & @ de4^ 4^e4`!44z*p^E@e_4 ^ @+H7 H+K?h,4y*N]4 +H7K?4y*N-4 4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ˀmK>Yˀ]K>Y+4ˀ5h44h+h84K?4y'`N 4ˀK>YˀK>YϟK>YϟK>YϟK>YϟK>YϟK>YϟuK>YK?4y)PNm4 ϟEK>YK?4y)N=4 ϟK>YϟK>YϟK>YϟK>YϟK>YϟK>YϟK>Y4`@ 6_ K?9 \40 ? ʀ@@ `@ 6_340K?e T ϟK>Y`@ 6_ K? E40  ,4@@ H _`@ 6_ K?1 V40 _:?4@@ `@ 6_240K?)m U ϟK>Y`@ 6_9w40K?!e ^E@ϟ-K>YˀK>Yϟ K>YϟK>Y:M@%4z*p^@ϟK>Y ( &k?7k?+7X# H77+Nq4+H74  "+H9 _]K?K?Y@7? ' Bk?o+H?7C"+H7"z`brBz p"z+x4`:!4c?q4c?s4^c?uh"c?{+@8 zc?w+H?c?y4c?} c?+H5 +o4:P" k?O!6+ " K?64 Ny4w+H! _K?4_-7?q`ϟK>" 6++o4:P"b k?OY6y,"b K?6x4 N4w+H< _K?7?q_e4 bB4K>@O?ˀK>ˀK>ϟK>لb r +xu` !f J4c?q4c?s+x4`9! 4^Pc?ud=4c?q4c?s+x4`8! 4^c?u+H7c?w4c?yc?{ c?}+H"@>o7?qr=4p f+of bbBb "=+o# u7p#" ]78+p#B E7X+# -7+" 6+ϟK>k?ok= k=k=k=!k=)k=1k=9k=Ak=Ik=Qk=Yk=ak=ik=qk=y k=7I7444,@4N94K=+n04*` `+4++4444,4 4444=87xIwӐ \"6 4cIh N #B"4c?5J?*2 4/k>9*140k>9*140k>9+o4^I,z4N77,z4J7:7,z4BI1Z40aHk>!1:4/(k>9140k>9040k>9+ok>!4LI%zCb58eZ+~4! 9 Cdk>)*05*%&&$‡""%4.k>1Cb+~4, Cd4`k>!5k>). -ʇ⍪/4.k>14^/-4L9-4J5-4B)/b40Pk>!4\4 4-P4-4N4 (4-!?@4,444N4+H" 4_4 4-P4-4NY4+H( +H!4b4 7>!4?_4 >+!r+o4  > 4  4,p444N4+H, _44 4-P4-4N)4+4 4-P4-4N44-4-574N4y+H/ _4zˀK<+n0@4`4#0k>!4?" 6  4?44^< 4p k>!4B!:4@4.k>!4.!Pk>14.A8k>14.a k>14.k>1@k>)4 J*+2Cb5"+~4"@ Y k>)@k>)Cd"+~43z k>1@k>1*Cf"B 4 ?6Q 8, 5> 4. Hk>94. 0k>9> . *4p k>94. k>94. k>9> 4/ k>94/! k>9> *. j* 2$ B" " p+o4/1 Pk>94/Q 8k>94/q k>94. k>9> "* 2$ B" "+o4/k>94/qk>94/k>9* $ "x+o4/Xk>94/@k>9* $ "(+o4/k>94/k>94^0 R4\<"z4L:!J4J6 :4B?"b40!k>!4+ppk>!401k>!4j?+x4+ `` 0+~4,@+~4-+n04.d+o4/  95P 40AOA65z0Si65H_ 5p0pk>)4y?4PfPk>!+~7:?4? +n047b7>)T` 7Y?7Y?@079Z:5 45 :=_ $%5< ?X+o40Q8k>!401 k>!4+k>!40k>!Cb+~43@Cdw Cf+~46 k>)4`k>!4?k>1! 5 ? 4 4.0k>94.k>9 4.k>94.k>9 4/k>94/!k>9 " 2 B "+o4/1`k>94/QHk>94/q0k>9 " 2 B "+o4/k>94/qk>94/k>9  "+o4/k>94/hk>9  "P+o4/0k>94/k>94.!k>14.Ak>14.ak>14.k>14+k>!4pk>!4ppk>!4^. 4L8 "H+o40(k>!4k>! 0L4 0Lk>!+o 0L4 0Lk>!+o 0L4Б 0Lk>!+o4 ^- 4L7 "X+o4+8k>!4 k>! 0^4+ 0^k>!+o4*P @404`7@*4:` 43@ 45 z @ 4`?@B48`4=@ 5)?O 1)4 j+4/ @4#0K>)K>1B@+K>9K>!@Lk? 041qK>Ak?`041qA-K>Ik?041qAnK>Qk?q041qAK>Yk?a041qAK>ak?Q041qAK>ik?A041qAK>qk?1 041qK>yk?!@041qK>B:B]k?Bk?i041qk?@041qk>041qK>K>CCk>4i?K>k>ْ`041qCTk?I4 k>ђ041qk?k?yk?Yk?9k?)k?k? k>k>k>5Zk>041qk>N5k> a+n04+`+x4-4@41441 h @@@5041 5N6Z͂@5Z41 4N]6Z4 5ZSy6Y5(_G h  41SA5Z "4S!5ZP4 "41S5Z 441S5Z445YM4+H. _5ZK=4K k>k>k>!k>)k>1C47$-7+H=.+H? -44=87 *44=87?4mӆ 4؀٠ 4-+H5 B#C 7Y2a7X24M4+4h4+H6؀ :+H"h4ƈU NIzN9-b4Mb44=87o"+H4Ӄ "+H3h`0Nz+H? +H) 020*+o" 4)P634؀ؠ4.4.Z B x4X# *+n04?`C4e)V+n048b47I~)4]M4yr@ 4`vR4zr4eRr4c?O`14j 4 h =De4]4ys4`sS4ws4#s4c?O`14j 4 v  4]4yxʀX4`#x א`14j+x 49 h )4$&4]U4yeFEN4`#e>ㅄ ɐ`14j 4 p  4]4yfހF4`wF ǐ`14j  44^t'4>v)4.|*4$a!j)4`14j 4 j "4]4yj@ 4`gB64vb4xA 4c?O`14j 4 j a4]4yj>4`#if4si>4 iI. <4c?O_4+H?  +H')΀I4`#iv|`14j 4 t  4]4yiI4`vIvj4^-4Nw,>4Fz*>4>y*40x)4.|,,4   Sq45-$7c>+n04#b_4z+4%454Ne4x_4+H:P?ZN4yB7>O4y?"4440^Q44 " 4164wM4 ϟK=ˀK=ˀK=ˀK=+o4#P"c 6y2!4zN4" 64 4yMu4+H< _4zˀK=φK=+H$ +H#!+o! 4#P524؀Ԡ 4 B4 # 07# +4?;Q "b 6x#0N4z" 64 4yM 4+H"@ _14z4>q`4?" 6 s ZRJ# 73_4" @ˀK=ϟK=+4<;Q " 6#0@ 4`}@"4t` 4v@ @4`z@ P+4s`4u@ 4?O 84j+47 " 47#0N5:# 74 59M 4w+H5 _ 5:4ߚB*^4ߙ+zȀ*4@ 4`t@24f` 4z@4 #2g4@4`s@  4Q@4#q@4?OϟPK=4x`4v@ 4?O`14j+x 4? r 8@ 4`}@B4d`4x@ 4c?O`1c4j y 8 @4`C` P 4t`4 i@ 4?O`14j  4 n '€@4 `i@ } 4#PE@4cp-@54?Oϟ0K=4t`4h@ 4?O`14j   @4 `i@ P 4s`4C` 4?O`14j  @4`h@ P 4}`4#` 4?O`14j  4 ^4i @ 4N%Z40w%b5"@4@4`#` P 4s`4h@ 4?O`14j 4 l 4_4@4`|@ P 4}`4g@ 4?O`14j 4 p 3@4`h@ ] 4M%@4m @ 4?OϟK=ِ`1c4j x 0 4`u@ P 4y`4d@ 4?O`14j 4 l 24`t@ P 4x`4C` 4?O`14j 4 p 14`g@ - 4K@4Ck@ 4?OϟK=ِ`1c4j } P C@b4w@R`4?O`1c4j| τK=ِ`14j  ?@4`# 4aE@4-@54c?O4440]m44444N]544@4`x@ P 4|`4 i@ 4?O`14j 4 r /*@ 4`w@B4v`4h@ 4c?O`1c4j b  @ 4`@*4u` 4g@ 4#!J@4 `i@ P 4t`4f@ 4?O`14j+x  4& n  4%@4`}@ P 4`4|@ 4?O`14j 4 r &@4`h@ P 4s`4e@ 4?O`14j+x 4& r '4%@4`C` - 4F@4#f@4?OϟK=4 i`4x@ 4?O`14j 4 v  @4`g@ P 4z`4|@ 4w?O`1w4j  @@4`|@ P 4h`4w@ 4?O`14j   @4`v@ P 4g`4@ 4?O`14j  @4`u@ P 4C@4 i@ 4?O`14j 4 n  @4`C` P 4y`4v@ 4w?O`1w4j  4^u b$@4`z@4 4 ~  4`#44 4 z " 4`4` 4 #^@4~@4?O`14j 4 | F h }`b4C`R`4?O`1c4jg ςK=ِ`14j  @?@4` 4C_E@4a_-@54c?O@4`t@ P 4#@4h@ 4w?O`1w4j 4 v  @4`#` P 4x`4u@ 4x?O`1x4j  @4`s@ P 4|`4g@ 4w?O`1w4j   @4`}@ P 4v`4f@ 4w?O`1w4j  @R4`w@B〈 ׈?@4`|O4 4f`4s@ 4?O`14j 4 j  Rb"ڈ"ςK=ِ`1c4j+44 +o 4$P@43A4`z@*4u` 4C` 4 Z@4`g+4_-@4a_@4c?O#B 7X#0N4# 474M4+H! ^443_4_q4ϛ(K=ـ@ 4`d@24w` 4u@4<4A4`Ca!  @4+n0 4548bM4 P4ϟHK=ِ`1c4j y 4K=K>1K>)K>!K>K>K> @O>?44`Cn?4㎽ ӀW4`zW  4|z4 iZ4?O4Zi@4zQ@Y4?OϟK=4 i`4s@ 4?O`14j+x 4? p >W4@ 4`d@B4y`4|@ 4c?O`1c4j x  @4`C` P 4x`4v@ 4?O`14j 4 l /@4`@  4bx@4x@4?OϟK=4s`4|@ 4?O`14j   @4`@ P 4}`4v@ 4?O`14j  @4 `i@ 1 4CW@4w@4?O +43H7434M a4+H7434M 14+H7444M 4+H7444M 4+H7 4414M 4+H& +H? R+H74 +H' : +H9Ȉ  "+H:  ^ 4B*4 `iB゠ 4`fG +H:07UB`Xh50 " 444A6M A4+H9xV54.]@ +H) (R@@x4ϟuK=ِ`1c4j s % ]A@ +H()@@w4ϟK=ϟK=4wh4uH4?OϟK=4MI4 4#@Z4z@JX4?O4zlz4gLj x4?OϟK=ِ`14j 4 n ]64^4C4`hC +n0@?`5:6?4 +n0+n0@?`  \%@ +H!5B@@u4ϟK=+n04?`C4846  877  866 6 Y   87   45 4544M4w4644M4+H4Ȁ3+h#+h%+n0@?`44434\@ +H43K>+n04:b@6y?s4ϟK=+H#`3g4K>+n049\ "   @448`46QMa4 4+n0K>]e4:`K=N 7>+n04|`4y@ 4?O`14j 4 r `2/4@4`h@ 94 #X4 h4?O4u`4w@ 4?O`14j 4 n 4@1G44`C` P 4t`4@ 4?O`14j 4 r 044`g@ i4 X34 ch)4?O-``1c4j| όK=ـ@ 4`|@*4h` 4}@ 4h#B4`vB 7>4z^4OWK=ـ@ 4`wL4v` 4hLb4#,R+n0# K>49`Mi754`14j  >@@4`~O 4^@4}@4c?O`@4`v@ P 4 i`4s@ 4?O`14j 4 p -g4@ 4`u@B4h`4}@ 4c?O`1c4j b  4g`4z@ 4?O`14j+x 48 l  4$@4`t@ P 4g`4z@ 4?O`14j 4 p $@4`u@ P 4f`4y@ 4?O`14j+x 4% p *I4$@4`|@  4 X 4 h  4?O`14j   @4`u@ P 4y`4f@ 4?O`14j  @4`s@ P 4f`4y@ 4?O`14j 4 t  @4`t@ P 4x`4e@ 4w?O`1w4j  @@4`}@ P 4e`4x@ 4?O`14j 4 l  8@4`s@ 4 X4bXw4w?O4C@4w@ 4?O`14j  4 x = @4`}@ P 4 i`4#` 4w?O`1w4j   @4`z@ P 4h`4|@ 4w?O`1w4j  @4`y@ P 4#@4@ 4?O`14j  4 t8g@4`y@ P 4g`4v@ 4w?O`1w4j   `1c4j+43(c `14j 4 h $'4+o 4$P@44q4`f@*4w` 4}@ 4v Z@4`b_+4^@4C~@4c?O# 7#0M 4!" 4584Le4+H< ^y443^u4^4ϛK=ـ@4`@ P 4u`4g@ 4?O`14j+x 48 l4$  (S@4`x@ P 4f`4u@ 4?O`14j  4 n @(+n0#C K>49`M7Z5A 4\ %@ +H" *@@`4ϟK=4`4u`+h#+h%+4& 464M4+4%4614xM4^M4^=44K>O6?7?hK>+n049b^-4?K>H5? %4K>H7? K>6?h` ' Bk?ok>k>k>k>k>k>k>k>k>k>k>k>k>k>k>+H17C7$"(4+H2B'444@c?A+}@4'+}@4(+b4)+x04*+}p4++s4,4 7?A!  e """*j"j x64_ e O4#7 4? 4? 4N 4444@c?A+}@4(+}@4)+b4*+x04++}p4,+s4-47?A" 4 f !!"2! 874_ f  4?4 4? 5 +H4 +H=$@+H8(+o 4$P2047X401䀚   z C?A%jA@$jAw $AY $A=$A $@ $4c?A e ' 4䀚   z C?A+rA'A (ZA| (AA )jA" @)A @*z4c?A f /u4 # 747Q444L %4+H( ^ 94 `4 u4  j4 N k4  l + uH0 +H/ +H8(+o4&P47M4444L4+H3` ^ 144 _4zeˀ `M)44?4`r+x4'4 440Ҙ48!M5Z5YQ4"_ 441Q4!" 4584L4+H? ^44_]4ymOm4ςK>YˀK>YˀK>YM157 uAw M 5z 7 ]AY M5Z 7 EA=M5:7-A M5 7@ Mi4 7456N q5 2A "M57 456N 5 2A  "M5z 7 M456N 5 2AX  "Ma5Z 7 456N i5 2A: "M 5:7456N 5 2A  "M5 7E456N 594@ 94MI4 74044 46# 474L4y+H" ^4z4K>YK>K>K>K>K>K>K>K>K>K>K>K>K>K>K>@O>ϟmK>Y 4` E N q664 % 14 5 N 16YM6Z7 A  4E N 664 4 5 q% N 6YM6Z7 A|  4% N A664  4 5r  N 6YMQ6Z7 AA 4 N664 45R Ni6YM6Z7A"  4 N664% 452 Q N6YM!6Z7}A  4@ Ny664 45  E N96YM6Z74665N6Y A  4 @6YN 4 4 E  5Ni6YM 6Z7 %4665N6Y A   4 6YN 4 E 4 5  N6YM 6Z7 U4665N6Y Aw   46YN 4 4 5r E N6YM 6Z7 4665N6Y AX  46YN9 e 44  % 5RN6YM I6Z74665NI6Y A9   46YNi 4 452 1 e N)6YM y6Z74665Ny6Y04A @04 46YN E 4 e 45   NI6YM 6Z7404 }4 c 4c6" 464L14y+H! ]M4zˀUK>Y1/40 " 47@O4ϟ K>Y+H59H39 k? ' Bk?ok? k?k?k?!+H:4B +H= +x@3` +H84 4481L4 +H?C 74 45ˀK>׀4K>K?!K?K?K? @O?" 4648QL445Q@7 M44\@ " 6#0+n04`'`4`?b40`7d4%` f4@Ӻ +n04'h4 2W9@  _@ 4 " 7@?@+H54` +H< +H8+o  4&P4h4$pM a4444L4+H6 ]4 4 %4 # 4X79_4z` ς K>ϟK> ' Bk?ok= +H6c="+H<"+x@! "+H$ Z+}@@4 84$ +~p" 7=48 68M4+H8 # 4498L4 +n04`:`4`=b4F`3d4?` f4@ :+n048h4"4c"7?"+H57` +H6 +H8+o4:Pk=d "b 7hMA6y$p# K=47L4+H9 ]K=d 44x  47_4`JςK<׀4K6}  U49^7= kX kW 7 7:   C 7Z C7Z:   C 7Z C  77Z:   C 7Z C  _+7_7H9k? 4 u+H< +o4:P" k?M69# K?47L 4+H9 ] K?K?_4z`RˀK?Y׀4K?Y@O?ˀK?YˀK?YϟK?Y? crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)? crt0: errno: tsdBeta0721 May 19997.0.195C-KermitCopyright (C) 1985, 1999, Trustees of Columbia University in the City of NewYork. The C-Kermit software may not be, in whole or in part, licensed orsold for profit as a software product itself, nor may it be included in ordistributed with commercial products or otherwise distributed by commercialconcerns to their clients or customers without written permission of theKermit Project, Columbia University. This copyright notice must not beremoved, altered, or obscured. For further information, contact the Kermit Project, Columbia University,612 West 115th Street, New York NY 10025-7799, USA; phone +1 (212) 854 3703,fax +1 (212) 663 8202 or +1 (212) 662 6442, email kermit@columbia.edu,Web http://www.columbia.edu/kermit/ or http://www.kermit-project.org/. Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. KermitXMODEMXMODEM-CRCYMODEMYMODEM-gZMODEMOtherU1nonexon/xoffrts/ctsdtr/cdetx/ackstringxxx1xxx2dtr/ctskeepautoremotedirect-serialmodemtcp/ipx.25decnetlatnetbiosnamed-pipesshpipe0anonymousA1Apple IIA3MacintoshD7VMSDARSTS/EDBRT11F3AOS/VSI1VM/CMSI2MVS/TSOI4MUSICI7CICSI9MVS/ROSCOEK2Atari STL3AmigaMVStratus VOSN3Apollo AegisUNIXU8MS-DOSUDOS-9UNWindows-32UOOS/2isabsoluteisabsolute rcinitflowinitproto spsizinitproto spsizr*.txt*.c*.h*.r*.w*.cpp*.ksc*.bwr*.upd*.html*.htm*.mss*.tex*.nr*akefile*.hex*.hqx*.for*.f77*.f*.F*.s*.pas*.java*.el*.lisp*.sh*.perl*.awk*.sno*.spt*.sed*.TXT*read.me*READ.ME.**/.**.gz*.Z*.tgz*.gif*.tar*.zip*.o*.so*.a*.out*.exe*.jpg*.jpeg*.tif*.tiff*.pdf*.so.**.class*.rpm*.bmp*.bz2*.BMP*.dll*.doc*.vxd*.xl**.lzh*.lhz[wk]ermitdotakeiniinserversstelnet Internet Kermit Service ready at %s%s C-Kermit ready at %s%s %s MAIN clienthostlogin loopMAIN LOGIN tryMAIN LOGINTELOPT_SB(TELOPT_KERMIT).kermit.me_startAccess denied. Login Timeoutmain executing init filemain exits init fileInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commandsckcmai got interruptmain cmdfil\%0setprefix%s %s-., Kermit versiontelnetrloginiksdhowcalledmain cmdini() donemain: no memory for keymapmain: no memory for macrotabCan't initialize!ckcmai mynamerx %ssx %ssx -a %src %srbsb %ssb -a %srzsz %ssz -a %skermit -irkermit -rkermit -x{{./.readme}{README.TXT}{READ.ME}}Can't allocate i/o buffers!main ckhostCan't open device: /dev/ttyCan't allocate packet buffers!main about to call ttopen() inservercan't initialize i/oMAINmain SO_OOBINLINEmain argc after prescan()main about to cc_executemain 2 cfilefmain argcmain zstatemain setting interrupt trapzoutbuffer mallocgetiobs ok? C-Kermit library, 7.0.002, 10 May 1999makestr *p 1makestr smakestr *p 2ckmatch stringckmatch patternckmatch skipfileselectfileselect fdatefileselect safileselect sbfileselect snafileselect snbfileselect filesizefileselect minsiz skippingfileselect maxsiz skipping*.~[0-9]*~fileselect skipping backupfileselect xlist emptyfileselect xlistfileselect skippingfileselect selecting??xՀՈՐ՘ՠըհո?mܠ?PbMA.?tzG{?PbMUNIX Communications support, 7.0.208, 23 Apr 1999 HP-UX 10.30/dev/ttynoneLINESxttgwsiz LINESCOLUMNSxttgwsiz COLUMNSle_inbufchars waitingle_putcharbuffer is fullle_putsle_putstrttgwsiz TIOCGWINSZttgwsiz tt_rowsttgwsiz tt_colsttgwsiz TIOCGWINSZ 00sysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! sysinit jchdlr: SIG_IGNsysinit jchdlr: SIG_DFLsysinit jchdlr: othersysinit uname machinesysinit uname sysnamesysinit uname releasesysinit uname versionsysinit hpis800USERsysinit uidbufJOBACCTPRINTERDISPLAYUNIXLOCATIONsysinit startupdirttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 *NOT* definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen netttopen got open network fdPipe errorFork errorwfdopen failurettopen net xttopen got open fdttopen fdflagttopen timottopen alarmttopenmodemttopen ttyfdttopen alarm returnttopen errnottopen EACCESS/dev/null%s is not a terminal device ttopen not a tty ttname=CTTNAM cname ttyname ctermid redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %dttopen lockpid%s %sttopen ioctl TCGETA ttold.c_lflagttopen O_NDELAYttopen fcntl O_NDELAYttopen fcntl failure to unset O_NDELAYCan't unset O_NDELAYttopen xlocalttopen executing close/openttopen calling carrctlttopen carrctl okttopen ioctlttopen ttspeedttopen *lclttopen lock filettclos ttyfdttclos netconnttclos closing netttclos ttyfd after netclosttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donetthang HP-UX style, HPUXDEBUGtthang HP-UX: can't get modem lines, NO HANGUP!%#lxtthang HP-UX: modem lines = tthang HP-UX: DTR down = tthang HP-UX: can't lower DTR!tthang HP-UX: modem lines got = tthang HP-UX: DCD not downtthang HP-UX: DCD downtthang HP-UX: can't get DCD status !tthang HP-UX: can't set saved statetthang HP-UX: final modem lines = ttres tty modes restorettres errnottchkpid lock pidttchkpid my pidttchkpid kill errnottchkpid pid testremoving stale lockRemoving stale lock %s (pid %d terminated) ttchkpid unlinkttyttydculcuacuadculdttrpidttrpid zchkittrpid fdttrpid string readttrpid integer readttrpid short readttrpid pid/var/spool/locksTTLOCK deviceLCK..%sTTLOCK unit 1TTLOCK unit 2/dev/%s%sTTLOCK exist%s/LCK..%s%sTTLOCK checkingTTLOCK check for lock A%s/LCK..%sTTLOCK check for lock BTTLOCK in useTTLOCK returns%s/%scu%s/LCK..ttyd%s%s/LTMP.%05dTTLOCK flfnamTTLOCK lock2TTLOCK tmpnamTTLOCK creat failedUUCP not installed or Kermit misconfigured TTLOCK temp okTTLOCK pidTTLOCK sizeof pidTTLOCK write pid returnsTTLOCK linkTTLOCK LOCKF code...TTLOCK lockf errorDevice already locked by another process TTLOCK lock2 creatttunlckttunlck lockfile seizedWarning - Lockfile %s seized by pid %d ttunlck unlinkWarning - Can't remove lockfile: %s ttunlck lock2 unlinkWarning - Can't remove secondary lockfile: %s tthflow ATTSV RTS/CTS OFFtthflow ATTSV TCSETX OFFtthflow ATTSV DTRXOFF not definedtthflow ATTSV RTS/CTS ONtthflow TCGETXtthflow ATTSV ioctltthflow ATTSV DTR/CD ONttpkt parityttpkt xflowttpkt speedttpkt ttpmskttpkt netconnttpkt carrierttpkt 2 stopbitsttpkt 1 stopbitttpkt 8 bits + even parityttpkt 8 bits + odd parityttpkt 8 bits + invalid parityttsetflowttvt ttyfdttvt tvtflgttvt speedttvt flowttvt network connection, skipping...ttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttvt 8 bits + even parityttvt 8 bits + odd parityttvt 8 bits + invalid parityttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failsttsspd TCGETA ioctlttsspd TCSETAW ioctlcongspdttgspd ttyfdttgspd c_cflag CBAUD 1 ATTSVttgspd ioctl 2 ATTSV xttgspd ioctl 2 ATTSV errnottgspd ioctl 2 ATTSV speedttgspd codettgspd speedttpushback nttpushback my_countmygetbuf IMPROPERLY CALLED with my_countmyfillbuf readmygetbuf errnomygetbuf TCP errormygetbuf SERIAL errorSVORPOSIX myfillbuf calling read()SVORPOSIX myfillbufSVORPOSIX myfillbuf ttcarrSVORPOSIX myfillbuf errnottinl calling tn_doop()ttinl tn_doop() returnedtxu_start and !inserverme_start and serverttflux my_countttflui le_inbuf chttflui ttpipettflui netfluittflui ttyfdttflui ATTSVconbgt process group testSVR4ORPOSIX jc test...sysconf fails, jcshellsysconf(_SC_JOB_CONTROL)jcconbgt jcconbgt jcshellconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdSIGHUP detectedconint arming SIGHUPconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconnoiin_chk entryin_chk carrier lostin_chk close-on-disconnectin_chk FIONREAD return codein_chk FIONREAD countin_chk FIONREAD errnoin_chk my_countin_chk nin_chk resultttxin MYREADttxin myread returnsttxin xttol nttol sttol dblflagttol tryttol okttol write errorttol TCP errorttol partialttoc timeoutttoc flowttoc errorttinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl unsavingttinl myread failure, nttinl myread errnottinl EINTR myread ittinl untimed network myread fails^%c... Canceled... ttinl skippingttinl lengthttinl extended lengthttinl bad seqttinl EOP lengthttinl ittinl csavedttinl removedttinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttincttpushttinc le_getcharchttinc myreadttinc restoring oldalarmttsndb ttyfdsndbrk ATTSVCan't send BREAKttwait select errnottwait OKttwait select xmsleep SELECT 1msleep SELECT 2msleep SVR4 selectgtimer%fgftimerztime GFTIMER gettimeofdaycongm getting modesconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb cccbrk.c_flagconcb c_cc[VINTR]concb returnsconbinconres cgmfconres isatty okconres restoring ioctlconchk contypttinc LocalEchoInBufconinc(0) errnoconinc HORRIBLE ERRORconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlttgmdmsuspendpsuspend errorpsuspend ok?Sorry, device is not open ttruncmd systemttruncmd waitttruncmd wait statuspttruncmd wait pexitstat%s%s %s :? ?zGd?dzGUNIX File support, 7.0.145, 8 May 1999 HP-UX 10.30rm -f cp mv pwd ls -l cat Maillpdf who /usr/adm/wtmpWTMP open failedWTMP write errorWTMP record OKcksyslog s1cksyslog s2cksyslog s3%s: %s %scksyslog errno/var/log/iksd.logdoiklog openxferlog open failure %s: %mdoiklog open errnoxferlog: %s open okzopeni namezopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinrzopeni fopenzopeni fullnamefile[%d] %s: open failed (%m)file[%d] %s: open read okzopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULLzopeno fp[n]=stdoutwazopeno appendzopeno fullnamezopeno fopen argzopeno failed errnofile[%d] %s: %s failed (%m)appendcreatezopeno zobufsizezopeno ZOFILE nonblockingzopeno ZOFILE unbufferedfile[%d] %s: %s okzopeno okzclosezclose zclosfzclose zclosf fp[n]zclose fclose failszclose error flushing last bufferzclose iklogopen*%.24s %d %s %ld %s %c %s %c %c %s %s %d %s _ikskermitzclose iksdmsgzclose returnszsinl zchin failzsinlzinfill kactiveZINFILL feofzinfill calling ttwaitzinfill ttwaitZINFILL freadZINFILL ferrorZINFILL errnoZINFILL count 0 EOF return -1ZINFILL count 0 not EOF return -2 %czoutdump zoutcntzoutdump wrotezoutdump write errorzoutdump write returnschkfn out of range/dev/nullzgetfs readlink(lookup failed)zgetfs S_ISLNK needrlinkzgetfs readlink errnozgetfs readlink resultzchki stat failszchki not regular filezchki stat ok:zchki access failed:zchki access ok:zchkozchko: Malloc error 46 zchko izchko itsadir.zchko access failed:zchko access ok:zdeletzdelet fullnamefile[] %s: delete failed (%m)file[] %s: delete oknzrtol name.%snzrtol fullnamenzrtol sizing MAXNAMLENnzrtol sizingNONAMEnzrtol new namezstrip beforezstrip after tilde-strippingzstrip afternzltor name.././nzltor fullnamenzltor name2zchdirzchdir 2zchdir 3HOMEzgtdir SVORPOSIX CWDBLzxcmdzxcmd outzxcmd pipe failure/usr/bin/shzxcmd pidSHELLzxcmd shpathgetpwuid()zxcmd...-czxcmd fork failurezxcmd fcntl 1 pipe flagszxcmd fcntl 2 resultzclosf filnumzclosf outzclosf pclosezclosf pexitstatzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzclosf wait statuspzclosf wait pexitstatzxpand entryzxpand xdironlyzxpand xfilonlyzxpand fn 1zxpand fn 2zxpand isdir 1zxpand fn 3zxpand okzxpand fcountnzxpandnzxpand xdironlynzxpand xfilonlynzxpand xmatchdotnzxpand xrecursivenzxpand xnobackupznextznewnznewn max 1znewn max 2znewn namepartznewn len.~*~znewn A matches.~%d~znewn A new nameznewn B deltaznewn B matchesznewn B new namezrename oldzrename new/zrename dirzrename no dirfile[] %s: rename to %s failed (%m)file[] %s: renamed to %s okzcopy src argzcopy dst argzcopy files identical: stat()source file not foundzcopy srczcopy dst 1zcopy files identical: strcmp()zcopy source is directoryzcopy dst 2zcopy open sourcezcopy open destzcopy final readzcopy errnofile[] %s: copy to %s failed (%m)file[] %s: copy to %s okzgperm----------%ozipermzsattr buf.st_mode & 0777zsattr lpermszsattr gpermsU1zdtstr timearglocaltime returns nullzdtstr tm_yearzstrdt YEAR-2000 ALERT 1: localtime yearzdatstr year%04d%02d%02d %02d:%02d:%02dzdatstrzfcdatzfcdat lstatzfcdat statzfcdat stat failedzfcdat buffer.st_mtimezstrdtBad creation date zstrdt date check 1zstrdt date check 2zstrdt date check 3zstrdt so far so goodzstrdt yearzstrdt fails - yearzstrdt 4 bad date zstrdt 6 bad date zstrdt 9 bad date zstrdt 12 bad date zstrdt 15 bad date zstrdt tmx 1zstrdt tmx 3zstimezstime datezstime: nothing to dozstime: zstrdt failszstime: tmzstime: A-pkt date ok zstime: Can't stat file:zstime lpermszstime gpermszstime system idzstime file perms beforezstime isguestzstime ckxpermszstime isguest sb.st_modezstime octal lpermzstime mask 1zstime mask 2zstime gprotectzstime S_IRUSRzstime S_IWUSRzstime S_IXUSRzstime mask xzstime mask x|maskzstime flagzstime S_IFMT x%04ozstime file perms afterzstime: sb.st_atimezstime setpermszstime DIRECTORY bit onzstime DIRECTORY bit offzstime chmodzstime 0: can't set modtime for filezstime 0: modtime set for filezstime 1: comparepacketmail %s < %szprint filezprint flagszprint printernamezprint printpipecat %s | %scat %s >> %s%s %s < %szprint commandecho%s %ssplitpath**splitpath mallocsplitpath malloc failuresplitpath xpatlastfgen patfgen current directoryfgen scratchfgen xpatslashfgen string spacefgen can't malloc string space fgen xpatfgen xpatlastfgen xpatabsolutefgentraverse add: end of path segmenttraverse entry sofartraverse entry xpattraverse entry xpatlasttraverse entry pl -> nparttraverse xpatslash absolutetraverse xpatslash relativetraverse xpatslash ckmatchtraverse add: recursive, match, && !isdirtraverse sofar 2traverse segisdirtraverse itswild traverse existstraverse not foundtraverse sofar 3traverse opening directorytraverse opendir()traverse opendir() failedtraverse skippingtraverse add: recursive && isdir && segisdir or matchtraverse mresult xpattraverse mresult pl -> nparttraverse mresult sofartraverse mresult xmatchdottraverse mresult nambuftraverse mresult itswildtraverse mresult segisdirtraverse add: match && !itsadiraddresult itsadiraddresult errnoLOGNAMEtilde_expand?Privilege cancellation failure sh-iisdir lstatisdir statisdir errnoisdir S_ISLNK islinkisdir islinkisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseekzfnqfp fnamezfnqfp xpzfnqfp realpath failszfnqfp realpath pathzfnqfp realpath name?Local resource failure: malloc sgetpwnamgetpwnam()userzvuser ckxsyslogzvuser CKSYSLOG definedftpanonymouszvuser anonymous ckxanonzvuser anon forbidden by ftpusers filezvuser anon sgetpwnam(ftp) OKzvuser anon sgetpwnam(ftp) FAILEDzvuser sgetpwnam ok/usr/bin/bashzvuser shellzvuser getusershellzvuser endusershell 1zvuser endusershell 2zvuser checkuserzvuser refused 1zvuser sgetpwnam NULLcheckuser name/etc/ftpuserscheckuser userfilecheckuser linecheckuser REFUSEDcheckuser OKWTMP logoutiksdckermitzsyslog syslog openedzvpassxxxxxx(null)xxzvpass deniediks_%04x(unknown host)WTMP loginzvpass anon chrootzvpass anon chroot FAILEDzvpass anon chdir FAILEDzvpass anon chroot/chdir OKzvpass non-guest chdir FAILEDzvpass non-guest chdir OKzvpass setuid FAILEDzvpass setuid OKlogin: anonymous %s %sUser %s logged in. login: %s %sUSER=%sLOGNAME=%sHOME=%s?0X_ lP TP  T    8!l0Pp!l!l!l!l!l!l!l0!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l00Pp!l!l!l!l!l!l!l0!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!lHp!l!l!l!l!l!l!l(@Xp!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l!l| !l!l!l! !l!l!l!l!l!l!l!l!l!X?C-Kermit functions, 7.0.170, 16 Apr 1999DisabledLocal onlyRemote onlyEnabledError receiving filerenamereplacebackupappenddiscardaskupdateSERIOUS ERROR: encstr data == NULLencstrencstr memptr 1encstr spsizencstr memptr 2encstr string too bigencstr getpkt rcputfilputfil zchout write error, setting czseenBDECODEbdecode write error - errnoDECODEdecode write error - errnomaxdata spsiz 1maxdata spsiz 2maxdata len 1maxdata len 2SERIOUS ERROR: bgetpkt data == NULLbgetpkt bufmaxbgetpkt timeout sizebgetpkt: input errorbgetpkt empty fileSERIOUS ERROR: getpkt data == NULLgetpkt first rtgetpkt zkanji: input errorgetpkt zkanji: empty string/filegetpkt: empty stringgetpkt: empty input functiongetpkt funcstrgetpkt zminchar 1getpkt timeout sizegetpkt: input errorgetpkt empty filegetpkt 1st chargetpkt fmaskgetpkt new rtgetpkt about to call translate functiontcharsetfcharset translate function returnsgetpkt eof crc16getpkt eof ffcgetpkt nleftgetpkt zminchar 2getpkt xlated rnext togetpkt EOPgetpkt leftovergetpkt osizegetpkt eof/eottinit tcharsettinit fcharsettinit timinttinit spsiztinit winlotinit getsbufpktinit winloTransaction beginsGlobal file mode:binarytextCollision action:resetc fsizefnlist: no memory for cmargbuffnlist nfilsfnlist cmargfnlist cmarg2stdinCalibrationsinit xpsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamsinit oksipkt pktnumsipkt ksipkt getsbufxsinit krcvfil rdatapCALIBRATENONAMEAccess deniedrcvfil rcvexceptrcvfil skippingException listrcvfil discard refused: exception listrcvfil cmarg2rcvfil srvcmd 2rcvfil access deniedWrite access deniedrcvfil srvcmd 1Receiving!%srcvfil pipesendrcvfil rcvfilter rcvfile pipesend filterrcvfil pipename?Sorry, receive filter + filename too long, %d max. Name too longrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil permsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2 refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil ofpermsrcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure. path created:rcvfilx: nrcvfilx: ofn1rcvfil fpfsecsreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof closf moving received file toreof MOVE zrenamereof RENAME zrename renaming received file toreof returnssfile xsfile send filter sfile cmarg2sfile binary 1sfile wearealikesfile xfermodesfile tcharsetsfile binary 2sfile sendmodesfile pktnamsfile fnspathsfile fncnvsfile calibratesfile pipesendsfile sndfiltersfile xpathsfile xfncnvFILE%02ldsfile filnam 1sfile pktnam 1sfile pipesend filtersfile pipename?Sorry, send filter + filename too long, %d max. sfile filnam 2sfile pktnam 2sfile error - Recover vs TextRecovery attempted in TEXT mode: %ssfile X packetsfile binarysfile qSending as mode: binary mode: text file character set xfer character settransparentSending from:SFILE fpfsecsSFILE fsecssdata entry, firstsdata drainsdata draining, winlosdata sbufnumsdata countdownsdata nxtpktsdata packetsdata cx/zseen, drainsdata spsizsdata binarysdata paritysdata eof, drainsdata pktnumsdata lensdata datasdata ttchkseof can't get s-buffersxeof nxtpkt failssxeof packetseot nxtpktrpar max 1rpar sprmlenrpar max 2rpar 8bq sqrpar 8bq ebqrparspar biggest 1spar rprmlenrpar biggest 2spar packetspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar setting parity to spacespar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar yspar lpcapuspar lp lenspar slow-start spsizspar lp spmaxspar windowspar window after adjustmentspar no windowsspar sending, redefine spmaxspar biggestspar whatruspar streamokspar clearrqspar urclearspar sysindex xspar sysindex yspar sysindex biggestspar whoareyouspar sysindexspar whatru2 xfermodeRemote system type: proto whoareuD7proto special VMS prefixinggnfile sndsrcgnfile filcntgnfile whatgnfile binary = gnf_binarygnfile pipesendCALIBRATIONTransaction cancelledgnfile czseengnfile filefile EOFgnfile filefile filnamgnfile nfils?Internal error expanding ADD list gnfile addlist filnamgnfile cmlist filnamgnfile ngetpathgnfile getpathgnfile absolute.gnfile wildgnfile nzxpandgnfile znextgnfile donegnfile setting sndsrc backgnfile skipping:not sentSkipped Client Command Status Description REMOTE LOGIN required GET %-14s%s Transfer file(s) from server to client. SEND %-14s%s Transfer file(s) from client to server. MAIL %-14s%s Send file(s) as e-mail. REMOTE ASSIGN %-14s%s Assign value to server variable or macro. REMOTE CD %-14s%s Change server's directory. REMOTE COPY %-14s%s Copy a file on the server. REMOTE DELETE %-14s%s Delete a file on the server. REMOTE DIRECTORY %-14s%s List files on the server. REMOTE EXIT %-14s%s Exit from Kermit server program. REMOTE HOST %-14s%s Execute a shell command on the server. REMOTE PRINT %-14s%s Send a file to the server for printing. REMOTE QUERY %-14s%s Get value of server variable or macro. REMOTE MKDIR %-14s%s Create a directory on the server. REMOTE RMDIR %-14s%s Remove a directory on the server. REMOTE RENAME %-14s%s Rename a file on the server. REMOTE SET %-14s%s Set a parameter on the server REMOTE SPACE %-14s%s Inquire about disk space on the server. REMOTE TYPE %-14s%s Display a server file on your screen. REMOTE WHO %-14s%s List who is logged in to the server. FINISH %-14s%s Return the server to its command prompt. BYE %-14s%s Log the server out and disconnect.REMOTE HELPC-Kermit %s,%s Internet Kermit Service (EXPERIMENTAL) typenxtdir funcnxtnxtdir funclennxtdir funcbufnxtdir return 1*.~[0-9]*~nxtdir ckmatchnxtdir zgetfsnxtdir zcfdat0000-00-00 00:00:00domydir permsnxtdir linkname%10s%-10s %s %s %-10s %s %s %10s%10ld %s %s%s%s -> %10ld %s %s%s%s %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiessnxtdir return 2snddirsnddir name./*snddir name 1snddir name 2Listing files: %s%s%s*/*snddir directorysnddir nzxpand nxpndDIRECTORY %sDIRECTORYsinit() %10s: %s%sskippingdeleted directory: %s%s%s%ld file%s deleted, %ld byte%s freed%sDeleting "%s"%sREMOTE DELETEDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremset xfer charset lookupREMOTE SET xfermodeadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new lenwhoarewe xfermodewhoarewe g_xfermodewhoarewe remote sysidL3N3whoarewe wearealikewhoarewe setting fncnvwhoarewe setting binary??PbM?UUUUU\???@@?0X_@@??0X_@@?<?tzG{A?tzG{A@RTT RECVRTT RECV ERROR spacketsRTT RECV ERROR sequenceRTT SENDRTT SEND ERRORRTT stddev1RTT stddev2RTT delay RTT rcvtimoinput sstateinput nakstateinput sndtypinput xitstainput whatinput CONNECTION BROKENinput winloinput rseqtbl[winlo]input return pre-stashed packetinput echo discardedinput type D=input typeUser cancelled.FAILED - InterruptedFAILED - Connection lostrpack receive window fullReceive window full.Transmission error on reliable link.input got E, nakstateZZZ crunched zZZZ xZZZ x not recd yetZZZ x not NAK'd yetZZZ NAKing winloToo many retries.input receive-state timeout, winloinput sending NAK for winloinput sent too many naksinput rsn=winloinput out of sequence, rsninput rseqtbl[rsn]input recv can't find index for rcvd pktSliding windows protocol error.input recv chkwinSequence error on reliable link.STREAMING input streamingSTREAMING input sndtypinput send returning pre-stashed ACKinput streaming typeinput sendecho discardedInterruptedConnection lostReceive window full wslots winlo pktnuminput send got E, nakstateToo many retriesinput send state timeout, winloinput send resending winloinput send too many resendsinput T cut packet lengthinput send rsninput send winloinput send chkwinbestlen ack xbestlen ack typebestlen Bbestlen retrybestlen lenbestlen spacketsbestlen Abestlen wslotsbestlen maxsendbestlen spsiz Abestlen spsiz Bbestlen spsiz Cbestlen spsiz Dinput send rotated send windowinput send mark pktinput send ACK for previousinput send ACK out of windowNAK received on reliable link.input send NAKinput N cut packet length in windowNAK for next packet, windowingNAK for next packet, no windowing NAK out of windowNAK out of windowinput send unexpected typeinput about to flushinput rsninput returning typeparchk nparchk startchktimo streamingchktimo timochktimo flagchktimo spmaxchktimo urpsizchktimo plenchktimo new timospack nspack dataspack dspack lenspack copyspack mydataspack sseqtbl[n]spack sending packet out of windowSTREAMING spack skippingspack spktlspack ttol returnsFAILED: Connection lostspack ttol msecspack calling screen, mydata=chk1chk2chk3nxtpkt pktnumnxtpkt winlo nxtpkt nnxtpkt chkwinnxtpkt getsbuf failureSTREAMING fastack kSTREAMING fastack can't getsbufSTREAMING fastack xacknsackns kackns can't getsbufackns winloackns nack1nack bad pkt numnacknack can't getsbufresend seqRetransmissionRESEND PKT NOT IN WINDOWRESEND kresend pktinfo index retry(resend)resend ttol msecresend ttol returnserrpktProtocol Error:errpkt drainingDraining incoming packets, wait...Drain complete.GET Packet Internal Error 1sopkt NULL listsopktsopkt encstrsopkt overflowGET Packet Too Long for Serversopkt leftoversopkt fieldGET Packet Internal Error 8@ sopkt o->opktitemsopkt datasopkt opktcntGET Packet Internal Error 9sopkt pktnumsopkt spackSend Packet Failuresopkt rcsrinit recursivesrinit regetsrinit retrievesrinit opktsrinit ooptssrinit omodesrinit cmargGET with no filenamesrinit null cmargGET Packet Internal Error 2srinit malloc fail O1Ox%dGET Packet Internal Error 3srinit malloc fail O2GET Packet Internal Error 4srinit malloc fail M1Mx%dGET Packet Internal Error 5GET Packet Internal Error 6srinit malloc fail F1GET Packet Internal Error 7srinit malloc fail F2kstartch == LFch = CRkstart SOPkstart EOLkstart EOP chkspktkstart ksbufp - ksbuf >= 94B00zstart Zmodem SOPZmodem downloadreceive /protocol:zmodemset proto kermit, server, set protocol gset proto kermit,server,set proto xmodemset proto kermit,server,set proto xmodem-crcset proto kermit,server, set protocol yset proto kermit,server,set proto zmodemserverreceive /protocol:kermitrpack pktnumrpack ksbufautodownload parityautodownload parchkrpack timintrpack rcvtimorpack streamingrpack timint 0 but rcvtimorpack ttinl lenrpack ttinl msecrpack: ttinl failsrpack ^C serverrpack ^C en_finBad packet headerrpack packet length less than 3Bad packet lengthrpack bad sequence numberBad sequence numberrpack echorpack bctlrpack chklenpacket too longrpack block check Bchecked charsblock check (1)should be (1)Checksum errorblock check (2)should be (2)block check (3)should be (3)CRC errorbad type B block check(crunched)rpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d- tstats xfsecststats filcnttstats fpxfsecststats fptsecsTransaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate fstats tfcfstats whatfstats epktmsg complete, size??UUUUU\???P0hpckmkdir 1 fc%s: no name givenmkdirrmdirckmkdir 2+UNIXOROSKckmkdir 3ckmkdir 4ckmkdir rcDirectory %s not implemented in this version of C-Kermitcreationremoval%s %s: %s%s: removedinibufs sinibufs rini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf packetgetsbuf pgetsbuf data == NULLgetrbuf new rbufnumfreesbuf sseqtbl[n]freerbuf no such slotfreerbuf packetfreerbuf rbufnumfreerpkt seqchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:sattr flagsattr zsattrsattr init max%ld%dsattr@sattr numsetsattr leftsattr sendingsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionoriginformatsys-dependent23456789:;<=>nameunknownrsattrrsattr refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgtattr: no memory for dsbufgattr file typegattr binary refused: typegattr attribute A = textgattr attribute B = binary refused: dategattr encodinggattr xfer charset lookupgattr: xfer charset unknown refused: character setgattr switch tcharsetgattr fcharsetgattr switch fcharsetgattr unk encoding attribute refused: encoding refused: bad disposition refused: mail disabled refused: print disabledgattr RESENDgattr: no memory for spbufgattr length refused: length bytes refused: length Kgattr fsizeN+gattr RESEND not binarygattr RESEND OKN?gattr returninitattr ofpermsAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopena xflgopena remfileopena remappdopena dispopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text file character-set: xfer character-set: opena charsetCan't open output fileFailure to openError:opena erroropenc zxcmdcanned: cxseen czseenopeni nameopeni sndsrcopeni file numberaccess deniedopeni CD disabledAccess deniedCommand or pipe failureopeni pipesend zxcmdopeni zopeni 1openi zopeni 2Can't open fileopeni failedopeni messageopeno stdouf zopenoopeno: name open cancelledopeno pipesendopeno zxcmdauthorization failureopeno CD disabledopeno failedopeno ok, nameopent zopenockopenx fsizeclsif i_isopenclsif zcloseclsif successclsif xferstatclsif fsizeclsif ffcclsif cxseenclsif czseenclsif discardInterruptedRefused: %sclsif fstatsIncompleteclsof dispclsof cxseenclsof successclsof o_isopenFailure to closeCan't close fileclsof incomplete discarded incomplete: discardedDiscardedclsof fstats 1closf incomplete kept incomplete: keptclsof fstats 2Ԍ , ԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌ<Ԍ<ԌԌԌlԌԌԌԌԌԌԌӜ\ӜԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌԌ(X׈׸ڜHx٨ڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜڜ@pxۀۈېۘ۠ۨ۰۸<<<<<<<<<<<<<<<<<<<<<<<<<<<<< (08x߀߰@Hx@HPX`hpxPX`hpx`X```X``````````````````````````````````X`XX`````````````````````````````XXH(HHHHHHHHHHHHHHHHHHHHHHHHHHH8HHHHHHHHHHHHHHHHHHHH \ P \ \ \ P \ P P P P \ P P P \ \ P P P P P T \ \ \ \ \ P \ PHPX`hpx                    Character Set Translation 7.0.030, 10 Nov 1998TRANSPARENTtransparentASCIIasciiISO 8859-1 Latin-1I6/100latin1-isoISO 8859-2 Latin-2I6/101latin2-isoISO 8859-5 Latin/CyrillicI6/144cyrillic-isoJapanese EUCI14/87/13japanese-eucISO 8859-8 Latin/HebrewI6/138hebrew-isoISO 8859-7 Latin/GreekI6/126greek-isoISO 8859-15 Latin-9I6/203latin9-isoelot928-greekllalatlatilatinUS ASCIIBritish/UK ISO-646britishDutch ISO-646dutchFinnish ISO-646finnishFrench ISO-646frenchCanadian-French NRCcanadian-frenchGerman ISO-646germanHungarian ISO-646hungarianItalian ISO-646italianNorwegian/Danish ISO-646norwegian/danishPortuguese ISO-646portugueseSpanish ISO-646spanishSwedish ISO-646swedishSwiss NRCswissDEC Multinationaldec-multinationalNeXT Multinationalnext-multinationalPC Code Page 437cp437PC Code Page 850cp850PC Code Page 852cp852Apple Macintosh Latinmacintosh-latinData General Internationaldg-internationalHewlett Packard Roman8hp-roman8CP866 Cyrilliccp866Short KOIshort-koiOld KOI-8 Cyrillickoi8-cyrillicJapanese JIS7jis7-kanjiJapanese Shift JISshift-jis-kanjiJapanese DEC Kanjidec-kanjiHebrew-7 DEChebrew-7CP862 Hebrewcp862-hebrewELOT 927 Greekelot927-greekCP869 Greekcp869-greekPC Code Page 858cp858PC Code Page 855cp855-cyrillicWindows Code Page 1251cp1251-cyrillicBulgarian PC Code Pagebulgaria-pcWindows Code Page 1250cp1250Polish Mazovia PC Code Pagemazovia-pcapple-quickdrawcp1252cp866-cyrillicdanishfr-canadianhehebhebrhebrehebrewnorwegianASCII (American English)DanishDutchFinnishFrenchGermanGreekHebrewHungarianIcelandicItalianJapaneseNorwegianPortugueseRussianSpanishSwedishSwissenglishgreekicelandicjapanesenonerussianukrainian|~<~l~Pl(l3D6(8\9p EF|HMHNP%LSTVlY]0^aXb`c`f|h8&Pl(oqt8H*(4xHp|{|0Wart Version 2.13 23 Nov 1998C-Kermit Protocol Module 7.0.121, 8 Feb 1999streamonstreamoffRESUMEserver=1server=0PROTO inputserver DELETE disabled - fncact set to BACKUPx justone 1x justone 2User cancelledLogin requiredSEND disabledreceive download dirreceive current dirreceive zchdir okreceive zchdir failedY winloSent G packetREGET sstateCPCPRO YCPCPRO Y xY winloCPCPRO Y not changing stateE winloserverGETDeleting files is disabledGET /DELETEGET /RECURSIVEGET /RECURSIVE /DELETEGET /RECOVERCKCPRO O sgetinit failCKCPRO O sgetinit doneEXTENDED GETCKCPRO O sgetinit TBCCKCPRO O sgetinit failCKCPRO O sgetinit doneCKCPRO O sgetinit TBCBadly formed server commandREMOTE HOST disabledHOST commands not availableREMOTE HOSTCan't do system commandXXX interruption success 1QUIT disabledXXX whatXXX interruption 2InterruptedDid you say RECEIVE instead of GET?Unimplemented server functionREMOTE LOGIN x_loginREMOTE LOGIN x_loggedAlready logged in.REMOTE LOGOUTLogged outREMOTE LOGIN lenREMOTE LOGINUsername too longREMOTE LOGIN 1REMOTE LOGIN 2REMOTE LOGIN 3REMOTE LOGIN 4Logged inLogged in as guest - restrictions applyLogin failedAccess denied.Logout ignoredLogin ignored.Logout ignored.REMOTE CDREMOTE CD disabledCan't change directoryREMOTE TYPE disabledREMOTE PWDREMOTE DIRECTORYREMOTE DIRECTORY disabledAccess deniedNo files matchCan't list directoryREMOTE DELETEREMOTE DELETE disabledIt's a directoryFile not foundDELETE failedFINISHFINISH disabledREMOTE EXITEXIT disabledBYEBYE disabledC-Kermit BYE - Loggin out...REMOTE HELPCan't send helpREMOTE RENAMEREMOTE RENAME disabledCan't rename fileREMOTE COPYREMOTE COPY disabledCan't copy fileREMOTE SETREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPECan't type fileREMOTE MKDIRREMOTE MKDIR disabledDirectory access restrictedDirectory creation failureREMOTE RMDIRREMOTE RMDIR disabledDirectory removal failureREMOTE SPACEREMOTE SPACE disabledCan't check spaceREMOTE WHOREMOTE WHO disabledCan't do who commandREMOTE QUERYREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedUnimplemented REMOTE commandCan't open fileError writing dataF winlo 1F winlo 2XXX ACK:F winloXXX ACK:F rsnCan't open windowX%s -s %c%s%c %s%s %sckcpro.w B tmpdir restoringZCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedCan't execute command remote name:Can't send attributesD deleting moving source tosend MOVE zrenamesend RENAME zrename renaming source tosseot justoneUnknown errorckcpro.w justone at E pktProtocol errorckcpro.w E tmpdir restoredUnexpected packet typeproto set binary modeTelnet Kermit Option negotiation failure IKS client/server failureproto reset binary mode failed:proto xferstatxxproto entry justone?No connection Sorry, you must 'set speed' firstfailed: proto ttopen localCan't open lineproto ttopen localCan't condition lineproto ttgmdmCarrier required but not detectedsrgcjhk ckcpro ttruncmd?Sorry, no external protocol defined for %s server backgrdserver quietSHOULD NOT SEE THIS IF IN BACKGROUND!KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.KERMIT READY TO SERVE... Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...proto calling wart, justoneC-Kermit server doneGET disabledsgetinit whatrusgetinit binary (1)sgetinit binary (2)sgetinit csgetinit lensgetinit psgetinit O valsgetinit M valsgetinit filenamesgetinit EOPUnknown GET Parametersgetinit unknown parametersgetinit unquoted filenamesgetinitsgetinit pipesendsgetinit O-Packet TBCsgetinit O-Packet done - havefsGET without filenamesgetinit winlo???UUUUU\ Command package 7.0.113, 21 May 1999Command? %s %s%s%s ?Memory allocation failure ?Name too long - %s prompt sxprompt sy %spushcmd: savbuf:fatal error: unable to allocate command buffers&cmpushcmpush: no memory for cmp&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zp 1cmnum zp 2cmnum 2nd chknum okcmnum xxesc 2 okcmnum exp eval okOutput filecmofi cmfld returnscmofi 1.5cmofi 2?Name too long cmofi 3?Wildcards not allowed - %s cmofi 4cmofi 5: is directory/dev/ttycmofi 6: failure?Write permission denied - %s cmofi 7: okcmifi2 path?Default name too long cmifi gtwordcmifi switch xCommand or field too long Expanded name too long cmifi tilde_expand?cmifi: malloc error cmifi svcmifi itsadir...cmifi y itsadircmifi *xp pre-zxpandcmifi y nzxpandcmifi y atmbufcmifi diractive catch-all zxpandcmifi sv wild?Wildcard matches more than one directory /cmifip add path?No %s match - %s directoriesfiles?Too many %s match - %s cmifi sv not wildcmifi nfiles?Not a directory - %s ?Read permission denied ?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s Default name too long %c cmifi nzxpandXXXcmifi filbufcmifi partialcmifi partial k%scmifi partial cmdbuf?Partial name too long cmifi partial atmbufcmifi unique?Directory name too long cmifi directory atmbuf?Completed name too long Directory name Input file specification %s?Expanded name too long cmifi ? *xp, cccmifi ? wildcmifi matchdot: %s %s%s, one of the following: cmfld xdef 1cmfld xdef 2?Default too long cmfld atmbuf 1cmfld: gtwordcmfld xcmfld 1cmfld 2cmfld zzstringValue too long cmfld 3cmfld returns Please complete this field %s%scmtxt, cmflgscmtxt: fresh startcmtxt:?Timed out cmtxt gtwordcmtxt xcmtxt calling (*f)cmtxt (*f) returnscmtxt: addbuf Text string?Unexpected return code from gtword() - %d ?Keyword table missing cmkey: pmsgcmkey: cmflgscmkey table lengthcmkey cmflgscmkey zzcmkey cccmkey gtword xccmkey atxbuf after *fEvaluated keyword too long ?Not a switch - %s ?Ambiguous - %s cmkey token:?No keywords match - %s cmkey Esc cccmkey: defaultcmkey Esc pmsgcmkey lookup ycmkey lookup zcmkey partial zcmkey partial ncmkey partial jcmkey partial kcmkey partial len?No keywords match - "%s" cmkey flgs%s:cmkey: addbuf?Evaluated keyword too long No keywords match One of the following: %s, one of the following: XXX kwdhlp nor the name of a macro ("do ?" for a list) or the token %c or one of the tokens: %s %d - Unexpected return code from gtword cmkey gtword zzaprilaugustdecemberfebruaryjanuaryjulyjunemarchmaynovemberoctoberseptemberdaysmonthsweekswksyearsyrs00cmcvtdatecmcvtdate nowcmcvtdate date too long+-TtYycmcvtdate NEWcmcvtdate offset ncmcvtdate unit startcmcvtdate time pointercmcvtdate unitcmcvtdate lookup failscmcvtdate offset units 00:00:00cmcvtdate dayscmcvtdate weeks%04d%02d%scmcvtdate months%04d%scmcvtdate yearstodaycmcvtdate todaytomorrowcmcvtdate tomorrowyesterdaycmcvtdate yesterdaycmcvtdate yyyymmddcmcvtdate yyyymmdd hh:mm:sscmcvtdate yyyymmdd ???cmcvtdate date bad timesepcmcvtdate null ztimecmcvtdate emtpy ztimecmcvtdate fail Acmcvtdate fail Bcmcvtdate fail C%02dcmcvtdate fail Dcmcvtdate fail Ecmcvtdate dotime scmcvtdate dotime pcmcvtdate fail K%s%s%02dcmcvtdate timesep:cmcvtdate fail Fcmcvtdate time icmcvtdate time fld[0]cmcvtdate time fld[1]cmcvtdate time fld[2]cmcvtdate fail Gcmcvtdate fail Hcmcvtdate fail Icmcvtdate fail Jcmcvtdate yearcmcvtdate monthcmcvtdate xcmcvtdate hhcmcvtdate mmcmcvtdate ss%s%s%02d %02d:%02d:%02dcmcvtdate hourcmcvtdate minutecmcvtdate secondcmcvtdate resultDate and/or timecmdate cmfld rccmdate 1cmdate 2?Evaluated date too long Invalid date or time - "%s" commandOops, command recall error cmcfm: cmflgscmcfm: atmbuf?Not confirmed - %s Type a carriage return to confirm the command cmfdb in->fcodecmfdb cmnumcmfdb cmoficmfdb cmifi2 xcmfdb cmifi2 ncmfdb cmfldcmfdb cmtxtcmfdb cmkeycmfdb cmcfmcmfdb - unexpected function code?cmfdb - unexpected function code: %d cmfdb xcmfdb cmflgscmfdb crflagcmfdb qmflagcmfdb esflagcmfdb out->nresultcmfdb cmdbuf & crflagcmfdb codecmfdb failure x?Not valid in this position: "%s" ungword cmflgsunungw atmbufgtword brkchargtword brkgtword ungetting from pp?Saved word too long gtword returning atmbufgtword cmdbufgtword bpgtword ppgtword timelimitgtword cgtword echofgtword IACcgtword skipping CRgtword CR to LFgtword LFgtword skiping LFgtword NUL to LFgtword NULgtwordgtword c < 0exitinggtword EOFgtword chargtword echof 2?Field too long error 1 gtword too long #1erasinggtword iscontdgtword too long #2?Field too long error 2 crflag is setgtword too long #3?Too long #3 gtword too long #4?Too long #4 %s %s%sgtword quote 0gtword quote 1gtword quote 3gtword quote?Command too long, maximum length: %d. cmdgetc()pushc chknum[OOOOP<PPPtPQQ,Q`QQQNR[SS@[[SST0QTpTRTU8U`NUUV[V0VVWPS,OR@VRSR0QVQ<TD[O8OLO$RR[QL[[VVQW$[TSTX[P`QVWL[[[ULQSTOp[P[[R VD[[TRxOSSO`UW8[[RTU$W`QWtSOTS|UPWPPWWT[[VXVlP[ShWXWV[XQp[[WXX(XPXdO[[XxX[X<R XY[[Y$[X[Y8[[YL[Y`YYx[Y[ZZ|ZhZZZZZ[[[X[[[[[[0[DZT[[lZ[[XYYYYZQP`Z@Z,Z,Z,[[[[[[P`d___`Pd`x`d``_`d_tdahddddb db dbHbb\bddabb`<^bcLc`aT_`(c$a@a`a_ c_bp_ ^_d_L_4dddc8`ddb4`d`dba,``dd^dctccddcdaddddddcdcdddddddxdddcdddbd(ddPd<dddddnef@f\fxffffgg g<gXgtngggghh h<hXhthhhehinnnnnnnnnnnnii8iTiTiiiinjj0jLjhjjjjjnnnkk,kdkHkkkklnnnnnnl4lpllmm0mTmxmmmnneenn,nXpo,o@oXoooooopppp p p4pHpp\pppppolopTrustees of Columbia University in the City of New York. Type INTRO for a brief introduction to C-Kermit. Type VERSION for version and copyright information. Type HELP followed by a command name for help about a specific command. Type MANUAL to access the C-Kermit manual page. Type NEWS for news about new features. Type SUPPORT to learn how to get technical support. Press ? (question mark) at the prompt, or anywhere within a command, for a menu (context-sensitive help, menu on demand). Type HELP OPTIONS for help with command-line options.DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support.More info at the Kermit Project website, http://www.columbia.edu/kermit/.See /usr/share/lib/kermit/*.* for additional information.Welcome to C-Kermit 7.0.195 Beta.This is a TEST version, not for production use.Major new features (not necessarily available on all platforms) include: . Configurability as an Internet Kermit Service Daemon. . Fast Kermit protocol settings are now the default (HELP FAST). . File-transfer selection and other option switches (HELP SEND, HELP GET). . File-transfer pipes and filters. . New streaming Kermit protocol for reliable connections. . More-flexible wildcards for filename matching (HELP WILDCARD). . Numerous modem and dialing improvements. . More/higher serial speeds on most platforms (SET SPEED ?). . New data-bits/parity/stop-bits options (HELP SET SERIAL). . File-permission preservation in UNIX and VMS. . Improvements in CD and other directory-related commands. . Greek character sets. . New Euro-compliant and other character sets. . Automatic character-set switching (HELP ASSOCIATE). . New script programming features, functions, and variables. . New selection of transaction-log formats (HELP SET TRANSACTION-LOG). . New MANUAL command to access online documentation (HELP MANUAL). . Performance improvements. . Bug fixes.These new features are documented in the ckermit2.txt file, to be used asa supplement to the manual, "Using C-Kermit", second edition (1997).If the release date shown by the VERSION command is long past, be sure tocheck with the Kermit Project to see if there have been updates.Welcome to HP-UX C-Kermit communications software for: . Error-free and efficient file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing . TCP/IP network connections While typing commands, you may use the following special characters: . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. . CTRL-W: Delete the most recent word typed. . CTRL-U: Delete the current line. . CTRL-R: Redisplay the current line. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-N: Command recall - go forward in command recall buffer. . ? (question mark) Display a menu for the current command field. . ESC (or TAB) Attempt to complete the current field. . \ (backslash) include the following character literally or introduce a backslash code, variable, or function. Command words other than filenames can be abbreviated in most contexts. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request general help HELP command request help about the given command TAKE execute commands from a file TYPE display a file on your screen Commands for file transfer: SEND send files RECEIVE receive files GET get files from a Kermit server RESEND recover an interrupted send REGET recover an interrupted get from a server SERVER be a Kermit server File-transfer speed selection: FAST use fast settings -- THIS IS THE DEFAULT CAUTIOUS use slower, more cautious settings ROBUST use extremely slow and cautious settings File-transfer performance fine tuning: SET RECEIVE PACKET-LENGTH Kermit packet size SET WINDOW number of sliding window slots SET PREFIXING amount of control-character prefixing Important settings: SET PARITY communications parity SET FLOW communications flow control, such as RTS/CTS SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET DIAL DIRECTORY specify dialing directory file (optional) SET DIAL COUNTRY-CODE country you are dialing from (*) SET DIAL AREA-CODE area-code you are dialing from (*) LOOKUP lookup entries in your dialing directory (*) SET MODEM TYPE select modem type DIAL dial the phone numberFurther info: HELP DIAL, HELP SET MODEM, HELP SET LINE, HELP SET DIAL(*) (For use with optional dialing directory) To make a network connection: SET NETWORK DIRECTORY Specify a network services directory (optional) LOOKUP Lookup entries in your network directory SET NETWORK TYPE Select network type (if more than one available) SET HOST Make a network connection but stay in command mode CONNECT Begin terminal connection TELNET Select a TCP/IP host and CONNECT to it RLOGIN Select a TCP/IP host and RLOGIN to it To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C.To display your escape character: SHOW ESCAPETo display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc.For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: The Kermit Project E-mail: kermit-orders@columbia.edu Columbia University Web: http://www.columbia.edu/kermit/ 612 West 115th Street Voice: +1 (212) 854-3703 New York NY 10025-7799 Fax: +1 (212) 663-8202 USASyntax: SCREEN { CLEAR, CLEOL, MOVE row column } Performs screen-formatting actions. Correct operation of these commands depends on proper terminal setup on both ends of the connection -- mainly that the host terminal type is set to agree with the kind of terminal or the emulation you are viewing C-Kermit through.SCREEN CLEAR Moves the cursor to home position and clears the entire screen. Synonyms: CLS, CLEAR SCREEN.SCREEN CLEOL Clears from the current cursor position to the end of the line.SCREEN MOVE row column Moves the cursor to the indicated row and column. The row and column numbers are 1-based so on a 24x80 screen, the home position is 1 1 and the lower right corner is 24 80. If a row or column number is given that too large for what Kermit or the operating system thinks is your screen size, the appropriate number is substituted.Also see: SHOW VARIABLE TERMINAL, SHOW VARIABLE COLS, SHOW VAR ROWS, SHOW COMMAND.Syntax: INPUT { number-of-seconds, time-of-day } [ text ]Example: INPUT 5 Login: or INPUT 23:59:59 RING Waits up to the given number of seconds, or until the given time of day for the given text to arrive on the connection. If no text is given, INPUT waits for any character. For use in script programs with IF FAILURE and IF SUCCESS. Also see MINPUT, REINPUT, SET INPUT. See HELP PAUSE for details on time-of-day format.Syntax: OUTPUT text Sends the text out the communications connection, as if you had typed it during CONNECT mode. The text may contain backslash codes, variables, etc, plus the following special codes: \N - Send a NUL (ASCII 0) character (you can't use \0 for this). \B - Send a BREAK signal. \L - Send a Long BREAK signal.Also see SET OUTPUT.SET PARITY NONE Chooses 8 data bits and no parity.SET PARITY { EVEN, ODD, MARK, SPACE } Chooses 7 data bits plus the indicated kind of parity. Forces 8th-bit prefixing during file transfer.SET PARITY HARDWARE { EVEN, ODD } Chooses 8 data bits plus the indicated kind of parity.Also see SET TERMINAL BYTESIZE, SET SERIAL, and SET STOP-BITS.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt or followed by ? to see other options.You may also enter the escape character as ^X (circumflex followed by aletter or one of: @, ^, _, [, \, or ], to indicate a control character;for example, SET ESC ^_ sets your escape character to Ctrl-Underscore.SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character, normally 0.SET OUTPUT SPECIAL-ESCAPES { ON, OFF } Whether to process the special OUTPUT-only escapes \B, \L, and \N. Normally ON (they are processed).Syntax: SET INPUT parameter valueSET INPUT AUTODOWNLOAD { ON, OFF } Controls whether autodownloads are allowed during INPUT command execution.SET INPUT BUFFER-LENGTH number-of-bytes Removes the old INPUT buffer and creates a new one with the given length.SET INPUT CANCELLATION { ON, OFF }Whether an INPUT in progress can be can interrupted from the keyboard.SET INPUT CASE { IGNORE, OBSERVE } Tells whether alphabetic case is to be significant in string comparisons. This setting is local to the current macro or command file, and is inherited by subordinate macros and take files.SET INPUT ECHO { ON, OFF } Tells whether to display arriving characters read by INPUT on the screen.SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUT command times out, 0 for no maximum.SET INPUT TIMEOUT-ACTION { PROCEED, QUIT } Tells whether to proceed or quit from a script program if an INPUT command fails. PROCEED (default) allows use of IF SUCCESS / IF FAILURE commands.SET FUNCTION DIAGNOSTICS { ON, OFF } Whether to issue diagnostic messages for illegal function calls and references to nonexistent built-in variables. ON by default.SET FUNCTION ERROR { ON, OFF } Whether an illegal function call or reference to a nonexistent built-in variable should cause a command to fail. OFF by default.Syntax: SET PROTOCOL { KERMIT, XMODEM, YMODEM, ZMODEM } [ s1 s2 s3 s4 s5 s6 ] Selects protocol to use for transferring files. s1 and s2 are commands to output prior to SENDing with this protocol, to automatically start the RECEIVE process on the other end in binary or text mode, respectively. If the protocol is KERMIT, s3 is the command to start a Kermit server on the remote computer, and there are no s4-s6 commands. Otherwise, s3 and s4 are commands used on this computer for sending files with this protocol in binary or text mode, respectively; s5 and s6 are the commands for receiving files with this protocol. Use "%s" in any of these strings to represent the filename(s). Use { braces } if any command contains spaces. Examples: set proto kermit {kermit -YQir} {kermit -YQTr} {kermit -YQx} set proto ymodem rb {rb -a} {sb %s} {sb -a %s} rb rbExternal protocols require REDIRECT and external file transfer programs thatuse redirectable standard input/output.Syntax: BYE Shut down and log out a remote Kermit serverSyntax: DIRECTORY [ switches ] [ filespec ] Lists files. The filespec may be a filename, possibly containing wildcard characters, or a directory name. If no filespec is given, all files in the current directory are listed. If a directory name is given, all the files in it are listed. Optional switches: /BRIEF List filenames only. /VERBOSE + Also list permissions, size, and date. /FILES Show files but not directories. /DIRECTORIES Show directories but not files. /ALL + Show both files and directories. /ARRAY:&a Store file list in specified array (e.g. \%a[]). /PAGE Pause after each screenful. /NOPAGE Don't pause after each screenful. /DOTFILES Include files whose names start with dot (period). /NODOTFILES + Don't include files whose names start with dot. /BACKUP + Include backup files (names end with .~n~). /NOBACKUP Don't include backup files. /HEADING Include heading and summary. /NOHEADING + Don't include heading or summary. /XFERMODE Show pattern-based transfer mode (T=Text, B=Binary). /MESSAGE:text Add brief message to each listing line. /NOMESSAGE + Don't add message to each listing line. /NOXFERMODE + Don't show pattern-based transfer mode /ISODATE + In verbose listings, show date in ISO 8061 format. /ENGLISHDATE In verbose listings, show date in "English" format. /RECURSIVE Descend through subdirectories. /NORECURSIVE + Don't descend through subdirectories. /SORT:key Sort by key, NAME, DATE, or SIZE; default key is NAME. /NOSORT + Don't sort. /ASCENDING + If sorting, sort in ascending order. /REVERSE If sorting, sort in reverse order.Factory defaults are marked with +. Default for paging depends on SETCOMMAND MORE-PROMPTING. Use SET OPTIONS DIRECTORY [ switches ] to changedefaults; use SHOW OPTIONS to display customized defaults.Syntax: DELETE [ switches... ] filespec Deletes a file or files on the computer where C-Kermit is running. The filespec may denote a single file or can include wildcard characters to match multiple files. RM is a synonym for DELETE. Switches include:/AFTER:date-time Specifies that only those files modified after the given date-time are to be deleted. HELP DATE for info about date-time formats./BEFORE:date-time Specifies that only those files modified before the given date-time are to be deleted./NOT-AFTER:date-time Specifies that only those files modified at or before the given date-time/NOT-BEFORE:date-time Specifies that only those files modified at or after the given date-time/LARGER-THAN:number Specifies that only those files longer than the given number of bytes are to be deleted./SMALLER-THAN:number Specifies that only those files smaller than the given number of bytes are to be sent./EXCEPT:pattern Specifies that any files whose names match the pattern, which can be a regular filename or may contain wildcards, are not to be deleted. To specify multiple patterns (up to 8), use outer braces around the group and inner braces around each pattern: /EXCEPT:{{pattern1}{pattern2}...}/DOTFILES Include (delete) files whose names begin with "."./NODOTFILES Skip (don't delete) files whose names begin with "."./LIST List each file and tell whether it was deleted. Synonyms: /LOG, /VERBOSE./NOLIST Don't list files while deleting. Synonyms: /NOLOG, /QUIET./HEADING Print heading and summary information./NOHEADING Don't print heading and summary information./PAGE If listing, pause after each screenful./NOPAGE Don't pause after each screenful./ASK Interactively ask permission to delete each file./NOASK Delete files without asking permission./SIMULATE Preview files selected for deletion without actually deleting them. Implies /LIST.Use SET OPTIONS DELETE to make selected switches effective for every DELETEcommand unless you override them; use SHOW OPTIONS to see selections currentlyin effect. Also see HELP PURGE, HELP WILDCARD.ASSOCIATE FILE-CHARACTER-SET Tells C-Kermit that whenever the given file-character set is selected, and SEND CHARACTER-SET (q.v.) is AUTOMATIC, the given transfer character-set is selected automatically.ASSOCIATE XFER-CHARACTER-SET Tells C-Kermit that whenever the given transfer-character set is selected, either by command or by an announcer attached to an incoming text file, and SEND CHARACTER-SET is AUTOMATIC, the specified file character-set is to be selected automatically. Synonym: ASSOCIATE TRANSFER-CHARACTER-SET.Use SHOW ASSOCIATIONS to list the current character-set associations, andSHOW CHARACTER-SETS to list the current settings.A "wildcard" is notation used in a filename to match multiple files.For example, in "send *.txt" the asterisk is a wildcard. Kermit commandsthat accept filenames also accepts wildcards, except commands that areallowed to operate on only one file, such as TRANSMIT or COPY.This version of Kermit accepts the following wildcards:* Matches any sequence of zero or more characters. For example, "ck*.c" matches all files whose names start with "ck" and end with ".c" including "ck.c".? Matches any single character. For example, "ck?.c" matches all files whose names are exactly 5 characters long and start with "ck" and end with ".c". When typing commands at the prompt, you must precede any question mark to be used for matching by a backslash (\) to override the normal function of question mark, which is providing menus and file lists.[abc] Square brackets enclosing a list of characters matches any character in the list. Example: ckuusr.[ch] matches ckuusr.c and ckuusr.h.[a-z] Square brackets enclosing a range of characters matches any character in the range; a hyphen (-) separates the low and high elements of the range. For example, [a-z] matches any character from a to z.[acdm-z] Lists and ranges may be combined. This example matches a, c, d, or any letter from m through z.{string1,string2,...} Braces enclose a list of strings to be matched. For example: ck{ufio,vcon,cmai}.c matches ckufio.c, ckvcon.c, or ckcmai.c. The strings may themselves contain *, ?, [abc], [a-z], or other lists of strings.To force a special pattern character to be taken literally, precede it witha backslash, e.g. [a\-z] matches a, hyphen, and z rather than a through z.The same wildcard syntax can be used for patterns in the IF MATCH command,in SWITCH case labels, the \fsearch(), \frsearch(), and \farraylook()functions, and in file patterns (see HELP IF, HELP SWITCH, HELP FUNC,HELP SET FILE).FAST, CAUTIOUS, and ROBUST are predefined macros that set severalfile-transfer parameters at once to achieve the desired file-transfer goal.FAST chooses a large packet size, a large window size, and a fair amount ofcontrol-character unprefixing at the risk of possible failure on someconnections. FAST is the default tuning in C-Kermit 7.0 and later. In caseFAST file transfers fail for you on a particular connection, try CAUTIOUS.If that fails too, try ROBUST. You can also change the definitions of eachmacro with the DEFINE command. To see the current definitions, type"show macro fast", "show macro cautious", or "show macro robust".Syntax: PURGE [ switches ] [ filespec ] Deletes backup files; that is, files whose names end in ".~n~", where n is a number. PURGE by itself deletes all backup files in the current directory. Switches: to be purged. HELP DATE for info about date-time formats. are to be purged. to be purged. regular filename or may contain wildcards, are not to be purged. To Include (purge) files whose names begin with ".". Skip (don't purge) files whose names begin with "."./KEEP:n Retain the 'n' most recent (highest-numbered) backup files for each file. By default, none are kept. If /KEEP is given without a number, 1 is used. Display each file as it is processed and say whether it is purged or kept. Synonyms: /LOG, /VERBOSE. The PURGE command should operate silently (default). Synonyms: /NOLOG, /QUIET. When /LIST is in effect, pause at the end of each screenful, even if COMMAND MORE-PROMPTING is OFF. Don't pause, even if COMMAND MORE-PROMPTING is ON. Interactively ask permission to delete each backup file. Purge backup files without asking permission. Inhibits the actual deletion of files; use to preview which files would actually be deleted. Implies /LIST.Use SET OPTIONS PURGE [ switches ] to change defaults; use SHOW OPTIONS todisplay customized defaults. Also see HELP DELETE, HELP WILDCARD.Syntax: CLOSE [ item ] Close the indicated item. The default item is CONNECTION, which is the current SET LINE or SET HOST connection. The other items are: CX-LOG (connection log, opened with LOG CX) SESSION-LOG (opened with LOG SESSION) TRANSACTION-LOG (opened with LOG TRANSACTIONS) PACKET-LOG (opened with LOG PACKETS) DEBUG-LOG (opened with LOG DEBUG) READ-FILE (opened with OPEN READ) WRITE-FILE (opened with OPEN WRITE or OPEN APPEND)Type HELP LOG and HELP OPEN for further info.Syntax: MINPUT n [ string1 [ string2 [ ... ] ] ]Example: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RING For use in script programs. Waits up to n seconds for any one of the strings to arrive on the communication device. If no strings are given, the command waits for any character at all to arrive. Strings are separated by spaces; use { braces } for grouping. If any of the strings is encountered within the timeout interval, the command succeeds and the \v(minput) variable is set to the number of the string that was matched: 1, 2, 3, etc. If none of the strings arrives, the command times out, fails, and \v(minput) is set to 0.Also see: INPUT, REINPUT, SET INPUT.Syntax: CONNECT (or C, or CQ) [ switches ] Connect to a remote computer via the serial communications device given in the most recent SET LINE command, or to the network host named in the most recent SET HOST command. Type the escape character followed by C to get back to the C-Kermit prompt, or followed by ? for a list of CONNECT-mode escape commands.Include the /QUIETLY switch to suppress the informational message thattells you how to escape back, etc. CQ is a synonym for CONNECT /QUIETLY.Other switches include:/TRIGGER:string One or more strings to look for that will cause automatic return to command mode. To specify one string, just put it right after the colon, e.g. "/TRIGGER:Goodbye". If the string contains any spaces, you must enclose it in braces, e.g. "/TRIGGER:{READY TO SEND...}". To specify more than one trigger, use the following format: /TRIGGER:{{string1}{string2}...{stringn}} Upon return from CONNECT mode, the variable \v(trigger) is set to the trigger string, if any, that was actually encountered. This value, like all other CONNECT switches applies only to the CONNECT command with which it is given, and overrides (temporarily) any global SET TERMINAL TRIGGER string that might be in effect.Syntax: MGET [ switches... ] remote-filespec [ remote-filespec ... ]Just like GET (q.v.) except allows a list of remote file specifications,separated by spaces.Syntax: GET [ switches... ] remote-filespec [ as-name ] Tells the other Kermit, which must be in (or support autoswitching into) server mode, to send the named file or files. If the remote-filespec or the as-name contain spaces, they must be enclosed in braces. Optional switches include:/AS-NAME:text Specifies "text" as the name to store the incoming file under. You can also specify the as-name as the second filename on the GET command line./BINARY Performs this transfer in binary mode without affecting the global transfer mode./COMMAND Receives the file into the standard input of a command, rather than saving it on disk. The /AS-NAME or the second "filename" on the GET command line is interpreted as the name of a command./DELETE Asks the other Kermit to delete the file (or each file in the group) after it has been transferred successfully. regular filename, or may contain "*" and/or "?" metacharacters, are to be refused. To specify multiple patterns (up to 8), use outer braces around the group, and inner braces around each pattern:/FILENAMES:{CONVERTED,LITERAL} Overrides the global SET FILE NAMES setting for this transfer only./FILTER:command Causes the incoming file to passed through the given command (standard input/output filter) before being written to disk./MOVE-TO:directory-name Specifies that each file that arrives should be moved to the specified directory after, and only if, it has been received successfully./PATHNAMES:{OFF,ABSOLUTE,RELATIVE,AUTO} Overrides the global SET RECEIVE PATHNAMES setting for this transfer./QUIET When sending in local mode, this suppresses the file-transfer display./RECOVER Used to recover from a previously interrupted transfer; GET /RECOVER is equivalent REGET. Works only in binary mode./RECURSIVE Tells the server to descend through the directory tree when locating the files to be sent./RENAME-TO:string Specifies that each file that arrives should be renamed as specified after, and only if, it has been received successfully. The string should normally contain variables like \v(filename) or \v(filenum)./TEXT Performs this transfer in text mode without affecting the globalAlso see HELP MGET, HELP SEND, HELP RECEIVE, HELP SERVER, HELP REMOTE.Syntax: LOG (or L) filename [ { NEW, APPEND } ]Record information in a log file:CX Connections made with SET LINE, SET PORT, SET HOST, DIAL, TELNET, etc. The default filename is CX.LOG in your home directory and APPEND is the default mode for opening.DEBUG Debugging information, to help track down bugs in the C-Kermit program. The default log name is debug.log in current directory.PACKETS Kermit packets, to help with protocol problems. The default filename is packet.log in current directory.SESSION Records your CONNECT session (default: session.log in current directory).TRANSACTIONS Names and statistics about files transferred (default: transact.log in current directory; see HELP SET TRANSACTION-LOG for transaction-log format options.)If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created (except APPEND isthe default for the connection log). Use CLOSE to stop logging.Note: The filename can also be a pipe, e.g.: log transactions |lpr log debug {| grep "^TELNET" > debug.log}Braces are required if the pipeline or filename contains spaces.Syntax: SCRIPT text A limited and cryptic "login assistant", carried over from old C-Kermit releases for comptability, but not recommended for use. Instead, please use the full script programming language described in chapters 17-19 of "Using C-Kermit". Login to a remote system using the text provided. The login script is intended to operate similarly to UNIX uucp "L.sys" entries. A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and 'send' is the names, numbers, etc, to return. The send may also be the keyword EOT to send Control-D, or BREAK (or \\b) to send a break signal. Letters in send may be prefixed by ~ to send special characters: ~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don't append a return, and ~o[o[o]] for octal of a character. As with some UUCP systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect, e.g. ~0 or two adjacent dashes, causes a short delay. If you expect that a sequence might not arrive, as with uucp, conditional sequences may be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.Syntax: TYPE [ switches... ] file Displays a file on the screen. Pauses automatically at end of each screenful if COMMAND MORE-PROMPTING is ON. Optional switches: /PAGE Pause at the end of each screenful even if COMMAND MORE-PROMPTING OFF. Synonym: /MORE /NOPAGE Don't pause at the end of each screen even if COMMAND MORE-PROMPTING ON. /HEAD:n Only type the first 'n' lines of the file. /TAIL:n Only type the last 'n' lines of the file. /MATCH:pattern Only type lines that match the given pattern. HELP WILDCARDS for info info about patterns. /HEAD and /TAIL apply after /MATCH. /PREFIX:string Print the given string at the beginning of each line. /WIDTH:number Truncate each line at the given column number before printing. /COUNT Count lines (and matches) and print the count(s) but not the lines.You can use SET OPTIONS TYPE to set the defaults for /PAGE or /NOPAGE and/WIDTH. Use SHOW OPTIONS to see current TYPE options.Syntax: CLEAR [ item-name ]Clears the named item. If no item is named, DEVICE-AND-INPUT is assumed. ALARM Clears any pending alarm (see SET ALARM). APC-STATUS Clears Application Program Command status. BINARY-PATTERNS Clears the file binary-patterns list. DEVICE Clears the current port or network input buffer. DEVICE-AND-INPUT Clears both the device and the INPUT buffer. DIAL-STATUS Clears the \v(dialstatus) variable. INPUT Clears the INPUT command buffer and the \v(input) variable. SEND-LIST Clears the current SEND list (see ADD). TEXT-PATTERNS Clears the file text-patterns list.Syntax: DATE [ date-time ] Prints the current date and time in standard format: yyyymmdd_hh:mm:ss. If a date-time is given, converts it to standard format. Various date-time formats are acceptable. The rules for the date-time are: . The date, if given, must precede the time. . The year must be four digits. . If the year comes first, the second field is the month. . The day, month, and year may be separated by spaces, /, -, or underscore. . The date and time may be separated by spaces or underscore. . The month may be numeric (1 = January) or spelled out or abbreviated in English. . The time may be in 24-hour format or 12-hour format. . If the hour is 12 or less, AM is assumed unless AM or PM is included. . If the date is omitted but a time is given, the current date is assumed. . If the time is given but date omitted, 00:00:00 is assumed. . If both the date and time are omitted, the current date and time are assumed. The following shortcuts can also be used: TODAY Today's date, optionally followed by a time; 00:00:00 if no time given. YESTERDAY Yesterday's date, optionally followed by a time (default 00:00:00). TOMORROW Tomorrows's date, optionally followed by a time (default 00:00:00). + A date in the future relative to the current date; may be DAYS WEEKS, MONTHS, or YEARS. Optionally followed by a time (default 00:00:00). Examples: +3days, +7weeks. - A date in the past relative to the current date, optionally followed by a time (default 00:00:00). Examples: -1year, -37months.All the formats shown above are acceptable as arguments to date-time switchessuch as /AFTER: or /BEFORE, and to functions such as \fcvtdate() that takedate-time strings as arguments.Syntax: SEND (or S) [ switches...] [ filespec [ as-name ] ] Sends the file or files specified by filespec. If the filespec is omitted the SEND-LIST is used (HELP ADD for more info). The filespec may contain wildcard characters. An 'as-name' may be given to specify the name(s) the files(s) are sent under; if the as-name is omitted, each file is sent under its own name. Also see HELP MSEND, HELP WILDCARD. Optional switches include:/AS-NAME: Specifies as the name to send the file under instead of its real name. This is equivalent to giving an as-name after the filespec./NOBACKUP Skip (don't send) Kermit or EMACS backup files (files with names that end with .~n~, where n is a number). Include (send) files whose names begin with ".". Don't send files whose names begin with ".". Sends the output from a command, rather than the contents of a file. The first "filename" on the SEND command line is interpreted as the name of a command; the second (if any) is the as-name./PATHNAMES:{OFF,ABSOLUTE,RELATIVE} Overrides the global SET SEND PATHNAMES setting for this transfer. Specifies a command (standard input/output filter) to pass the file through before sending it. Deletes the file (or each file in the group) after it has been sent successfully (applies only to real files). Used to recover from a previously interrupted transfer; SEND /RECOVER is equivalent RESEND (use in binary mode only). Tells C-Kermit to look not only in the given or current directory for files that match the filespec, but also in all its subdirectories, and all their subdirectories, etc./RENAME-TO:name Tells C-Kermit to rename each source file that is sent successfully to the given name (usually you should include \v(filename) in the new name, which is replaced by the original filename./MOVE-TO:directory Tells C-Kermit to move each source file that is sent successfully to the given directory./STARTING:number Starts sending the file from the given byte position. SEND /STARTING:n filename is equivalent to PSEND filename n./SUBJECT:text Specifies the subject of an email message, to be used with /MAIL. If the text contains spaces, it must be enclosed in braces./MAIL:address Sends the file as e-mail to the given address; use with /SUBJECT:./PRINT:options Sends the file to be printed, with optional options for the printer./PROTOCOL:name Uses the given protocol to send the file (Kermit, Zmodem, etc) for this transfer without changing global protocol. to be sent. HELP DATE for info about date-time formats. are to be sent. are not to be sent. To specify multiple patterns (up to 8), use outer/LISTFILE:filename Specifies the name of a file that contains the list of names of files that are to be sent. The filenames should be listed one name per line in this file (but a name can contain wildcards).Also see HELP RECEIVE, HELP GET, HELP SERVER, HELP REMOTE.Syntax: RECEIVE (or R) [ switches... ] [ as-name ] Wait for a file to arrive from the other Kermit, which must be given a SEND command. If the optional as-name is given, the incoming file or files are stored under that name, otherwise it will be stored under the name it arrives with. If the filespec denotes a directory, the incoming file or files will be placed in that directory.Optional switches include: You can also specify the as-name as a filename on the command line. Skips text-mode conversions unless the incoming file arrives with binary attribute it on disk. The /AS-NAME or the "filename" on the RECEIVE command line is interpreted as the name of a command. Use the given protocol to receive the incoming file(s). Equivalent to /PATHNAMES:RELATIVE. Forces text-mode conversions unless the incoming file has the binaryAlso see HELP SEND, HELP GET, HELP SERVER, HELP REMOTE.Syntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.Syntax: REGET filespec Ask a server to RESEND a file to C-Kermit.Syntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position.Syntax: MSEND [ switches... ] filespec [ filespec [ ... ] ] Sends the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. Alternative names cannot be given. Switches include /BINARY /DELETE /MAIL /PROTOCOL /QUIET /RECOVER /TEXT; see HELP SEND for descriptions.ADD SEND-LIST filespec [ [ ] ] Adds the specified file or files to the current SEND list. Use SHOW SEND-LIST and CLEAR SEND-LIST to display and clear the list; use SEND by itself to send the files from it.ADD BINARY-PATTERNS [ [ ... ] ] Adds the pattern(s), if any, to the SET FILE BINARY-PATTERNS list.ADD TEXT-PATTERNS [ [ ... ] ] Adds the pattern(s), if any, to the SET FILE TEXT-PATTERNS list. Use SHOW PATTERNS to see the lists. See HELP SET FILE for further info.REMOVE BINARY-PATTERNS [ [ ... ] ] Removes the pattern(s), if any, from the SET FILE BINARY-PATTERNS listREMOVE TEXT-PATTERNS [ [ ... ] ] Removes the given patterns from the SET FILE TEXT-PATTERNS list.Syntax: SERVER Enter server mode on the current connection. All further commands are taken in packet form from the other Kermit program. Use FINISH, BYE, or REMOTE EXIT to get C-Kermit out of server mode. The SET command establishes communication, file, scripting, or other parameters. The SHOW command can be used to display the values of SET parameters. Help is available for each individual parameter; type HELP SET ? to see what's available.Syntax: SET KEY k textOr: SET KEY CLEAR Configure the key whose "scan code" is k to send the given text when pressed during CONNECT mode. SET KEY CLEAR restores all the default key mappings. If there is no text, the default key binding is restored for the key k. SET KEY mappings take place before terminal character-set translation. To find out the scan code and mapping for a particular key, use the SHOW KEY command.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, or BLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3 specify more rigorous checking at the cost of higher overhead. The BLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain no blanks.Syntax: SET DEBUG { SESSION, ON, OFF, TIMESTAMP }SET DEBUG ON Opens a debug log file named debug.log in the current directory. Use LOG DEBUG if you want specify a different log file name or path.SET DEBUG OFF Stops debug logging and session debugging.SET DEBUG SESSION Displays control and 8-bit characters symbolically during CONNECT mode. Equivalent to SET TERMINAL DEBUG ON.SET DEBUG TIMESTAMP { ON, OFF } Enables/Disables timestamps on debug log entries.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31,127-159,255. The word "ALL" means all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL is recommended for safety. You can include multiple values in one command, separated by spaces.Syntax: SET MODEM ...Note: Many of the SET MODEM parameters are configured automatically whenyou SET MODEM TYPE, according to the modem's capabilities. SHOW MODEM tosee them. Also see HELP DIAL and HELP SET DIAL.SET MODEM TYPE Tells Kermit which kind of modem you have, so it can issue the appropriate modem-specific commands for configuration, dialing, and hanging up. For a list of the modem types known to Kermit, type "set modem type ?". Use SET MODEM TYPE NONE (the default) for direct serial connections. Use SET MODEM TYPE USER-DEFINED to use a type of modem that is not built in to Kermit, and then user SET MODEM CAPABILITIES, SET MODEM DIAL-COMMAND, and SET MODEM COMMAND to tell Kermit how to configure and control it. Give the SET MODEM TYPE command BEFORE the SET LINE command so Kermit can open the communications device in the correct mode for dialing.SET MODEM CAPABILITIES Use this command for changing Kermit's idea of your modem's capabilities, for example, if your modem is supposed to have built-in error correction but in fact does not. Also use this command to define the capabilities of a USER-DEFINED modem. Capabilities are: AT AT-commands DC data-compression EC error-correction HWFC hardware-flow ITU v25bis-commands SWFC software-flow KS kermit-spoof SB speed-buffering TB TelebitSET MODEM CARRIER-WATCH { AUTO, ON, OFF } Synonym for SET CARRIER-WATCH (q.v.)SET MODEM COMPRESSION { ON, OFF } Enables/disables the modem's data compression feature, if any.SET MODEM DIAL-COMMAND The text replaces Kermit's built-in modem dialing command. It must include '%s' (percent s) as a place-holder for the telephone numbers given in your DIAL commands.SET MODEM ERROR-CORRECTION { ON, OFF } Enables/disables the modem's error-correction feature, if any.SET MODEM ESCAPE-CHARACTER number Numeric ASCII value of modem's escape character, e.g. 43 for '+'. For Hayes-compatible modems, Kermit uses three copies, e.g. "+++".SET MODEM FLOW-CONTROL {AUTO, NONE, RTS/CTS, XON/XOFF} Selects the type of local flow control to be used by the modem.SET MODEM HANGUP-METHOD { MODEM-COMMAND, RS232-SIGNAL } How hangup operations should be done. MODEM-COMMAND means try to escape back to the modem's command processor and give a modem-specific hangup command. RS232-SIGNAL means turn off the DTR signal.SET MODEM KERMIT-SPOOF {ON, OFF} If the selected modem type supports the Kermit protocol directly, use this command to turn its Kermit protocol function on or off.SET MODEM MAXIMUM-SPEED Specify the maximum interface speed for the modem.SET MODEM NAME Descriptive name for a USER-DEFINED modem.SET MODEM SPEAKER {ON, OFF} Turns the modem's speaker on or off during dialing.SET MODEM SPEED-MATCHING {ON, OFF} ON means that C-Kermit changes its serial interface speed to agree with the speed reported by the modem's CONNECT message, if any. OFF means Kermit should not change its interface speed.SET MODEM VOLUME {LOW, MEDIUM, HIGH} Selects the desired modem speaker volume for when the speaker is ON.SET MODEM COMMAND commands are used to override built-in modem commands foreach modem type, or to fill in commands for the USER-DEFINED modem type.Omitting the optional [ text ] restores the built-in modem-specific command,if any:SET MODEM COMMAND AUTOANSWER {ON, OFF} [ text ] Modem commands to turn autoanswer on and off.SET MODEM COMMAND COMPRESSION {ON, OFF} [ text ] Modem commands to turn data compression on and off.SET MODEM COMMAND ERROR-CORRECTION {ON, OFF} [ text ] Modem commands to turn error correction on and off.SET MODEM COMMAND HANGUP [ text ] Command that tells the modem to hang up the connection.SET MODEM COMMAND IGNORE-DIALTONE [ text ] Command that tells the modem not to wait for dialtone before dialing.SET MODEM COMMAND INIT-STRING [ text ] The 'text' is a replacement for C-Kermit's built-in initialization command for the modem.SET MODEM COMMAND PREDIAL-INIT [ text ] A second INIT-STRING that is to be sent to the modem just prior to dialing.SET MODEM COMMAND HARDWARE-FLOW [ text ] Modem command to enable hardware flow control (RTS/CTS) in the modem.SET MODEM COMMAND SOFTWARE-FLOW [ text ] Modem command to enable local software flow control (Xon/Xoff) in modem.SET MODEM COMMAND SPEAKER { ON, OFF } [ text ] Modem command to turn the modem's speaker on or off.SET MODEM COMMAND NO-FLOW-CONTROL [ text ] Modem command to disable local flow control in the modem.SET MODEM COMMAND PULSE [ text ] Modem command to select pulse dialing.SET MODEM COMMAND TONE [ text ] Modem command to select tone dialing.SET MODEM COMMAND VOLUME { LOW, MEDIUM, HIGH } [ text ] Modem command to set the modem's speaker volume.The SET DIAL command establishes or changes all parameters related todialing the telephone. Also see HELP DIAL and HELP SET MODEM. Use SHOWDIAL to display all of the SET DIAL values.SET DIAL COUNTRY-CODE Tells Kermit the telephonic country-code of the country you are dialing from, so it can tell whether a portable-format phone number from your dialing directory will result in a national or an international call. Examples: 1 for USA, Canada, Puerto Rico, etc; 7 for Russia, 39 for Italy, 351 for Portugal, 47 for Norway, 44 for the UK, 972 for Israel, 81 for Japan, ... If you have not already set your DIAL INTL-PREFIX and LD-PREFIX, then this command sets default values for them: 011 and 1, respectively, for country code 1; 00 and 0, respectively, for all other country codes. If these are not your true international and long-distance dialing prefixes, then you should follow this command by DIAL INTL-PREFIX and LD-PREFIX to let Kermit know what they really are.SET DIAL AREA-CODE [ ] Tells Kermit the area or city code that you are dialing from, so it can tell whether a portable-format phone number from the dialing directory is local or long distance. Be careful not to include your long-distance dialing prefix as part of your area code; for example, the area code for central London is 171, not 0171.SET DIAL CONFIRMATION {ON, OFF} Kermit does various transformations on a telephone number retrieved from the dialing directory prior to dialing (use LOOKUP to see them). In case the result might be wrong, you can use SET DIAL CONFIRM ON to have Kermit ask you if it is OK to dial the number, and if not, to let you type in a replacement.SET DIAL CONNECT { AUTO, ON, OFF } Whether to CONNECT (enter terminal mode) automatically after successfully dialing. ON means to do this; OFF means not to. AUTO (the default) means do it if the DIAL command was given interactively, but don't do it if the DIAL command was issued from a macro or command file. If you specify ON or AUTO, you may follow this by one of the keywords VERBOSE or QUIET, to indicate whether the verbose 4-line 'Connecting...' message is to be displayed if DIAL succeeds and Kermit goes into CONNECT mode.SET DIAL CONVERT-DIRECTORY {ASK, ON, OFF} The format of Kermit's dialing directory changed in version 5A(192). This command tells Kermit what to do when it encounters an old-style directory: ASK you whether to convert it, or convert it automatically (ON), or leave it alone (OFF). Old-style directories can still be used without conversion, but the parity and speed fields are ignored.SET DIAL DIRECTORY [ filename [ filename [ filename [ ... ] ] ] ] The name(s) of your dialing directory file(s). If you do not supply any filenames, the dialing directory feature is disabled and all numbers are dialed literally as given in the DIAL command. If you supply more than one directory, all of them are searched.SET DIAL SORT {ON, OFF} When multiple entries are obtained from your dialing directory, they are sorted in "cheapest-first" order. If this does not produce the desired effect, SET DIAL SORT OFF to disable sorting, and the numbers will be dialed in the order in which they were found.SET DIAL DISPLAY {ON, OFF} Whether to display dialing progress on the screen; default is OFF.SET DIAL HANGUP {ON, OFF} Whether to hang up the phone prior to dialing; default is ON.SET DIAL IGNORE-DIALTONE {ON, OFF} Whether to ignore dialtone when dialing; default is OFF.SET DIAL METHOD {AUTO, DEFAULT, TONE, PULSE} Whether to use the modem's DEFAULT dialing method, or to force TONE or PULSE dialing. AUTO (the default) means to choose tone or pulse dialing based on the country code. (Also see SET DIAL TONE-COUNTRIES and SET DIAL PULSE-COUNTRIES.)SET DIAL PACING number How many milliseconds to pause between sending each character to the modem dialer. The default is -1, meaning to use the number from the built-in modem database. SET DIAL PULSE-COUNTRIES [ cc [ cc [ ... ] ] ] Sets the list of countries in which pulse dialing is required. Each cc is a country code.SET DIAL TONE-COUNTRIES [ cc [ cc [ ... ] ] ] Sets the list of countries in which tone dialing is available. Each ccSET DIAL TIMEOUT number How many seconds to wait for a dialed call to complete. Use this command to override the DIAL command's automatic timeout calculation. A value of 0 turns off this feature and returns to Kermit's automatic dial timeout calculation.SET DIAL RESTRICT { INTERNATIONAL, LOCAL, LONG-DISTANCE, NONE } Prevents placing calls of the type indicated, or greater. For example SET DIAL RESTRICT LONG prevents placing of long-distance and international calls. If this command is not given, there are no restrictions. Useful when dialing a list of numbers fetched from a dialing directory.SET DIAL RETRIES How many times to redial each number if the dialing result is busy or no no answer, until the call is succesfully answered. The default is 0 because automatic redialing is illegal in some countries.SET DIAL INTERVAL How many seconds to pause between automatic redial attempts; default 10.The following commands apply to all phone numbers, whether given literallyor found in the dialing directory:SET DIAL PREFIX [ text ] Establish a prefix to be applied to all phone numbers that are dialed, for example to disable call waiting.SET DIAL SUFFIX [ text ] Establish a suffix to be added after all phone numbers that are dialed.The following commands apply only to portable-format numbers obtained fromthe dialing directory; i.e. numbers that start with a "+" sign andcountry code, followed by area code in parentheses, followed by the phonenumber.SET DIAL LC-AREA-CODES [ ] Species a list of area codes to which dialing is local, i.e. does not require the LD-PREFIX. Up to 32 area codes may be listed, separated by spaces. Any area codes in this list will be included in the final dial string so do not include your own area code if it should not be dialed.SET DIAL LC-PREFIX [ ] Specifies a prefix to be applied to local calls made from portable dialing directory entries. Normally no prefix is used for local calls.SET DIAL LC-SUFFIX [ ] Specifies a suffix to be applied to local calls made from portable dialing directory entries. Normally no suffix is used for local calls.SET DIAL LD-PREFIX [ ] Your long-distance dialing prefix, to be used with portable dialing directory entries that result in long-distance calls.SET DIAL LD-SUFFIX [ ] Long-distance dialing suffix, if any, to be used with portable dialing directory entries that result in long-distance calls. This would normally be used for appending a calling-card number to the phone number.SET DIAL FORCE-LONG-DISTANCE { ON, OFF } Whether to force long-distance dialing for calls that normally would be local. For use (e.g.) in France.SET DIAL TOLL-FREE-AREA-CODE [ [ [ ... ] ] ] Tells Kermit the toll-free area code(s) in your country.SET DIAL TOLL-FREE-PREFIX [ ] You toll-free dialing prefix, in case it is different from your long- distance dialing prefix.SET DIAL INTL-PREFIX Your international dialing prefix, to be used with portable dialing directory entries that result in international calls.SET DIAL INTL-SUFFIX International dialing suffix, if any, to be used with portable dialingSET DIAL PBX-OUTSIDE-PREFIX Use this to tell Kermit how to get an outside line when dialing from a Private Branch Exchange (PBX).SET DIAL PBX-EXCHANGE [ [ ... ] ] If PBX-OUTSIDE-PREFIX is set, then you can use this command to tell Kermit the leading digits of one or more local phone numbers that identify it as being on your PBX, so it can make an internal call by deleting those digits from the phone number.SET DIAL PBX-INTERNAL-PREFIX If PBX-EXCHANGE is set, and Kermit determines from it that a call is internal, then this prefix, if any, is added to the number prior to dialing. Use this if internal calls from your PBX require a special prefix.Syntax: SET FLOW [ switch ] value Selects the type of flow control to use during file transfer, terminal connection, and script execution. Switches let you associate a particular kind of flow control with each kind of connection: /REMOTE, /MODEM, /DIRECT-SERIAL, /TCPIP, etc; type "set flow ?" for a list of available switches. Then whenever you make a connection, the associated flow-control is chosen automatically. The flow-control values are NONE, KEEP, XON/XOFF, and possibly RTS/CTS and some others; again, type "set flow ?" for a list. KEEP tells Kermit not to try to change the current flow-control method for the connection. If you omit the switch and simply supply a value, this value becomes the current flow control type, overriding any default value that might have been chosen in your most recent SET LINE, SET PORT, or SET HOST, or other connection-establishment command. Type SHOW FLOW-CONTROL to see the current defaults for each connection type as well as the current connection type and flow-control setting. SHOW COMMUNICATIONS also shows the current flow-control setting.Syntax: SET FILE parameter valueSets file-related parameters. Use SHOW FILE to view them.Parameters:SET FILE TYPE { TEXT, BINARY, ... } How file contents are to be treated during file transfer. TYPE is normally TEXT, with conversion of record format and character set. BINARY means to do no conversion. Use BINARY for executable programs or binary data. Example: SET FILE TYPE BINARY.SET FILE PATTERNS { ON, OFF, AUTO } ON means to use filename pattern lists to determine whether to send a file in text or binary mode. OFF means to send all files in the prevailing mode. AUTO (the default) is like ON if the other Kermit accepts Attribute packets and like OFF otherwise.SET FILE BINARY-PATTERNS [ [ ... ] ] Zero or more filename patterns which, if matched, cause a file to be sent in binary mode. See HELP WILDCARDS for more information about patterns.SET FILE TEXT-PATTERNS [ [ ... ] ] in text mode. See HELP WILDCARD for pattern syntax.SET FILE BYTESIZE { 7, 8 } Normally 8. If 7, truncate the 8th bit of all file bytes.SET FILE CHARACTER-SET name Tells the encoding of the local file, ASCII by default. The names ITALIAN, PORTUGUESE, NORWEGIAN, etc, refer to 7-bit ISO-646 national character sets. LATIN1 is the 8-bit ISO 8859-1 Latin Alphabet 1 for Western European languages. NEXT is the 8-bit character set of the NeXT workstation. The CPnnn sets are for PCs. MACINTOSH-LATIN is for the Macintosh. LATIN2 is ISO 8859-2 for Eastern European languages that are written with Roman letters. Mazovia is a PC code page used in Poland. KOI-CYRILLIC, CYRILLIC-ISO, and CP866 are 8-bit Cyrillic character sets. SHORT-KOI is a 7-bit ASCII coding for Cyrillic. BULGARIA-PC is a PC code page used in Bulgaria HEBREW-ISO is ISO 8859-8 Latin/Hebrew. CP862 is the Hebrew PC code page. HEBREW-7 is like ASCII with the lowercase letters replaced by Hebrew. GREEK-ISO is ISO 8859-7 Latin/Greek. CP869 is the Greek PC code page. ELOT-927 is like ASCII with the lowercase letters replaced by Greek. JAPANESE-EUC, JIS7-KANJI, DEC-KANJI, and SHIFT-JIS-KANJI are Japanese Kanji character sets. Type SET FILE CHAR ? for a complete list of file character sets.SET FILE COLLISION option Tells what to do when a file arrives that has the same name as an existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if newer than the existing file.SET FILE DESTINATION { DISK, PRINTER, SCREEN, NOWHERE } DISK (default): Store incoming files on disk. PRINTER: Send incoming files to SET PRINTER device. SCREEN: Display incoming files on screen (local mode only). NOWHERE: Do not put incoming files anywhere (use for calibration).SET FILE DISPLAY option Selects the format of the file transfer display for local-mode file transfer. The choices are: BRIEF A line per file, showing size, mode, status, and throughput. SERIAL One dot is printed for every K bytes transferred. CRT Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. FULLSCREEN A fully formatted 24x80 screen showing lots of information. This requires a terminal or terminal emulator. NONE No file transfer display at all.SET FILE DOWNLOAD-DIRECTORY [ ] The directory into which all received files should be placed. By default, received files go into your current directory.SET FILE END-OF-LINE { CR, CRLF, LF } Use this command to specify nonstandard line terminators for text files.SET FILE INCOMPLETE { AUTO, KEEP, DISCARD } What to do with an incompletely received file: KEEP (default), or DISCARD. AUTO (the default) means DISCARD if transfer is in text mode, KEEP if it is in binary mode.SET FILE NAMES { CONVERTED, LITERAL } File names are normally CONVERTED to "common form" during transmission (e.g. lowercase to uppercase, extra periods changed to underscore, etc). LITERAL means use filenames literally (useful between like systems). Also see SET SEND PATHNAMES and SET RECEIVE PATHNAMES.SET FILE OUTPUT { { BUFFERED, UNBUFFERED } [ size ], BLOCKING, NONBLOCKING } Lets you control the disk output buffer for incoming files. Buffered blocking writes are normal. Nonblocking writes might be faster on some systems but might also be risky, depending on the underlying file service. Unbuffered writes might be useful in critical applications to ensure that cached disk writes are not lost in a crash, but will probably also be slower. The optional size parameter after BUFFERED or UNBUFFERED lets you change the disk output buffer size; this might make a difference in performance.SET FILE WARNING { ON, OFF } SET FILE WARNING is superseded by the newer command, SET FILE COLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAME and SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE.Syntax: SET HANDSHAKE { NONE, XON, LF, BELL, ESC, CODE number } Character to use for half duplex line turnaround handshake during file transfer. C-Kermit waits for this character from the other computer before sending its next packet. Default is NONE; you can give one of the other names like BELL or ESC, or use SET HANDSHAKE CODE to specify the numeric code value of the handshake character. Type SET HANDSH ? for a complete list of possibilities.SET SERVER CD-MESSAGE {ON,OFF} Tells whether the server, after successfully executing a REMOTE CD command, should send the contents of the new directory's READ.ME (or similar) file to your screen.SET SERVER CD-MESSAGE FILE name Tells the name of the file to be displayed as a CD-MESSAGE, such as READ.ME (SHOW SERVER tells the current CD-MESSAGE FILE name). To specify more than one filename to look for, use {{name1}{name2}..}. Synonym: SET CD MESSAGE FILE .SET SERVER DISPLAY {ON,OFF} Tells whether local-mode C-Kermit during server operation should put a file transfer display on the screen. Default is OFF.SET SERVER GET-PATH [ directory [ directory [ ... ] ] ] Tells the C-Kermit server where to look for files whose names it receives from client GET commands when the names are not fully specified pathnames. Default is no GET-PATH, so C-Kermit looks only in its current directory.SET SERVER LOGIN [ username [ password [ account ] ] ] Sets up a username and optional password which must be supplied before the server will respond to any commands other than REMOTE LOGIN. The account is ignored. If you enter SET SERVER LOGIN by itself, then login is no longer required.SET SERVER TIMEOUT n Server command wait timeout interval, how often the C-Kermit server issues a NAK while waiting for a command packet. Specify 0 for no NAKs at all. Default is 0.The REMOTE command sends file management instructions or other commandsto a Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.All REMOTE commands except LOGIN and LOGOUT have R-command shortcuts;for example, RDIR for REMOTE DIR, RCD for REMOTE CD, etc.Syntax: IF [NOT] condition commandlistIf the condition is (is not) true, do the commandlist. The commandlistcan be a single command, or a list of commands separated by commas andenclosed in braces. The condition can be a single condition or a group ofconditions separated by AND (&&) or OR (||) and enclosed in parentheses.Examples: IF EXIST oofa.txt IF ( EXIST oofa.txt || = \v(nday) 3 ) IF ( EXIST oofa.txt || = \v(nday) 3 ) { , , ... }The conditions are: SUCCESS - The previous command succeeded OK - Synonym for SUCCESS FAILURE - The previous command failed ERROR - Synonym for FAILURE FLAG - Succeeds if SET FLAG ON, fails if SET FLAG OFF BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground REMOTE-ONLY - C-Kermit was started with the -R command-line option ALARM - SET ALARM time has passed ASKTIMEOUT - The most recent ASK, ASKQ, GETC, or GETOK timed out EMULATION - Succeeds if executed while in CONNECT mode AVAILABLE CRYPTO - Encryption is available AVAILABLE KERBEROS4 - Kerberos 4 authentication is available AVAILABLE KERBEROS5 - Kerberos 5 authentication is available AVAILABLE NTLM - NTLM authentication is available AVAILABLE SRP - SRP authentication is available AVAILABLE SSL - SSL/TLS authentication is available MATCH string pattern - Succeeds if string matches pattern DEFINED variablename or macroname - The named variable or macro is defined NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists ABSOLUTE filename - The filename is absolute, not relative DIRECTORY string - The string is the name of a directory READABLE filename - Succeeds if the file is readable WRITEABLE filename - Succeeds if the file is writeable NEWER file1 file2 - The 1st file is newer than the 2nd one OPEN { READ-FILE,SESSION-LOG,...} - The given file or log is open OPEN CONNECTION - A connection is open COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n2 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 <= n1 n2 - n1 is arithmetically less than or equal to n2 > n1 n2 - n1 is arithmetically greater than n2 >= n1 n2 - n1 is arithmetically greater than or equal to n2 (number by itself) - fails if the number is 0, succeeds otherwise TRUE - always succeeds FALSE - always failsThe IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not lessIt can also include an ELSE part on the same line if braces are used: IF < \%x 10 { ECHO It's less } ELSE { ECHO It's not less }Also see HELP WILDCARD (for IF MATCH pattern syntax).Syntax: EVALUATE variable expression Evaluates the expression and assigns its value to the given variable. The expression can contain numbers and/or numeric-valued variables or functions, combined with mathematical operators and parentheses in traditional notation. Operators include +-/*(), etc. Example: EVALUATE \%n (1+1) * (\%a / 3). NOTE: Prior to C-Kermit 7.0, the syntax was "EVALUATE expression" (no variable), and the result was printed. Use SET EVAL { OLD, NEW } to choose the old or new behavior, which is NEW by default.Alse see: HELP FUNCTION EVAL.Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Obsolete. Same as IF (see HELP IF).Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist the number of times given by the initial value, final value and increment. Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketed commandlist while the condition is true. Conditions are the same as for IF commands.Syntax: SWITCH { case-list } Selects from a group of commands based on the value of a variable. The case-list is a series of lines like these: :x, command, command, ..., break where "x" is a possible value for the variable. At the end of the case-list, you can put a "default" label to catch when the variable does not match any of the labels: :default, command, command, ...The case label "x" can be a character, a string, a variable, a functioninvocation, a pattern, or any combination of these. See HELP WILDCARDSfor information about patterns.Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specified mode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or write to a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename [ prompt ]Example: ASKQ \%p { Password:} Issues the prompt and defines the variable to be whatever you type in. The characters that you type do not echo on the screen. Use braces to preserve leading and/or trailing spaces in the prompt. To include a question mark, precede it by backslash (\).Also see SET ASK-TIMER.Syntax: ASK variablename [ prompt ]Example: ASK \%n { What is your name\? }Syntax: GETC variablename [ prompt ]Example: GETC \%c { Type any character to continue...} Issues the prompt and sets the variable to the first character you type.Syntax: SET ASK-TIMER number For use with ASK, ASKQ, GETOK, and GETC. If ASK-TIMER is set to a number greater than 0, these commands will time out after the given number of seconds with no response. This command is "sticky", so to revert to untimed ASKs after a timed one, use SET ASK-TIMER 0. Also see IF ASKTIMEOUT.Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally. No expansion or evaluation of the definition is done. Thus if the definition includes any variable or function references, their names are included, rather than their values (compare with ASSIGN). If the definition is omitted, then the named variable or macro is undefined.A typical macro definition looks like this: DEFINE name command, command, command, ...for example: DEFINE vax set parity even, set duplex full, set flow xon/xoffwhich defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments.The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro). The definition string is fully evaluated before it is assigned, so that the values of any variables are contained are used, rather than their names. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This prints 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current value is numeric. If the number argument is given, subtract that number instead.Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value is numeric. If the number argument is given, add that number instead.Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: SET PRINTER [ { |command, filename } ] Specifies the command (such as "|lpr") or filename to be used by the PRINT command. If a filename is given, each PRINT command appends to the given file. If the SET PRINTER argument contains spaces, it must be enclosed in braces, e.g. "set printer {| lpr -Plaser}". If the argument is omitted the default value is restored. SHOW PRINTER lists the current printer. See HELP PRINT for further info.Syntax: SET EXIT ON-DISCONNECT { ON, OFF } When ON, C-Kermit EXITs automatically when a network connection is terminated either by the host or by issuing a HANGUP command.Syntax: SET EXIT STATUS number Set C-Kermit's program return code to the given number, which can be a constant, variable, function result, or arithmetic expression.Syntax: SET EXIT WARNING { ON, OFF, ALWAYS } When EXIT WARNING is ON, issue a warning message and ask for confirmation before EXITing if a connection to another computer might still be open. When EXIT WARNING is ALWAYS, confirmation is always requested. When OFF it is never requested. The default is ON.Syntax: PAUSE [ { number-of-seconds, hh:mm:ss } ]Example: PAUSE 3 or PAUSE 14:52:30 Do nothing for the specified number of seconds or until the given time of day in 24-hour hh:mm:ss notation. If the time of day is earlier than the current time, it is assumed to be tomorrow. If no argument given, one second is used. The pause can be interrupted by typing any character on the keyboard unless SLEEP CANCELLATION is OFF. If interrupted, PAUSE fails, otherwise it succeeds. Synonym: SLEEP.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given, 100 milliseconds.Syntax: !, @, RUN, PUSH, or SPAWN, optionally followed by a command. Gives the command to the local operating system's command processor, and displays the results on the screen. If the command is omitted, enters the system's command line interpreter or shell; exit from it (the command for this is usually EXIT or QUIT or LOGOUT) to return to Kermit.Syntax: TRANSMIT { /COMMAND, /TEXT, /BINARY } filename Sends the contents of a file, without any error checking or correction, to the computer on the other end of your SET LINE or SET HOST connection (or if C-Kermit is in remote mode, displays it on the screen). The filename is the name of a single file (no wildcards) to be sent or, if the /COMMAND switch is included, the name of a command whose output is The file is sent according to your current FILE TYPE setting (BINARY or TEXT), which you can override with a /BINARY or /TEXT switch without changing the global setting. In text mode, it is sent a line at a time, with carriage return at the end of each line (as if you were typing it at your keyboard), and C-Kermit waits for a linefeed to echo before sending the next line. In binary mode, it is sent a character at a time, with no feedback required. There can be no guarantee that the other computer will receive the file correctly and completely. Before you start the TRANSMIT command, you must put the other computer in data collection mode, for example by starting a text editor. TRANSMIT may be interrupted by Ctrl-C. Synonym: XMIT. See HELP SET TRANSMIT for further information.Syntax: TRANSLATE file1 cs1 cs2 [ file2 ] Translates file1 from the character set cs1 into the character set cs2 and stores the result in file2. The character sets can be any of C-Kermit's file character sets. If file2 is omitted, the translation is displayed on the screen. An appropriate intermediate character-set is chosen automatically, if necessary. Synonym: XLATE. Example: TRANSLATE lasagna.lat latin1 italian lasagna.nrcSyntax: WAIT { number-of-seconds, hh:mm:ss } [modem-signal(s)] wait 5 cd cts wait 23:59:59 cd Waits up to the given number of seconds or the given time of day for all the specified modem signals to appear on the serial communication device. Sets FAILURE if the signals do not appear in the given time or interrupted from the keyboard during the waiting period. Also see HELP PAUSE.Signals: cd = Carrier Detect; dsr = Dataset Ready; cts = Clear To Send; ri = Ring Indicate.Syntax: WRITE name text Writes the given text to the named log or file. The text text may include backslash codes, and is not terminated by a newline unless you include the appropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGSyntax: LOOKUP name Looks up the given name in the dialing directory or directories, if any, specified in the most recent SET DIAL DIRECTORY command. Each matching entry is shown, along with any transformations that would be applied to portable-format entries based on your locale. HELP DIAL, HELP SET DIAL for further info.Syntax: ANSWER [ ] Waits for a modem call to come in. Prior SET MODEM TYPE and SET LINE required. If is 0 or not specified, Kermit waits forever or until interrupted, otherwise Kermit waits the given number of seconds. The ANSWER command puts the modem in autoanswer mode. Subsequent DIAL commands will automatically put it (back) in originate mode. SHOW MODEM, HELP SET MODEM for more info.Syntax: DIAL phonenumberExample: DIAL 7654321 Dials a number using an autodial modem. First you must SET MODEM, then SET LINE, then SET SPEED. Then give the DIAL command, including the phone number, for example: DIAL 7654321 If the modem is on a network modem server, SET HOST first, then SET MODEM, then DIAL. See also SET DIAL, SET MODEM, SET LINE, SET HOST, SET SPEED, REDIAL, and PDIAL.If the phonenumber starts with a letter, and if you have used the SET DIALDIRECTORY command to specify one or more dialing-directory files, Kermitlooks it up in the given file(s); if it is found, the name is replaced bythe number or numbers associated with the name. If it is not found, thename is sent to the modem literally.If the phonenumber starts with an equals sign ("="), this forces the partafter the = to be send literally to the modem, even if it starts with aletter, without any directory lookup.A dialing directory is a plain text file, one entry per line: name phonenumber ; comments work 9876543 ; This is a comment e-mail +1 (212) 555 4321 ; My electronic mailbox heise +49 (511) 535 2301 ; Verlag Heinz Heise BBSIf a phone number starts with +, then it must include country code andarea code, and C-Kermit will try to handle these appropriately based onthe current locale (HELP SET DIAL for further info); these are calledPORTABLE entries. If it does not start with +, it is dialed literally.If more than one entry is found with the same name, Kermit dials all ofthem until the call is completed; if the entries are in portable format,Kermit dials then in cheap-to-expensive order: internal, then local, thenlong-distance, then international, based on its knowledge of your localcountry code and area code (see HELP SET DIAL).Specify your dialing directory file(s) with the SET DIAL DIRECTORY command.Syntax: TELNET [ switches ] [ host [ service ] ] Equivalent to SET NETWORK TYPE TCP/IP, SET HOST host [ service ] /TELNET, IF SUCCESS CONNECT. If host is omitted, the previous connection (if any) is resumed. Depending on how Kermit has been built switches may be available to require a secure authentication method and bidirectional encryption. See HELP SET TELNET for more info.TELOPT { AO, AYT, BREAK, CANCEL, EC, EL, EOF, EOR, GA, IP, DMARK, NOP, SE, SUSP, SB [ option ], DO [ option ], DONT [ option ], WILL [ option ], WONT [option] } This command lets you send all the Telnet protocol commands. Note that certain commands do not require a response, and therefore can be used as nondestructive "probes" to see if the Telnet session is still open; e.g.: set host xyzcorp.com ... telopt nop if fail stop 1 Connection lost TELOPT NOP is sent twice because the failure of the connection will not be detected until the second send is attempted. This command is meant primarily as a debugging tool for the expert user.Syntax: ARRAY verb operands...Declares arrays and performs various operations on them. Arrays havethe following syntax: \&a[n]where "a" is a letter and n is a number or a variable with a numeric valueor an arithmetic expression. The value of an array element can be anythingat all -- a number, a character, a string, a filename, etc.The following ARRAY verbs are available:[ ARRAY ] DECLARE arrayname[n] [ = initializers... ] Declares an array of the given size, n. The resulting array has n+1 elements, 0 through n. Array elements can be used just like any other variables. Initial values can be given for elements 1, 2, ... by including = followed by one or more values separated by spaces. If you omit the size, the array is sized according to the number of initializers; if none are given the array is destroyed and undeclared if it already existed. The ARRAY keyword is optional. Synonym: [ ARRAY ] DCL.ARRAY SHOW [ arrayname ] Displays the contents of the given array. A range specifier can be included to display a segment of the array, e.g. "array show \&a[1:24]." If the arrayname is omitted, all declared arrays are listed, but their contents is not shown. Synonym: SHOW ARRAY.ARRAY CLEAR arrayname Clears all elements of the array, i.e. sets them to empty values. You may include a range specifier to clear a segment of the array rather than the whole array, e.g. "array clear \%a[22:38]"ARRAY SET arrayname value Sets all elements of the array to the given value. You may specify a range to set a segment of the array, e.g. "array set \%a[2:9] 0"ARRAY DESTROY arrayname Destroys and undeclares the given array.ARRAY RESIZE arrayname number Changes the size of the given array, which must already exist, to the number given. If the number is smaller than the current size, the extra elements are discarded; if it is larger, new empty elements are added.ARRAY COPY array1 array2 Copys array1 to array2. If array2 has not been declared, it is created automatically. Range specifiers may be given on one or both arrays.[ ARRAY ] SORT [ switches ] array-name Sorts the given array lexically according to the switches. Element 0 of the array is excluded from sorting by default. The ARRAY keyword is optional. Switches: /CASE:{ON,OFF} If ON, alphabetic case matters; if OFF it is ignored. If this switch is omitted, the current SET CASE setting applies. /KEY:number Position (1-based column number) at which comparisons begin, 1 by default. /RANGE:low[:high] The range of elements, low through high, to be sorted. If this switch is not given, elements 1 through the dimensioned size are sorted. If :high is omitted, the dimensioned size is used. To include element 0 in a sort, use /RANGE:0 (to sort the whole array) or /RANGE:0:n (to sort elements 0 through n). You can use a range specifier in the array name instead of the /RANGE switch. /REVERSE Sort in reverse order. If this switch is not given, the array is sorted in ascending order.Various functions are available for array operations; see HELP FUNCTION fordetails. These include \fdimension(), \farraylook(), \ffiles(), \fsplit(),and many more.Syntax: COPY [ switches ] file1 file2 Copies the source file (file1) to the destination file (file2). If file2 is a directory, this command copies file1 under its own name to the given directory. Only one file at a time may be copied; wildcards are not supported. Switches: /LIST Print the filenames and status while copying. Synonyms: /LOG, /VERBOSE /NOLIST Copy silently (default). Synonyms: /NOLOG, /QUIETSyntax: RENAME [ switches ] file1 file2 Renames the source file (file1) to the destination file (file2). If file2 is a directory, this command moves file1 under its own name to the given directory. Only one file at a time may be renamed; wildcards are not Print the filenames and status while renaming. Synonyms: /LOG, /VERBOSE Rename silently (default). Synonyms: /NOLOG, /QUIETCommand-line options are given after the program name in the systemcommand that you use to start C-Kermit. Example: kermit -i -s oofa.exetells C-Kermit to send (-s) the file oofa.exe in binary (-i) mode.Command-line options are case-sensitive; "-s" is different from "-S".If any "action options" are included on the command line, C-Kermit exitsafter executing its command-line options. If -S is included, or no actionoptions were given, C-Kermit enters its interactive command parser andissues its prompt.Command-line options are single characters preceded by dash (-). Somerequire an "argument," others do not. If an argument contains spaces, itmust be enclosed in doublequotes: kermit -s "filename with spaces"An option that does not require an argument can be bundled with other options: kermit -Qis oofa.exeExceptions to the rules: . If the first command-line option is a filename, Kermit executes commands from the file. Additional command-line options can follow the filename. . The special option "=" (equal sign) or "--" (double hyphen) means to treat the rest of the command line as data, rather than commands; this data is placed in the argument vector array, \&@[], along with the other items on the command line, and also in the top-level \%1..\%9 variables. . A similar option "+" (plus sign) means: the name of a Kermit script file follows. This file is to be executed, and its name assigned to \%0 and \&_[0]. All subsequent command-line arguments are to be ignored by Kermit but made available to the script as \%1, \%2, ..., as well as in the argument-vector arrays. The initialization file is not executed automatically in this case. . The -s option can accept multiple filenames, separated by spaces. . the -j and -J options allow an optional second argument, the TCP port name or number.Type "help options all" to list all the command-line options.Type "help option x" to see the help message for option x.C-Kermit also offers a selection of "extended command-line" options.These begin with two dashes, followed by a keyword, and then, if the optionhas arguments, a colon (:) or equal sign (=) followed by the argument.Unlike single-letter options, extended option keywords aren't case sensitiveand they can be abbreviated to any length that still distinguishes them fromother extended-option keywords. Example: kermit --banner:oofa.txtwhich designates the file oofa.txt to be printed upon startup, rather thanthe built-in banner (greeting) text. To obtain a list of availableextended options, type "help extended-options ?". To get help about allextended options, type "help extended-options". To get help about aparticular extended option, type "help extended-option xxx", where "xxx"is the option keyword.At present, most of the extended options apply only to the Internet KermitService Daemon (IKSD). Type "help iksd" for details.Extended argument without the "--" prefix %s %s %s %s A command-line option character, or the word ALL, or carriage return for an overviewallALL?A single character, please, or carriage to list them all. The following command-line options are available: -%c %s (action option) %s Argument: %s -%c %s%s Argument: (none) DOHELP xxSyntax: APC text Echoes the text within a VT220/320/420 Application Program Command.Describes how to get technical support.Syntax: BEEP Sends a BEL character to your terminal.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: CD [ directoryname ] Change Directory. If directory name omitted, changes to your home directory. Also see HELP SET CD.Syntax: UNDEFINE variable-name Undefines a macro or variable.Syntax: PDIAL phonenumber Partially dials a phone number. Like DIAL but does not wait for carrier or CONNECT message.Redial the number given in the most recent DIAL commnd.Syntax: LS [ args ] Runs "ls" with the given arguments.Syntax: DISABLE command Security for the C-Kermit server. Prevents the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Executes a macro that was defined with the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1 through \%9.Syntax: ECHO text Displays the text on the screen, followed by a line terminator. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: XECHO text Just like ECHO but does not add a line terminator to the text. See ECHO.Syntax: ENABLE capability For use with server mode. Allows the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exits from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: E-PACKET Sends an Error packet to the other Kermit.Syntax: QUIT (or EXIT) [ number ] Exits from the Kermit program, closing all open files and devices, optionally setting the program's return code to the given number. Also see SET EXIT.Syntax: FINISH Tells the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Prints the prompt, makes user type 'yes', 'no', or 'ok', and sets SUCCESS or FAILURE accordingly. Also see SET ASK-TIMER.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1999, Trustees of Columbia University in the City of New York. %s, Copyright (C) 1985, 1999,Give a brief introduction to C-Kermit.Syntax: REINPUT n string Looks for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored. Introduces a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Equivalent to SEND /MAIL /ADDRESS:xxx filename.MMOVE is exactly like MSEND, except each file that is sent successfully is deleted after it is sent. Prints news of new features since publication of "Using C-Kermit". New features are described in the file DOCS\UPDATES.TXT.Syntax: PING [ IP-hostname-or-number ] Checks if the given IP network host is reachable. Default host is from most recent SET HOST or TELNET command. Runs system PING program, if any.Syntax: FTP [ IP-hostname-or-number ] Makes an FTP connection to the given IP host or, if no host specified, to the current host. Uses the system's FTP program, if any.Syntax: PRINT file [ options ] Prints the local file on a local printer with the given options. Also see HELP SET PRINTER.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Reads a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with \fexecute(macro), which allows macros to be used like functions.MOVE is exactly like SEND, except each file that is sent successfully is deleted after it is sent.Syntax: SUSPEND or Z Suspends Kermit. Continue Kermit with the appropriate system command, such as fg.ParameterHELP SET ySorry, help not available for "%s" Syntax: REDIRECT command Runs the given local command with its standard input and output redirected to the current SET LINE or SET HOST communications path. Synonym: < (Left angle bracket). Display current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS [/BRIEF] Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: RLOGIN [ switches ] [ host [ username ] ] Equivalent to SET NETWORK TYPE TCP/IP, SET HOST host [ service ] /RLOGIN, IF SUCCESS CONNECT. If host is omitted, the previous connection (if any) is resumed. Depending on how Kermit has been built switches may be available to require Kerberos authentication and DES encryption.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Declares a variable to be local to the current macro or command file.View the terminal emulation screen even when there is no connection.Synonym for SET FILE TYPE TEXT.Synonym for SET FILE TYPE BINARY.Just like GET but asks the server to delete each file that has been sent successfully.Equivalent to SET PARITY NONE, SET COMMAND BYTE 8, SET TERMINAL BYTE 8.Syntax: SAVE KEYMAP Saves current keymap definitions to file, "keymap.ini" by default.Syntax: EDIT [ ] Starts your preferred editor on the given file, or if none given, the most recently edited file, if any. Also see SET EDITOR.Syntax: BROWSE [ ] Starts your preferred Web browser on the given URL, or if none given, the most recently visited URL, if any. Also see SET BROWSER.Syntax: CSEND [ switches ] [ ] Sends from the given rather than from a file. Equivalent to SEND /COMMAND; see HELP SEND for details.Syntax: CRECEIVE [ switches ] Receives to the given rather than to a file. Equivalent to RECEIVE /COMMAND; see HELP RECEIVE for details.Syntax: CGET Equivalent to GET /COMMAND; see HELP GET for details.Name of function without \fSyntax: KERMIT [command-line-options] Lets you give command-line options at the prompt or in a script. HELP OPTIONS for more info.Syntax: BACK Returns to your previous directory.Syntax: WHERE Tells where your transferred files went.Syntax: PIPE [ command ] Makes a connection through the program whose command line is given. Example: pipe rlogin xyzcorp.comSTATUS is the same as SHOW STATUS; prints SUCCESS or FAILURE for the previous command.Syntax: ASSERT Succeeds or fails depending on ; see HELP IF for s.Always fails.Always succeeds.If you haved logged in to C-Kermit as an Internet Kermit server, the LOGOUT command, given at the prompt, logs you out and closes your session.The Internet Kermit Service Daemon can be started only by the system administrator. The IKSD is documented separately.Closes all open files and logs.Syntax: SHIFT [ n ] Shifts \%1..9 variables n places to the left; default n = 1.Syntax: MANUAL [ topic ] Runs the "man" command on the given topic (default "kermit").RASG and RASSIGN are short forms of REMOTE ASSIGN.RCD and RCWD are short forms of REMOTE CD.RCOPY is a short form of REMOTE COPY.RDELETE is a short form of REMOTE RELETE.RDIRECTORY is a short form of REMOTE DIRECTORY.REXIT is a short form of REMOTE EXIT.RHELP is a short form of REMOTE HELP.RHOST is a short form of REMOTE HOST.RKERMIT is a short form of REMOTE KERMIT.RMKDIR is a short form of REMOTE MKDIR.RPRINT is a short form of REMOTE PRINT.RPWD is a short form of REMOTE PWD.QUERY and RQUERY are short forms of REMOTE QUERY.RRENAME is a short form of REMOTE RENAME.RRMDIR is a short form of REMOTE RMDIR.RSET is a short form of REMOTE SET.RSPACE is a short form of REMOTE SPACE.RTYPE is a short form of REMOTE TYPE.RWHO is a short form of REMOTE WHO. %s Syntax: SET TRANSMIT parameter valueControls the behavior of the TRANSMIT command (see HELP TRANSMIT):SET TRANSMIT ECHO { ON, OFF } Whether to echo text to your screen as it is being transmitted.SET TRANSMIT EOF text Text to send after end of file is reached, e.g. \4 for Ctrl-DSET TRANSMIT FILL number ASCII value of a character to insert into blank lines, 0 for none. Applies only to text mode. 0 by default.SET TRANSMIT LINEFEED { ON, OFF } Transmit Linefeed as well as Carriage Return (CR) at the end of each line. Normally, only CR is sent.SET TRANSMIT LOCKING-SHIFT { ON, OFF } Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.SET TRANSMIT PAUSE number How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).SET TRANSMIT PROMPT number ASCII value of character to look for from host before sending next line when TRANSMITting in text mode; normally 10 (Linefeed). 0 means none; don't wait for a prompt.SET TRANSMIT TIMEOUT number Number of seconds to wait for each character to echo when TRANSMIT ECHO is ON or TRANSMIT PROMPT is not 0. If 0 is specified, this means wait indefinitely for each echo.Synonym: SET XMIT. SHOW TRANSMIT displays current settings.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screen even though Kermit thinks it is running in the background.Syntax: SET BUFFERS n1 [ n2 ] Changes the overall amount of memory allocated for SEND and RECEIVE packet buffers, respectively. Bigger numbers let you have longer packets and more window slots. If n2 is omitted, the same value as n1 is used. NOTE: This command is not needed in this version of C-Kermit, which is already configured for maximum-size packet buffers.Syntax: SET COMMAND parameter valueSET COMMAND AUTODOWNLOAD { ON, OFF } Enables/Disables automatic recognition of Kermit packets while in command mode. ON by default.SET COMMAND BYTESIZE { 7, 8 } Informs C-Kermit of the bytesize of the communication path between itself and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow entry and display of 8-bit characters.SET COMMAND HEIGHT Informs C-Kermit of the number of rows in your command screen for the purposes of More?-prompting.SET COMMAND WIDTH Informs C-Kermit of the number of characters across your screen for purposes of screen formatting.SET COMMAND MORE-PROMPTING { ON, OFF } ON (the default) enables More?-prompting when C-Kermit needs to display text that does not fit vertically on your screen. OFF allows the text to scroll by without intervention. If your command window has scroll bars, you might prefer OFF.SET COMMAND RECALL-BUFFER-SIZE number How big you want C-Kermit's command recall buffer to be. By default, it holds 10 commands. You can make it any size you like, subject to memory constraints of the computer. A size of 0 disables command recall. Whenever you give this command, previous command history is lost.SET COMMAND QUOTING { ON, OFF } Whether to treat backslash and question mark as special characters (ON), or as ordinary data characters (OFF) in commands. ON by default.SET COMMAND RETRY { ON, OFF } Whether to reprompt you with the correct but incomplete portion of a syntactically incorrect command. ON by default.Use SHOW COMMAND to display these settings.Syntax: SET CARRIER-WATCH { AUTO, OFF, ON } Attempts to control treatment of carrier (the Data Carrier Detect signal) on serial communication (SET LINE or SET PORT) devices. ON means that carrier is required at all times. OFF means carrier is never required. AUTO (the default) means carrier is required at all times except during the DIAL command. Correct operation of carrier-watch depends on the capabilities of the underlying OS, drivers, devices, and cables. If you need to CONNECT to a serial device that is not asserting carrier, and Kermit won't let you, use SET CARRIER-WATCH OFF. Use SHOW COMMUNICATIONS to display the CARRIER-WATCH setting.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission of selected file attributes along with each file, and to handle or ignore selected incoming file attributes, including: CHARACTER-SET: The transfer character set for text files DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary)You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET TAKE parameter value Controls behavior of TAKE command:SET TAKE ECHO { ON, OFF } Tells whether commands read from a TAKE file should be displayed on the screen (if so, each command is shown at the time it is read, and labeled with a line number).SET TAKE ERROR { ON, OFF } Tells whether a TAKE command file should be automatically terminated when a command fails. This setting is local to the current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter valueSET TERMINAL TYPE ... This command is not available because this version of C-Kermit does not include a terminal emulator. Instead, it is a "semitransparent pipe" (or a totally transparent one, if you configure it that way) to the computer or service you have made a connection to. Your console, workstation window, or the terminal emulator or terminal from which you are running C-Kermit provides the emulation.SET TERMINAL APC { ON, OFF, UNCHECKED } Controls execution of Application Program Commands sent by the host while C-Kermit is in CONNECT mode. ON allows execution of "safe" commands and disallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, and RUN. OFF prevents execution of APCs. UNCHECKED allows execution of all APCs. OFF is the default.SET TERMINAL AUTODOWNLOAD { ON, OFF } Enables/disables automatic switching into file-transfer mode when a valid Kermit or ZMODEM packet of the appropriate type is received during CONNECT mode. Default is OFF.SET TERMINAL BYTESIZE { 7, 8 } Use 7- or 8-bit terminal characters between C-Kermit and the remote computer or service during CONNECT.SET TERMINAL CHARACTER-SET [ ] Specifies the character set used by the remote host, , and the character set used by C-Kermit locally, . If you don't specify the local character set, the current FILE CHARACTER-SET is used. When you specify two different character sets, C-Kermit translates between them during CONNECT. By default, both character sets are TRANSPARENT, and no translation is done.SET TERMINAL CR-DISPLAY { CRLF, NORMAL } Specifies how incoming carriage return characters are to be displayed on your screen.SET TERMINAL DEBUG { ON, OFF } Turns terminal session debugging on and off. When ON, incoming control characters are displayed symbolically, rather than be taken as formatting commands.SET TERMINAL ECHO { LOCAL, REMOTE } Specifies which side does the echoing during terminal connection.SET TERMINAL ESCAPE-CHARACTER { ENABLED, DISABLED } Turns on/off the ability to escape back from CONNECT mode using the SET ESCAPE character. If you disable it, Kermit returns to its prompt only when the connection is closed by the other end. USE WITH EXTREME CAUTION. Also see HELP SET ESCAPE.SET TERMINAL HEIGHT Tells C-Kermit how many rows (lines) are on your CONNECT-mode screen.SET TERMINAL LOCKING-SHIFT { OFF, ON } Tells C-Kermit whether to use Shift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bit characters during CONNECT. OFF by default.SET TERMINAL NEWLINE-MODE { OFF, ON } Tells whether to send CRLF (Carriage Return and Line Feed) when you type CR (press the Return or Enter key) in CONNECT mode.SET TERMINAL PRINT { ON, OFF } Enables and disables host-initiated transparent printing in CONNECT mode.SET TERMINAL TRIGGER Specifies a string that, when detected during any subsequent CONNECT session, is to cause automatic return to command mode. Give this command without a string to cancel the current trigger. See HELP CONNECT for additional information.SET TERMINAL WIDTH Tells C-Kermit how many columns (characters) are on your CONNECT-mode screen.Type SHOW TERMINAL to see current terminal settings.SET HOST [ switches ] hostname-or-address [ service ] [ protocol-switch ] Establishes a connection to the specified network host on the currently selected network type. For TCP/IP connections, the default service is TELNET; specify a different TCP port number or service name to choose a different service. The first set of switches can be: /NETWORK-TYPE:name Makes the connection on the given type of network. Equivalent to SET NETWORK TYPE name prior to SET HOST, except that the selected network type is used only for this connection. Type "set host /net:?" to see a list. /NETWORK-TYPE:COMMAND means to make the connection through the given system command, such as "rlogin" or "cu". /CONNECT Enter CONNECT (terminal) mode automatically if the connection is successful. /SERVER Enter server mode automatically if the connection is successful. /USERID:[] Equivalent to SET LOGIN USER . Sets the value of (userid) to . This value is sent to the host during TELNET NEW-ENVIRONMENT and TELNET AUTHENTICATION negotiations. This change is permanent. An empty is accepted.The protocol-switches can be: /NO-TELNET-INIT Do not send initial Telnet negotiations even if this is a Telnet port. /RAW-SOCKET This is a connection to a raw TCP socket. /RLOGIN Use Rlogin protocol even if this is not an Rlogin port. /TELNET Send initial Telnet negotiations even if this is not a Telnet port. SET HOST kermit.columbia.edu SET HOST /CONNECT kermit.columbia.edu SET HOST * 1649 SET HOST /SERVER * 1649 SET HOST 128.59.39.2 SET HOST madlab.sprl.umich.edu 3000 SET HOST xyzcorp.com 2000 /RAW-SOCKET SET HOST /CONNECT /COMMAND rlogin xyzcorp.comThe TELNET command is equivalent to SET NETWORK TYPE TCP/IP,SET HOST name [ port ] /TELNET, IF SUCCESS CONNECTAlso see SET NETWORK, TELNET, SET TELNET.Syntax: SET NETWORK { TYPE network-type, DIRECTORY [ file(s)... ] }Select the type of network to be used with SET HOST connections: SET NETWORK TYPE COMMAND ; Make a connection through an external command SET NETWORK TYPE TCP/IP ; Internet: Telnet, Rlogin, etc.If only one network type is listed above, that is the default network forSET HOST commands. Also see SET HOST, TELNET, RLOGIN.SET NETWORK DIRECTORY [ file [ file [ ... ] ] ] Specifies the name(s) of zero or more network directory files, similar to dialing directories (HELP DIAL for details). The general format of a network directory entry is: name network-type address [ network-specific-info ] [ ; comment ] For TCP/IP, the format is: name tcp/ip ip-hostname-or-address [ socket ] [ ; comment ]You can have multiple network directories and you can have multiple entrieswith the same name. SET HOST and TELNET commands look up thegiven in the directory and, if found, fill in the additional itemsfrom the entry, and then try all matching entries until one succeeds.SET TCP ADDRESS This allows a specific IP Address on a multihomed host to be used instead of allowing the TCP/IP stack to choose. This may be necessary when using authentication or listening for an incoming connection. Specify no to remove the preference.SET TCP KEEPALIVE { ON, OFF } Setting this ON might help to detect broken connections more quickly. (default is ON.)SET TCP LINGER { ON [timeout], OFF } Setting this ON ensures that a connection doesn't close before all outstanding data has been transferred and acknowledged. The timeout is measured in 10ths of milliseconds. The default is ON with a timeout of 0.SET TCP NODELAY { ON, OFF } ON means send short TCP packets immediately rather than waiting to accumulate a bunch of them before transmitting (Nagle Algorithm). (default is OFF.)SET TCP RECVBUF SET TCP SENDBUF TCP receive and send buffer sizes. (default is -1, use system defaults.)These items let you tune TCP networking performance on a per-connectionbasis by adjusting parameters you normally would not have access to. Youshould use these commands only if you feel that the TCP/IP protocol stackthat Kermit is using is giving you inadequate performance, and then only ifyou understand the concepts (see, for example, the Comer TCP/IP books), andthen at your own risk. These settings are displayed by SHOW NETWORK. Notall options are necessarily available in all Kermit versions; it depends onthe underlying TCP/IP services.The following TCP and/or IP parameter(s) may also be changed:SET TCP REVERSE-DNS-LOOKUP { AUTO, ON, OFF } Tells Kermit whether to perform reverse DNS lookup on TCP/IP connections so Kermit can determine the actual hostname of the host it is connected to, which is useful for connections to host pools, and is required for Kerberos connections to host pools and for incoming connections. If the other host does not have a DNS entry, the reverse lookup could take a long time (minutes) to fail, but the connection will still be made. Turn this option OFF for speedier connections if you do not need to know exactly which host you are connected to and you are not using Kerberos. AUTO, the default, means the lookup is done on hostnames, but not on numeric IP addresses unless Kerberos support is installed.SET TELOPT [ { /CLIENT, /SERVER } ]